F477929

General Info

Members Datasets Scaffolds Average Seq Length
730 300 1460 410

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0062344|Ga0451576_0062344_1736_3052
Length 438
Sequence MKNGRLGVGFVGSGFNTRFHIQGFTGVRDADVLGVWSPNAKRAGEAAAIARRLDVGECKVYKSIADMVADPAIDGIWLSGPNHARIENVEELVDAVERGKGELRGVACEKPLARNVAEAKRVRDLTKKAGIKTGYLENQLFSPHVETGKALLWARGAATTGRPYLARAAEEHSGPHAPWFWQGTQQGGGVLNDMMCHSALLVRHLLTKPGASLSTVKPVRVTGHIASLKWSRPEYAKKLQRTMSKELDYTRAPSEDFASVMIEFATDDGFTVLGEATTSWSYVGAGLRLSAELLGPEYSMRWNSLDSGLNLFFSREVKGKAGEDLVEKQNAETGTMPVVPSEAVAYGYEAEDRHFVRAFMGKEEPRLTFEDGLEVVQLLMTAYQSAEQGRALTFPPRGLEKFVPSVARGEGLGTPSAGSNGVSGGSLKASTETRSVRA

Samples

Sample ID Description Type Environment
1 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
176 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
179 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
180 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
181 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
182 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
183 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
184 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
185 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
186 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
187 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
188 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
189 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
190 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
191 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
192 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
193 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
194 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
195 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
196 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
197 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
198 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
199 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
200 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
201 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
202 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
203 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
205 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
206 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
207 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
208 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
209 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
210 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
211 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
212 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
213 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
214 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
215 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
216 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
217 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
218 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
219 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
220 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
221 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
222 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
223 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
224 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
225 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
226 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
227 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
228 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
229 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
230 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
231 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
232 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
233 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
234 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
235 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
236 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
237 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
238 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
239 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
240 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
241 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
242 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
243 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
244 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
245 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
246 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
247 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
248 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
249 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
250 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
251 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
252 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
253 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
254 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
255 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
256 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
257 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
258 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
259 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
260 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
261 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
262 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
263 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
264 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
265 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
266 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
267 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
268 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
277 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
278 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
279 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
280 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
281 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
282 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
283 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
284 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
285 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
287 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
288 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
289 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
290 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
291 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
292 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
293 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
294 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
295 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
296 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
297 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
298 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
299 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
300 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.14
Nodule 0
Rhizoplane 1.1
Rhizosphere 98.08
Stem 0
Stem Tuber 0
Unclassified 2.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451576_0062344 3300045051 Bacteria 3887
2 JGI25406J46586_10002739 3300003203 Bacteria 8295
3 rootL2_10210485 3300003322 Bacteria 2538
4 Ga0065707_10083036 3300005295 Bacteria 10717
5 Ga0065707_10112941 3300005295 Bacteria 2344
6 Ga0070658_10042001 3300005327 Bacteria 3690
7 Ga0070658_10090993 3300005327 Bacteria 2514
8 Ga0070676_10090180 3300005328 Bacteria 1877
9 Ga0070683_100000947 3300005329 Bacteria 21595
10 Ga0070683_100012756 3300005329 Bacteria 7309
11 Ga0070683_100015226 3300005329 Bacteria 6752
12 Ga0070683_100027400 3300005329 Bacteria 5139
13 Ga0070683_100033372 3300005329 Bacteria 4694
14 Ga0070683_100040925 3300005329 Bacteria 4262
15 Ga0070683_100043564 3300005329 Bacteria 4136
16 Ga0070683_100069483 3300005329 Bacteria 3284
17 Ga0070683_100214279 3300005329 Bacteria 1830
18 Ga0070683_100217042 3300005329 Bacteria 1818
19 Ga0070690_100031688 3300005330 Bacteria 3295
20 Ga0070690_100058574 3300005330 Bacteria 2474
21 Ga0070690_100151711 3300005330 Bacteria 1582
22 Ga0070670_100063047 3300005331 Bacteria 3181
23 Ga0068869_100002109 3300005334 Bacteria 11951
24 Ga0068869_100015616 3300005334 Bacteria 5101
25 Ga0070666_10144688 3300005335 Unclassified 1657
26 Ga0070680_100009023 3300005336 Bacteria 7647
27 Ga0070680_100009769 3300005336 Bacteria 7385
28 Ga0070680_100012507 3300005336 Bacteria 6597
29 Ga0070680_100013291 3300005336 Bacteria 6411
30 Ga0070682_100000902 3300005337 Bacteria 17347
31 Ga0070682_100051681 3300005337 Bacteria 2569
32 Ga0068868_100007457 3300005338 Bacteria 7791
33 Ga0070660_100030680 3300005339 Bacteria 4033
34 Ga0070660_100032963 3300005339 Bacteria 3902
35 Ga0070660_100095107 3300005339 Bacteria 2354
36 Ga0070660_100102637 3300005339 Bacteria 2267
37 Ga0070689_100006653 3300005340 Bacteria 8027
38 Ga0070691_10034813 3300005341 Bacteria 2371
39 Ga0070687_100006856 3300005343 Bacteria 4701
40 Ga0070687_100049396 3300005343 Bacteria 2167
41 Ga0070661_100016980 3300005344 Bacteria 5156
42 Ga0070661_100083520 3300005344 Bacteria 2359
43 Ga0070661_100105281 3300005344 Bacteria 2102
44 Ga0070668_100001609 3300005347 Bacteria 16347
45 Ga0070668_100002137 3300005347 Bacteria 14459
46 Ga0070669_100007688 3300005353 Bacteria 7707
47 Ga0070669_100048397 3300005353 Bacteria 3103
48 Ga0070669_100049308 3300005353 Bacteria 3074
49 Ga0070675_100001846 3300005354 Bacteria 15611
50 Ga0070675_100015388 3300005354 Bacteria 6047
51 Ga0070675_100019186 3300005354 Bacteria 5447
52 Ga0070671_100242572 3300005355 Bacteria 1530
53 Ga0070674_100000286 3300005356 Bacteria 24776
54 Ga0070674_100104416 3300005356 Bacteria 2070
55 Ga0070674_100242829 3300005356 Bacteria 1411
56 Ga0070688_100033609 3300005365 Bacteria 3101
57 Ga0070688_100057642 3300005365 Bacteria 2442
58 Ga0070659_100018857 3300005366 Bacteria 5211
59 Ga0070659_100019214 3300005366 Bacteria 5172
60 Ga0070659_100038775 3300005366 Bacteria 3717
61 Ga0070659_100139465 3300005366 Bacteria 1973
62 Ga0070667_100063555 3300005367 Bacteria 3129
63 Ga0070703_10022861 3300005406 Bacteria 1838
64 Ga0070709_10014410 3300005434 Bacteria 4471
65 Ga0070709_10024096 3300005434 Bacteria 3580
66 Ga0070713_100000276 3300005436 Bacteria 33685
67 Ga0070713_100206613 3300005436 Bacteria 1776
68 Ga0070701_10001295 3300005438 Bacteria 9192
69 Ga0070701_10015313 3300005438 Bacteria 3538
70 Ga0070711_100000144 3300005439 Bacteria 38529
71 Ga0070711_100029838 3300005439 Bacteria 3604
72 Ga0070711_100054232 3300005439 Bacteria 2766
73 Ga0070711_100054233 3300005439 Bacteria 2766
74 Ga0070705_100001547 3300005440 Bacteria 12071
75 Ga0070705_100006462 3300005440 Bacteria 5750
76 Ga0070705_100067496 3300005440 Bacteria 2149
77 Ga0070700_100004464 3300005441 Bacteria 7309
78 Ga0070700_100012060 3300005441 Bacteria 4806
79 Ga0070700_100031323 3300005441 Bacteria 3186
80 Ga0070700_100058484 3300005441 Bacteria 2422
81 Ga0070694_100003671 3300005444 Bacteria 9152
82 Ga0070694_100009677 3300005444 Bacteria 5918
83 Ga0070694_100011246 3300005444 Bacteria 5541
84 Ga0070694_100014806 3300005444 Bacteria 4886
85 Ga0070694_100021072 3300005444 Bacteria 4161
86 Ga0070694_100045264 3300005444 Bacteria 2949
87 Ga0070694_100049421 3300005444 Bacteria 2833
88 Ga0070694_100057678 3300005444 Bacteria 2640
89 Ga0070694_100067570 3300005444 Bacteria 2454
90 Ga0070708_100014698 3300005445 Bacteria 6450
91 Ga0070708_100021645 3300005445 Bacteria 5441
92 Ga0070708_100025506 3300005445 Bacteria 5053
93 Ga0070663_100280619 3300005455 Bacteria 1327
94 Ga0070662_100000187 3300005457 Bacteria 35990
95 Ga0070662_100002445 3300005457 Bacteria 11435
96 Ga0070662_100011576 3300005457 Bacteria 5822
97 Ga0070662_100028398 3300005457 Bacteria 3892
98 Ga0070662_100046922 3300005457 Bacteria 3105
99 Ga0070681_10000279 3300005458 Bacteria 40944
100 Ga0070681_10011895 3300005458 Bacteria 8629
101 Ga0070681_10032032 3300005458 Bacteria 5277
102 Ga0070681_10047999 3300005458 Bacteria 4267
103 Ga0070681_10060010 3300005458 Bacteria 3782
104 Ga0070681_10172916 3300005458 Bacteria 2082
105 Ga0068867_100000244 3300005459 Bacteria 35772
106 Ga0068867_100129643 3300005459 Bacteria 1958
107 Ga0070685_10005118 3300005466 Bacteria 6643
108 Ga0070685_10007503 3300005466 Bacteria 5582
109 Ga0070706_100008213 3300005467 Bacteria 9734
110 Ga0070706_100170344 3300005467 Bacteria 2033
111 Ga0070706_100200483 3300005467 Bacteria 1864
112 Ga0070707_100118145 3300005468 Bacteria 2574
113 Ga0070698_100002426 3300005471 Bacteria 20542
114 Ga0070698_100004972 3300005471 Bacteria 14568
115 Ga0070698_100006794 3300005471 Bacteria 12402
116 Ga0070698_100013193 3300005471 Bacteria 8744
117 Ga0070698_100035299 3300005471 Bacteria 5171
118 Ga0070698_100073059 3300005471 Bacteria 3437
119 Ga0070698_100081303 3300005471 Bacteria 3235
120 Ga0070699_100000985 3300005518 Bacteria 26518
121 Ga0070699_100009683 3300005518 Bacteria 8343
122 Ga0070699_100011851 3300005518 Bacteria 7524
123 Ga0070699_100068335 3300005518 Bacteria 3086
124 Ga0070699_100103452 3300005518 Bacteria 2497
125 Ga0070679_100002633 3300005530 Bacteria 16327
126 Ga0070679_100273620 3300005530 Bacteria 1642
127 Ga0070684_100001538 3300005535 Bacteria 16659
128 Ga0070684_100002233 3300005535 Bacteria 14276
129 Ga0070684_100003708 3300005535 Bacteria 11521
130 Ga0070684_100009352 3300005535 Bacteria 7716
131 Ga0070684_100012111 3300005535 Bacteria 6898
132 Ga0070684_100019666 3300005535 Bacteria 5588
133 Ga0070684_100122883 3300005535 Bacteria 2336
134 Ga0070684_100142114 3300005535 Bacteria 2171
135 Ga0070697_100014265 3300005536 Bacteria 6244
136 Ga0070697_100016432 3300005536 Bacteria 5821
137 Ga0070672_100019827 3300005543 Bacteria 4891
138 Ga0070672_100062393 3300005543 Bacteria 2941
139 Ga0070695_100000593 3300005545 Bacteria 19143
140 Ga0070695_100004421 3300005545 Bacteria 8249
141 Ga0070695_100008635 3300005545 Bacteria 6052
142 Ga0070695_100026272 3300005545 Bacteria 3601
143 Ga0070695_100041355 3300005545 Bacteria 2921
144 Ga0070695_100224453 3300005545 Unclassified 1355
145 Ga0070696_100006790 3300005546 Bacteria 7642
146 Ga0070704_100002718 3300005549 Bacteria 10000
147 Ga0070704_100005402 3300005549 Bacteria 7441
148 Ga0070704_100005499 3300005549 Bacteria 7386
149 Ga0070704_100017890 3300005549 Bacteria 4521
150 Ga0070704_100020889 3300005549 Bacteria 4233
151 Ga0070704_100046807 3300005549 Bacteria 3019
152 Ga0070704_100109892 3300005549 Bacteria 2096
153 Ga0068855_100026047 3300005563 Bacteria 6996
154 Ga0068855_100263904 3300005563 Bacteria 1917
155 Ga0070664_100016671 3300005564 Bacteria 6024
156 Ga0070664_100042464 3300005564 Bacteria 3838
157 Ga0070664_100072535 3300005564 Bacteria 2953
158 Ga0070664_100116507 3300005564 Bacteria 2336
159 Ga0068857_100017595 3300005577 Bacteria 6267
160 Ga0068857_100021985 3300005577 Bacteria 5613
161 Ga0068857_100061097 3300005577 Bacteria 3348
162 Ga0068857_100125703 3300005577 Bacteria 2310
163 Ga0068856_100001784 3300005614 Bacteria 22483
164 Ga0068856_100049458 3300005614 Bacteria 4144
165 Ga0070702_100001139 3300005615 Bacteria 10667
166 Ga0070702_100006252 3300005615 Bacteria 5623
167 Ga0068852_100005183 3300005616 Bacteria 9295
168 Ga0068852_100036924 3300005616 Bacteria 4094
169 Ga0068852_100061770 3300005616 Bacteria 3257
170 Ga0068852_100077773 3300005616 Bacteria 2933
171 Ga0068852_100157024 3300005616 Bacteria 2120
172 Ga0068859_100010511 3300005617 Bacteria 9314
173 Ga0068859_100026803 3300005617 Bacteria 5781
174 Ga0068859_100113817 3300005617 Bacteria 2769
175 Ga0068859_100260496 3300005617 Bacteria 1825
176 Ga0068864_100041387 3300005618 Bacteria 3941
177 Ga0068864_100096722 3300005618 Bacteria 2613
178 Ga0068864_100133802 3300005618 Bacteria 2230
179 Ga0068866_10000802 3300005718 Bacteria 14039
180 Ga0068861_100004829 3300005719 Bacteria 9062
181 Ga0068861_100041249 3300005719 Bacteria 3457
182 Ga0068870_10038564 3300005840 Bacteria 2468
183 Ga0068870_10040908 3300005840 Bacteria 2406
184 Ga0068858_100048765 3300005842 Bacteria 3922
185 Ga0068858_100221402 3300005842 Bacteria 1792
186 Ga0068860_100003765 3300005843 Bacteria 15598
187 Ga0068860_100069300 3300005843 Bacteria 3352
188 Ga0068862_100005150 3300005844 Bacteria 10993
189 Ga0068862_100012977 3300005844 Bacteria 6891
190 Ga0068862_100041926 3300005844 Bacteria 3896
191 Ga0081539_10000131 3300005985 Bacteria 176467
192 Ga0081539_10033964 3300005985 Bacteria 3095
193 Ga0070717_10019150 3300006028 Bacteria 5363
194 Ga0070716_100036604 3300006173 Bacteria 2707
195 Ga0070716_100067757 3300006173 Bacteria 2086
196 Ga0070712_100005384 3300006175 Bacteria 7921
197 Ga0070712_100075874 3300006175 Bacteria 2419
198 Ga0097621_100040274 3300006237 Bacteria 3756
199 Ga0097621_100105057 3300006237 Bacteria 2380
200 Ga0097621_100339938 3300006237 Bacteria 1333
201 Ga0068871_100061024 3300006358 Bacteria 3077
202 Ga0068871_100113870 3300006358 Bacteria 2278
203 Ga0068871_100140786 3300006358 Bacteria 2051
204 Ga0075428_100046168 3300006844 Bacteria 4786
205 Ga0075428_100069388 3300006844 Bacteria 3853
206 Ga0075428_100076846 3300006844 Bacteria 3645
207 Ga0075428_100197995 3300006844 Bacteria 2173
208 Ga0075430_100014787 3300006846 Bacteria 6646
209 Ga0075431_100010206 3300006847 Bacteria 9442
210 Ga0075431_100079421 3300006847 Bacteria 3386
211 Ga0075431_100106219 3300006847 Bacteria 2897
212 Ga0075431_100304536 3300006847 Bacteria 1610
213 Ga0075433_10000656 3300006852 Bacteria 23337
214 Ga0075433_10009738 3300006852 Bacteria 7699
215 Ga0075433_10018433 3300006852 Bacteria 5802
216 Ga0075433_10021323 3300006852 Bacteria 5433
217 Ga0075434_100000545 3300006871 Bacteria 28731
218 Ga0075434_100000640 3300006871 Bacteria 27055
219 Ga0075434_100006465 3300006871 Bacteria 10739
220 Ga0075434_100036983 3300006871 Bacteria 4830
221 Ga0075434_100079898 3300006871 Bacteria 3267
222 Ga0075434_100233889 3300006871 Bacteria 1857
223 Ga0075429_100009485 3300006880 Bacteria 8444
224 Ga0068865_100003500 3300006881 Bacteria 9412
225 Ga0068865_100022872 3300006881 Bacteria 4085
226 Ga0075436_100003674 3300006914 Bacteria 10512
227 Ga0075436_100005735 3300006914 Bacteria 8530
228 Ga0075436_100050137 3300006914 Bacteria 2880
229 Ga0097620_100010511 3300006931 Bacteria 9314
230 Ga0097620_100026803 3300006931 Bacteria 5781
231 Ga0097620_100113818 3300006931 Bacteria 2769
232 Ga0097620_100260473 3300006931 Bacteria 1825
233 Ga0075435_100015200 3300007076 Bacteria 5781
234 Ga0075435_100132881 3300007076 Bacteria 2083
235 Ga0075435_100306438 3300007076 Bacteria 1359
236 Ga0099794_10000131 3300007265 Bacteria 27266
237 Ga0105240_10020323 3300009093 Bacteria 8861
238 Ga0105240_10129826 3300009093 Bacteria 3024
239 Ga0105240_10298478 3300009093 Bacteria 1844
240 Ga0111539_10004126 3300009094 Bacteria 19069
241 Ga0111539_10016058 3300009094 Bacteria 9292
242 Ga0111539_10061007 3300009094 Bacteria 4468
243 Ga0111539_10103557 3300009094 Bacteria 3340
244 Ga0111539_10114546 3300009094 Bacteria 3162
245 Ga0105245_10007450 3300009098 Bacteria 9584
246 Ga0114129_10039535 3300009147 Bacteria 6651
247 Ga0114129_10198646 3300009147 Bacteria 2718
248 Ga0114129_10278060 3300009147 Bacteria 2238
249 Ga0105243_10002354 3300009148 Bacteria 15819
250 Ga0105241_10014823 3300009174 Bacteria 5707
251 Ga0105241_10073395 3300009174 Bacteria 2662
252 Ga0105242_10000259 3300009176 Bacteria 41912
253 Ga0105242_10263951 3300009176 Bacteria 1557
254 Ga0105248_10041331 3300009177 Bacteria 5169
255 Ga0105248_10066502 3300009177 Bacteria 4047
256 Ga0105248_10220313 3300009177 Bacteria 2136
257 Ga0105237_10195983 3300009545 Unclassified 2020
258 Ga0105237_10234743 3300009545 Bacteria 1835
259 Ga0105238_10001391 3300009551 Bacteria 24270
260 Ga0105238_10169297 3300009551 Bacteria 2161
261 Ga0105238_10382975 3300009551 Bacteria 1398
262 Ga0105249_10001176 3300009553 Bacteria 23184
263 Ga0105249_10108302 3300009553 Bacteria 2623
264 Ga0105239_10013524 3300010375 Bacteria 9060
265 Ga0105239_10276340 3300010375 Bacteria 1890
266 Ga0105246_10007787 3300011119 Bacteria 6576
267 Ga0105246_10023745 3300011119 Bacteria 3971
268 Ga0105246_10070830 3300011119 Bacteria 2453
269 Ga0157373_10020582 3300013100 Bacteria 4793
270 Ga0157371_10039047 3300013102 Bacteria 3396
271 Ga0157370_10000364 3300013104 Bacteria 57195
272 Ga0157370_10039944 3300013104 Bacteria 4533
273 Ga0157370_10191161 3300013104 Bacteria 1900
274 Ga0157369_10425507 3300013105 Bacteria 1377
275 Ga0157374_10080151 3300013296 Bacteria 3096
276 Ga0157378_10067087 3300013297 Bacteria 3214
277 Ga0163162_10002300 3300013306 Bacteria 17935
278 Ga0163162_10017788 3300013306 Bacteria 6955
279 Ga0157372_10001745 3300013307 Bacteria 23584
280 Ga0157372_10016526 3300013307 Bacteria 7919
281 Ga0157372_10020178 3300013307 Bacteria 7186
282 Ga0157372_10055638 3300013307 Bacteria 4419
283 Ga0157372_10066403 3300013307 Bacteria 4052
284 Ga0157375_10016600 3300013308 Bacteria 6620
285 Ga0157375_10022412 3300013308 Bacteria 5814
286 Ga0157375_10065318 3300013308 Bacteria 3627
287 Ga0157375_10104628 3300013308 Bacteria 2919
288 Ga0163163_10031980 3300014325 Bacteria 5081
289 Ga0163163_10039614 3300014325 Bacteria 4600
290 Ga0163163_10122991 3300014325 Bacteria 2630
291 Ga0157380_10008553 3300014326 Bacteria 7316
292 Ga0157380_10033413 3300014326 Unclassified 3960
293 Ga0157380_10054546 3300014326 Bacteria 3172
294 Ga0157380_10143944 3300014326 Bacteria 2052
295 Ga0157377_10010673 3300014745 Bacteria 4554
296 Ga0157379_10017436 3300014968 Bacteria 6323
297 Ga0157379_10026619 3300014968 Bacteria 5148
298 Ga0157376_10202833 3300014969 Unclassified 1826
299 Ga0163161_10007256 3300017792 Bacteria 7657
300 Ga0163161_10051599 3300017792 Bacteria 2980
301 Ga0207697_10003869 3300025315 Bacteria 7300
302 Ga0207656_10021618 3300025321 Bacteria 2572
303 Ga0207653_10000147 3300025885 Bacteria 49999
304 Ga0207653_10006468 3300025885 Bacteria 3655
305 Ga0207642_10014461 3300025899 Bacteria 2913
306 Ga0207642_10047211 3300025899 Bacteria 1924
307 Ga0207688_10045914 3300025901 Bacteria 2438
308 Ga0207680_10007200 3300025903 Bacteria 5409
309 Ga0207699_10002415 3300025906 Bacteria 8822
310 Ga0207699_10006674 3300025906 Bacteria 5599
311 Ga0207645_10000159 3300025907 Bacteria 53280
312 Ga0207645_10002586 3300025907 Bacteria 14109
313 Ga0207645_10003441 3300025907 Bacteria 12023
314 Ga0207645_10057519 3300025907 Bacteria 2483
315 Ga0207643_10002397 3300025908 Bacteria 10155
316 Ga0207643_10011811 3300025908 Bacteria 4714
317 Ga0207643_10032903 3300025908 Bacteria 2899
318 Ga0207705_10006920 3300025909 Bacteria 8375
319 Ga0207705_10022583 3300025909 Bacteria 4487
320 Ga0207705_10025070 3300025909 Bacteria 4257
321 Ga0207684_10007540 3300025910 Bacteria 9787
322 Ga0207684_10011317 3300025910 Bacteria 7811
323 Ga0207684_10119171 3300025910 Bacteria 2262
324 Ga0207684_10194218 3300025910 Bacteria 1751
325 Ga0207654_10006256 3300025911 Bacteria 5985
326 Ga0207654_10139947 3300025911 Bacteria 1542
327 Ga0207707_10070917 3300025912 Bacteria 3036
328 Ga0207707_10178439 3300025912 Bacteria 1855
329 Ga0207695_10000803 3300025913 Bacteria 58645
330 Ga0207695_10120743 3300025913 Bacteria 2589
331 Ga0207693_10021294 3300025915 Bacteria 5152
332 Ga0207693_10066382 3300025915 Bacteria 2825
333 Ga0207663_10000053 3300025916 Bacteria 62261
334 Ga0207663_10033260 3300025916 Bacteria 3070
335 Ga0207663_10073174 3300025916 Bacteria 2217
336 Ga0207660_10004496 3300025917 Bacteria 9095
337 Ga0207660_10006018 3300025917 Bacteria 7873
338 Ga0207660_10009757 3300025917 Bacteria 6214
339 Ga0207660_10010094 3300025917 Bacteria 6117
340 Ga0207660_10013704 3300025917 Bacteria 5319
341 Ga0207660_10015394 3300025917 Bacteria 5047
342 Ga0207660_10121423 3300025917 Bacteria 1979
343 Ga0207660_10199651 3300025917 Bacteria 1562
344 Ga0207662_10001829 3300025918 Bacteria 10452
345 Ga0207657_10003488 3300025919 Bacteria 16784
346 Ga0207657_10010128 3300025919 Bacteria 9422
347 Ga0207657_10029521 3300025919 Bacteria 4989
348 Ga0207657_10045016 3300025919 Bacteria 3876
349 Ga0207657_10080162 3300025919 Bacteria 2745
350 Ga0207657_10144821 3300025919 Bacteria 1939
351 Ga0207649_10026955 3300025920 Bacteria 3367
352 Ga0207649_10065938 3300025920 Bacteria 2293
353 Ga0207652_10003358 3300025921 Bacteria 13216
354 Ga0207652_10078577 3300025921 Bacteria 2881
355 Ga0207652_10144502 3300025921 Bacteria 2128
356 Ga0207646_10003926 3300025922 Bacteria 16511
357 Ga0207646_10004004 3300025922 Bacteria 16302
358 Ga0207646_10049811 3300025922 Bacteria 3750
359 Ga0207646_10283862 3300025922 Bacteria 1496
360 Ga0207681_10015094 3300025923 Bacteria 4816
361 Ga0207681_10018871 3300025923 Bacteria 4349
362 Ga0207681_10115849 3300025923 Bacteria 1957
363 Ga0207694_10000038 3300025924 Bacteria 186790
364 Ga0207694_10053892 3300025924 Bacteria 3120
365 Ga0207659_10022011 3300025926 Bacteria 4240
366 Ga0207659_10024328 3300025926 Bacteria 4056
367 Ga0207659_10024391 3300025926 Bacteria 4051
368 Ga0207659_10032688 3300025926 Bacteria 3574
369 Ga0207659_10116244 3300025926 Bacteria 2042
370 Ga0207687_10036945 3300025927 Bacteria 3330
371 Ga0207687_10143667 3300025927 Unclassified 1813
372 Ga0207700_10003899 3300025928 Bacteria 8711
373 Ga0207700_10022119 3300025928 Bacteria 4356
374 Ga0207664_10148095 3300025929 Bacteria 1992
375 Ga0207644_10203661 3300025931 Bacteria 1562
376 Ga0207690_10005968 3300025932 Bacteria 7213
377 Ga0207706_10000215 3300025933 Bacteria 63479
378 Ga0207706_10002234 3300025933 Bacteria 18904
379 Ga0207706_10003371 3300025933 Bacteria 15280
380 Ga0207706_10006000 3300025933 Bacteria 11296
381 Ga0207706_10144205 3300025933 Bacteria 2095
382 Ga0207686_10000068 3300025934 Bacteria 94208
383 Ga0207686_10044267 3300025934 Bacteria 2732
384 Ga0207709_10004505 3300025935 Bacteria 8038
385 Ga0207670_10024478 3300025936 Bacteria 3773
386 Ga0207670_10196872 3300025936 Bacteria 1528
387 Ga0207669_10002821 3300025937 Bacteria 7448
388 Ga0207669_10027693 3300025937 Bacteria 3107
389 Ga0207669_10056510 3300025937 Bacteria 2384
390 Ga0207669_10159927 3300025937 Bacteria 1590
391 Ga0207704_10000531 3300025938 Bacteria 16983
392 Ga0207704_10067239 3300025938 Bacteria 2253
393 Ga0207665_10014938 3300025939 Bacteria 5101
394 Ga0207665_10018265 3300025939 Bacteria 4606
395 Ga0207691_10001081 3300025940 Bacteria 27139
396 Ga0207691_10003716 3300025940 Bacteria 14808
397 Ga0207691_10004595 3300025940 Bacteria 13365
398 Ga0207691_10039419 3300025940 Bacteria 4371
399 Ga0207711_10001842 3300025941 Bacteria 19338
400 Ga0207711_10204428 3300025941 Bacteria 1803
401 Ga0207689_10000620 3300025942 Bacteria 33953
402 Ga0207689_10001946 3300025942 Bacteria 19554
403 Ga0207689_10058736 3300025942 Bacteria 3164
404 Ga0207661_10002153 3300025944 Bacteria 13566
405 Ga0207661_10008530 3300025944 Bacteria 7323
406 Ga0207661_10016654 3300025944 Bacteria 5425
407 Ga0207661_10016710 3300025944 Bacteria 5416
408 Ga0207661_10026635 3300025944 Bacteria 4408
409 Ga0207661_10029645 3300025944 Bacteria 4206
410 Ga0207661_10035341 3300025944 Bacteria 3893
411 Ga0207661_10036036 3300025944 Bacteria 3860
412 Ga0207661_10049706 3300025944 Bacteria 3338
413 Ga0207661_10083114 3300025944 Bacteria 2649
414 Ga0207661_10115747 3300025944 Bacteria 2275
415 Ga0207679_10001793 3300025945 Bacteria 13367
416 Ga0207679_10110260 3300025945 Bacteria 2170
417 Ga0207679_10117535 3300025945 Bacteria 2110
418 Ga0207667_10022116 3300025949 Bacteria 7034
419 Ga0207667_10036968 3300025949 Bacteria 5225
420 Ga0207667_10045151 3300025949 Bacteria 4667
421 Ga0207667_10059225 3300025949 Bacteria 4012
422 Ga0207667_10139474 3300025949 Bacteria 2496
423 Ga0207667_10151558 3300025949 Bacteria 2386
424 Ga0207667_10154910 3300025949 Bacteria 2358
425 Ga0207712_10023027 3300025961 Bacteria 4107
426 Ga0207668_10004666 3300025972 Bacteria 8062
427 Ga0207640_10002132 3300025981 Bacteria 10625
428 Ga0207640_10080609 3300025981 Bacteria 2222
429 Ga0207658_10071248 3300025986 Bacteria 2632
430 Ga0207658_10100549 3300025986 Bacteria 2264
431 Ga0207658_10106834 3300025986 Bacteria 2205
432 Ga0207703_10072684 3300026035 Bacteria 2843
433 Ga0207703_10222748 3300026035 Bacteria 1687
434 Ga0207678_10002057 3300026067 Bacteria 18237
435 Ga0207678_10052928 3300026067 Bacteria 3500
436 Ga0207678_10078814 3300026067 Bacteria 2821
437 Ga0207678_10128696 3300026067 Bacteria 2159
438 Ga0207708_10011420 3300026075 Bacteria 6614
439 Ga0207708_10039259 3300026075 Bacteria 3607
440 Ga0207708_10058882 3300026075 Bacteria 2931
441 Ga0207708_10125277 3300026075 Bacteria 2004
442 Ga0207702_10034800 3300026078 Bacteria 4213
443 Ga0207702_10062893 3300026078 Bacteria 3172
444 Ga0207702_10411803 3300026078 Bacteria 1306
445 Ga0207648_10000196 3300026089 Bacteria 63696
446 Ga0207648_10003258 3300026089 Bacteria 17075
447 Ga0207648_10018691 3300026089 Bacteria 6268
448 Ga0207676_10002313 3300026095 Bacteria 13675
449 Ga0207676_10013497 3300026095 Bacteria 5867
450 Ga0207676_10087212 3300026095 Bacteria 2552
451 Ga0207676_10098074 3300026095 Bacteria 2422
452 Ga0207674_10000033 3300026116 Bacteria 142149
453 Ga0207674_10002793 3300026116 Bacteria 21728
454 Ga0207674_10010447 3300026116 Bacteria 10514
455 Ga0207674_10028765 3300026116 Bacteria 5861
456 Ga0207674_10087835 3300026116 Bacteria 3102
457 Ga0207675_100000209 3300026118 Bacteria 54603
458 Ga0207675_100001013 3300026118 Bacteria 27815
459 Ga0207675_100016877 3300026118 Bacteria 6821
460 Ga0207675_100218347 3300026118 Bacteria 1836
461 Ga0207683_10000999 3300026121 Bacteria 25886
462 Ga0207683_10064659 3300026121 Bacteria 3224
463 Ga0207683_10069138 3300026121 Bacteria 3118
464 Ga0207698_10017201 3300026142 Bacteria 4899
465 Ga0207698_10025313 3300026142 Bacteria 4178
466 Ga0207698_10140401 3300026142 Bacteria 2080
467 Ga0209970_1003539 3300027614 Bacteria 2619
468 Ga0210002_1002491 3300027617 Bacteria 2660
469 Ga0209983_1002646 3300027665 Bacteria 3887
470 Ga0209588_1003163 3300027671 Bacteria 4540
471 Ga0209588_1004925 3300027671 Bacteria 3797
472 Ga0209588_1015858 3300027671 Bacteria 2319
473 Ga0209971_1004726 3300027682 Bacteria 3231
474 Ga0209998_10005562 3300027717 Bacteria 2635
475 Ga0207428_10002246 3300027907 Bacteria 19394
476 Ga0207428_10101105 3300027907 Bacteria 2228
477 Ga0268265_10004895 3300028380 Bacteria 9224
478 Ga0268265_10090652 3300028380 Bacteria 2442
479 Ga0268265_10160450 3300028380 Bacteria 1909
480 Ga0268264_10003466 3300028381 Bacteria 13606
481 Ga0268264_10035307 3300028381 Bacteria 4115
482 Ga0307408_100000917 3300031548 Bacteria 23008
483 Ga0307408_100015897 3300031548 Bacteria 5016
484 Ga0307405_10034677 3300031731 Bacteria 3005
485 Ga0307413_10005772 3300031824 Bacteria 5569
486 Ga0307413_10076559 3300031824 Bacteria 2127
487 Ga0307410_10003949 3300031852 Bacteria 7554
488 Ga0307410_10113126 3300031852 Bacteria 1967
489 Ga0307406_10010515 3300031901 Bacteria 5222
490 Ga0307406_10032097 3300031901 Bacteria 3203
491 Ga0307406_10050008 3300031901 Bacteria 2647
492 Ga0307406_10139153 3300031901 Bacteria 1716
493 Ga0307407_10021581 3300031903 Bacteria 3324
494 Ga0307412_10001081 3300031911 Bacteria 15577
495 Ga0307412_10009827 3300031911 Bacteria 5495
496 Ga0307409_100026742 3300031995 Bacteria 4075
497 Ga0307409_100033368 3300031995 Unclassified 3745
498 Ga0307409_100036735 3300031995 Bacteria 3605
499 Ga0307409_100037613 3300031995 Bacteria 3569
500 Ga0307409_100350329 3300031995 Bacteria 1393
501 Ga0307416_100001594 3300032002 Bacteria 12454
502 Ga0307416_100054735 3300032002 Bacteria 3208
503 Ga0307416_100076108 3300032002 Bacteria 2811
504 Ga0307416_100118720 3300032002 Bacteria 2351
505 Ga0307416_100254549 3300032002 Bacteria 1711
506 Ga0307414_10075930 3300032004 Bacteria 2440
507 Ga0307414_10173077 3300032004 Bacteria 1728
508 Ga0307411_10004373 3300032005 Bacteria 6757
509 Ga0307411_10028496 3300032005 Bacteria 3396
510 Ga0307411_10043265 3300032005 Bacteria 2880
511 Ga0307411_10086811 3300032005 Bacteria 2171
512 Ga0307415_100050697 3300032126 Bacteria 2813
513 Ga0307415_100079685 3300032126 Bacteria 2334
514 Ga0373934_0000939 3300035086 Bacteria 10543
515 Ga0373923_0008175 3300035111 Bacteria 3717
516 Ga0373953_0022967 3300035117 Bacteria 2358
517 Ga0373954_0009334 3300035118 Bacteria 4315
518 Ga0373956_0073777 3300035119 Bacteria 1559
519 Ga0373960_0017304 3300035121 Bacteria 1867
520 Ga0373943_0001928 3300035170 Bacteria 9395
521 Ga0373943_0036306 3300035170 Bacteria 2360
522 Ga0373946_0001769 3300035171 Bacteria 7531
523 Ga0373955_0008333 3300035172 Bacteria 4810
524 Ga0373955_0018838 3300035172 Bacteria 3441
525 Ga0373935_0005553 3300035692 Bacteria 7430
526 Ga0373927_0003285 3300035695 Bacteria 11628
527 Ga0373927_0124561 3300035695 Bacteria 1682
528 Ga0373933_0000586 3300035724 Bacteria 22744
529 Ga0373933_0007451 3300035724 Bacteria 5973
530 Ga0373933_0026941 3300035724 Bacteria 3306
531 Ga0373933_0093857 3300035724 Bacteria 1855
532 Ga0373947_0029673 3300035725 Bacteria 3210
533 Ga0373937_0000043 3300036401 Bacteria 108234
534 Ga0373937_0000105 3300036401 Bacteria 80211
535 Ga0373937_0002432 3300036401 Bacteria 15480
536 Ga0373937_0010062 3300036401 Bacteria 8247
537 Ga0373925_0008429 3300037068 Bacteria 7508
538 Ga0373925_0017773 3300037068 Bacteria 5160
539 Ga0395899_0084381 3300037312 Bacteria 2309
540 Ga0395900_0008793 3300037418 Bacteria 10376
541 Ga0395905_0016860 3300037471 Bacteria 6941
542 Ga0395905_0026727 3300037471 Bacteria 5442
543 Ga0242420_000442 3300038996 Bacteria 4688
544 Ga0436365_0171095 3300039437 Bacteria 1408
545 Ga0436365_0725081 3300039437 Bacteria 1747
546 Ga0436365_1596989 3300039437 Bacteria 1958
547 Ga0436363_0413121 3300039450 Bacteria 7511
548 Ga0439431_0002374 3300041997 Bacteria 4166
549 Ga0450923_015094 3300042125 Bacteria 1440
550 Ga0451577_0009243 3300042876 Bacteria 9503
551 Ga0451577_0009911 3300042876 Bacteria 9132
552 Ga0451577_0042814 3300042876 Bacteria 4058
553 Ga0451577_0046228 3300042876 Bacteria 3895
554 Ga0451577_0070501 3300042876 Bacteria 3117
555 Ga0451577_0106606 3300042876 Bacteria 2505
556 Ga0453683_0024719 3300044673 Bacteria 3820
557 Ga0466966_0144050 3300044684 Bacteria 1455
558 Ga0466963_0144160 3300044694 Bacteria 1652
559 Ga0453684_0000332 3300044712 Bacteria 197651
560 Ga0453684_0051332 3300044712 Bacteria 5408
561 Ga0453684_0217724 3300044712 Bacteria 2214
562 Ga0466959_0062386 3300045049 Bacteria 2709
563 Ga0451576_0005790 3300045051 Bacteria 15371
564 Ga0451576_0014776 3300045051 Bacteria 8677
565 Ga0451576_0049577 3300045051 Bacteria 4406
566 Ga0451576_0057606 3300045051 Bacteria 4062
567 Ga0451576_0174112 3300045051 Unclassified 2246
568 Ga0451576_0175148 3300045051 Unclassified 2239
569 Ga0451576_0188455 3300045051 Bacteria 2154
570 Ga0451576_0218385 3300045051 Bacteria 1991
571 Ga0451576_0228195 3300045051 Bacteria 1944
572 Ga0466967_0023894 3300045976 Bacteria 5017
573 Ga0466967_0033928 3300045976 Bacteria 4325
574 Ga0466967_0212567 3300045976 Bacteria 1835
575 Ga0495603_0000253 3300046455 Bacteria 28050
576 Ga0495629_0001592 3300046459 Bacteria 17857
577 Ga0495629_0018183 3300046459 Bacteria 5036
578 Ga0495629_0196220 3300046459 Bacteria 1396
579 Ga0495651_0001415 3300046462 Bacteria 18617
580 Ga0495651_0009151 3300046462 Bacteria 7602
581 Ga0495651_0160092 3300046462 Bacteria 1614
582 Ga0495653_0000224 3300046463 Bacteria 46278
583 Ga0495580_0002193 3300046472 Bacteria 17090
584 Ga0495580_0180612 3300046472 Bacteria 1457
585 Ga0495582_0004961 3300046473 Bacteria 7455
586 Ga0495639_0000850 3300046475 Bacteria 13870
587 Ga0495639_0051920 3300046475 Bacteria 1865
588 Ga0495664_0015075 3300046477 Bacteria 4391
589 Ga0495594_0002756 3300046499 Bacteria 9116
590 Ga0495594_0013123 3300046499 Bacteria 4320
591 Ga0495594_0029996 3300046499 Unclassified 2941
592 Ga0495594_0046579 3300046499 Bacteria 2382
593 Ga0495608_0007577 3300046511 Bacteria 7656
594 Ga0495608_0092918 3300046511 Unclassified 1949
595 Ga0495618_0037710 3300046514 Bacteria 3036
596 Ga0495628_0007479 3300046516 Bacteria 9449
597 Ga0495628_0020059 3300046516 Bacteria 5517
598 Ga0495630_0002301 3300046517 Bacteria 13291
599 Ga0495630_0032328 3300046517 Bacteria 3898
600 Ga0495643_0000008 3300046522 Bacteria 367010
601 Ga0495652_0002064 3300046529 Bacteria 21254
602 Ga0495665_0014829 3300046531 Bacteria 4198
603 Ga0495640_0093468 3300046533 Bacteria 1982
604 Ga0495586_0004677 3300046535 Bacteria 7318
605 Ga0495587_0000832 3300046536 Bacteria 20408
606 Ga0495587_0003148 3300046536 Bacteria 11027
607 Ga0495587_0003161 3300046536 Bacteria 11008
608 Ga0495587_0015785 3300046536 Bacteria 4708
609 Ga0495621_0006884 3300046539 Bacteria 3342
610 Ga0495645_0000165 3300046543 Bacteria 45764
611 Ga0495645_0002257 3300046543 Bacteria 13111
612 Ga0495645_0029719 3300046543 Bacteria 3976
613 Ga0495645_0048683 3300046543 Bacteria 3086
614 Ga0495622_0049207 3300046557 Bacteria 1957
615 Ga0495667_0000538 3300046559 Bacteria 24210
616 Ga0495667_0001933 3300046559 Bacteria 13697
617 Ga0495667_0002068 3300046559 Bacteria 13321
618 Ga0495635_0000486 3300046663 Bacteria 25064
619 Ga0495635_0103766 3300046663 Bacteria 1943
620 Ga0495588_0000360 3300046674 Bacteria 28282
621 Ga0495657_0000031 3300046675 Bacteria 124359
622 Ga0495657_0067767 3300046675 Bacteria 2341
623 Ga0495657_0107988 3300046675 Bacteria 1766
624 Ga0495599_0001012 3300046678 Bacteria 15805
625 Ga0495599_0001165 3300046678 Bacteria 14919
626 Ga0495599_0040360 3300046678 Bacteria 2931
627 Ga0495623_0000150 3300046679 Bacteria 42942
628 Ga0495623_0002759 3300046679 Bacteria 11602
629 Ga0495623_0018528 3300046679 Bacteria 4496
630 Ga0495646_0006059 3300046680 Bacteria 7670
631 Ga0495658_0000184 3300046683 Bacteria 36090
632 Ga0495658_0009058 3300046683 Bacteria 4949
633 Ga0495669_0036318 3300046684 Bacteria 2178
634 Ga0495613_0046281 3300046689 Bacteria 3217
635 Ga0495600_0000793 3300046809 Bacteria 16700
636 Ga0495600_0032221 3300046809 Bacteria 3400
637 Ga0495581_0013005 3300047315 Bacteria 4824
638 Ga0495604_0000068 3300047317 Bacteria 90073
639 Ga0495604_0146365 3300047317 Bacteria 1683
640 Ga0495674_0013069 3300047319 Bacteria 7813
641 Ga0495680_0008415 3300047322 Bacteria 9385
642 Ga0495675_0005272 3300047444 Bacteria 7874
643 Ga0495675_0010895 3300047444 Bacteria 5698
644 Ga0495675_0012684 3300047444 Bacteria 5304
645 Ga0495675_0013273 3300047444 Bacteria 5199
646 Ga0495675_0082649 3300047444 Bacteria 2022
647 Ga0495675_0162326 3300047444 Bacteria 1375
648 Ga0495684_0000829 3300047471 Bacteria 25034
649 Ga0495684_0002697 3300047471 Bacteria 14054
650 Ga0495684_0086856 3300047471 Bacteria 2371
651 Ga0495593_0000876 3300047673 Bacteria 17442
652 Ga0495602_0003605 3300048088 Bacteria 16041
653 Ga0495602_0064541 3300048088 Bacteria 3165
654 Ga0496101_0161139 3300048904 Bacteria 1720
655 Ga0496104_0003566 3300048907 Bacteria 13431
656 Ga0496106_0082344 3300048909 Bacteria 2474
657 Ga0496112_0132830 3300048915 Bacteria 2460
658 Ga0496113_0038997 3300048916 Bacteria 3495
659 Ga0496113_0113236 3300048916 Bacteria 2114
660 Ga0496114_0001877 3300048917 Bacteria 15935
661 Ga0496115_0002432 3300048918 Bacteria 13369
662 Ga0501032_0033060 3300049569 Bacteria 3545
663 Ga0501032_0053891 3300049569 Bacteria 2708
664 Ga0501033_0037743 3300049570 Bacteria 3615
665 Ga0501034_0047254 3300049571 Bacteria 4348
666 Ga0501034_0058480 3300049571 Bacteria 3875
667 Ga0501037_0116426 3300049573 Bacteria 1923
668 Ga0501038_0076360 3300049574 Bacteria 2830
669 Ga0501038_0128620 3300049574 Bacteria 2082
670 Ga0501039_0087936 3300049575 Bacteria 2421
671 Ga0501042_0016997 3300049578 Bacteria 5009
672 Ga0501047_0002515 3300049581 Bacteria 17482
673 Ga0501067_0084054 3300049583 Bacteria 1766
674 Ga0501068_0047867 3300049584 Bacteria 2580
675 Ga0501069_0031672 3300049585 Bacteria 2910
676 Ga0501070_0145371 3300049586 Bacteria 1957
677 Ga0501072_0217302 3300049588 Bacteria 1523
678 Ga0501073_0037641 3300049589 Bacteria 3433
679 Ga0501073_0067573 3300049589 Unclassified 2492
680 Ga0501077_0025769 3300049593 Unclassified 3732
681 Ga0501077_0122884 3300049593 Unclassified 1646
682 Ga0501079_0209972 3300049741 Bacteria 1520
683 Ga0501080_0112694 3300049742 Bacteria 2521
684 Ga0501035_0008635 3300049822 Bacteria 9483
685 Ga0501035_0030834 3300049822 Bacteria 4886
686 Ga0501044_0019342 3300049823 Bacteria 7287
687 Ga0501044_0024088 3300049823 Bacteria 6467
688 Ga0501044_0220361 3300049823 Bacteria 1848
689 nmdc:mga0qj67_45786_c1 3300050509 Bacteria 3451
690 nmdc:mga0qj67_55437_c1 3300050509 Bacteria 3140
691 nmdc:mga06r32_3276_c1 3300050510 Bacteria 14498
692 nmdc:mga06r32_66532_c1 3300050510 Bacteria 3477
693 nmdc:mga08y16_149427_c1 3300050511 Bacteria 2429
694 nmdc:mga08y16_16305_c1 3300050511 Bacteria 7812
695 nmdc:mga08y16_236074_c1 3300050511 Bacteria 1891
696 nmdc:mga08y16_41787_c1 3300050511 Bacteria 4802
697 nmdc:mga08y16_472635_c1 3300050511 Bacteria 1276
698 nmdc:mga0n895_11060_c1 3300050512 Bacteria 8026
699 nmdc:mga0n895_1332_c1 3300050512 Bacteria 18289
700 nmdc:mga0n895_17183_c1 3300050512 Bacteria 6666
701 nmdc:mga0n895_252537_c1 3300050512 Bacteria 1790
702 nmdc:mga0n895_28203_c1 3300050512 Bacteria 5341
703 nmdc:mga0n895_37182_c1 3300050512 Bacteria 4708
704 nmdc:mga0n895_74012_c1 3300050512 Bacteria 3383
705 nmdc:mga0n895_85317_c1 3300050512 Bacteria 3152
706 nmdc:mga0n895_89238_c1 3300050512 Bacteria 3084
707 nmdc:mga0rr50_111517_c1 3300050513 Bacteria 2165
708 nmdc:mga0rr50_121099_c1 3300050513 Bacteria 2083
709 nmdc:mga0rr50_7352_c1 3300050513 Bacteria 6786
710 nmdc:mga08x19_101039_c1 3300050514 Bacteria 1914
711 nmdc:mga08x19_21323_c1 3300050514 Bacteria 3998
712 nmdc:mga08x19_32558_c1 3300050514 Bacteria 3287
713 nmdc:mga08x19_3976_c1 3300050514 Bacteria 8797
714 nmdc:mga08x19_80328_c1 3300050514 Bacteria 2140
715 nmdc:mga0a205_153571_c1 3300050515 Bacteria 2201
716 nmdc:mga0a205_170773_c1 3300050515 Bacteria 2071
717 nmdc:mga0a205_19017_c1 3300050515 Bacteria 6472
718 nmdc:mga0a205_3361_c1 3300050515 Bacteria 14252
719 nmdc:mga0a205_42513_c1 3300050515 Bacteria 4379
720 nmdc:mga0a205_57080_c1 3300050515 Bacteria 3770
721 nmdc:mga0a205_79206_c1 3300050515 Bacteria 3174
722 Ga0495601_0070327 3300053077 Bacteria 2234
723 Ga0495612_0007913 3300053078 Bacteria 4332
724 Ga0495612_0010231 3300053078 Bacteria 3794
725 Ga0495595_0032647 3300053084 Unclassified 2345
726 Ga0495619_0011899 3300053085 Bacteria 5479
727 Ga0500628_000431 3300053129 Bacteria 7991
728 Ga0590077_002148 3300059426 Bacteria 4309
729 Ga0530510_0012049 3300061734 Bacteria 6066
730 Ga0530510_0245246 3300061734 Bacteria 1334
731 Ga0451576_0062344
732 JGI25406J46586_10002739
733 rootL2_10210485
734 Ga0065707_10083036
735 Ga0065707_10112941
736 Ga0070658_10042001
737 Ga0070658_10090993
738 Ga0070676_10090180
739 Ga0070683_100000947
740 Ga0070683_100012756
741 Ga0070683_100015226
742 Ga0070683_100027400
743 Ga0070683_100033372
744 Ga0070683_100040925
745 Ga0070683_100043564
746 Ga0070683_100069483
747 Ga0070683_100214279
748 Ga0070683_100217042
749 Ga0070690_100031688
750 Ga0070690_100058574
751 Ga0070690_100151711
752 Ga0070670_100063047
753 Ga0068869_100002109
754 Ga0068869_100015616
755 Ga0070666_10144688
756 Ga0070680_100009023
757 Ga0070680_100009769
758 Ga0070680_100012507
759 Ga0070680_100013291
760 Ga0070682_100000902
761 Ga0070682_100051681
762 Ga0068868_100007457
763 Ga0070660_100030680
764 Ga0070660_100032963
765 Ga0070660_100095107
766 Ga0070660_100102637
767 Ga0070689_100006653
768 Ga0070691_10034813
769 Ga0070687_100006856
770 Ga0070687_100049396
771 Ga0070661_100016980
772 Ga0070661_100083520
773 Ga0070661_100105281
774 Ga0070668_100001609
775 Ga0070668_100002137
776 Ga0070669_100007688
777 Ga0070669_100048397
778 Ga0070669_100049308
779 Ga0070675_100001846
780 Ga0070675_100015388
781 Ga0070675_100019186
782 Ga0070671_100242572
783 Ga0070674_100000286
784 Ga0070674_100104416
785 Ga0070674_100242829
786 Ga0070688_100033609
787 Ga0070688_100057642
788 Ga0070659_100018857
789 Ga0070659_100019214
790 Ga0070659_100038775
791 Ga0070659_100139465
792 Ga0070667_100063555
793 Ga0070703_10022861
794 Ga0070709_10014410
795 Ga0070709_10024096
796 Ga0070713_100000276
797 Ga0070713_100206613
798 Ga0070701_10001295
799 Ga0070701_10015313
800 Ga0070711_100000144
801 Ga0070711_100029838
802 Ga0070711_100054232
803 Ga0070711_100054233
804 Ga0070705_100001547
805 Ga0070705_100006462
806 Ga0070705_100067496
807 Ga0070700_100004464
808 Ga0070700_100012060
809 Ga0070700_100031323
810 Ga0070700_100058484
811 Ga0070694_100003671
812 Ga0070694_100009677
813 Ga0070694_100011246
814 Ga0070694_100014806
815 Ga0070694_100021072
816 Ga0070694_100045264
817 Ga0070694_100049421
818 Ga0070694_100057678
819 Ga0070694_100067570
820 Ga0070708_100014698
821 Ga0070708_100021645
822 Ga0070708_100025506
823 Ga0070663_100280619
824 Ga0070662_100000187
825 Ga0070662_100002445
826 Ga0070662_100011576
827 Ga0070662_100028398
828 Ga0070662_100046922
829 Ga0070681_10000279
830 Ga0070681_10011895
831 Ga0070681_10032032
832 Ga0070681_10047999
833 Ga0070681_10060010
834 Ga0070681_10172916
835 Ga0068867_100000244
836 Ga0068867_100129643
837 Ga0070685_10005118
838 Ga0070685_10007503
839 Ga0070706_100008213
840 Ga0070706_100170344
841 Ga0070706_100200483
842 Ga0070707_100118145
843 Ga0070698_100002426
844 Ga0070698_100004972
845 Ga0070698_100006794
846 Ga0070698_100013193
847 Ga0070698_100035299
848 Ga0070698_100073059
849 Ga0070698_100081303
850 Ga0070699_100000985
851 Ga0070699_100009683
852 Ga0070699_100011851
853 Ga0070699_100068335
854 Ga0070699_100103452
855 Ga0070679_100002633
856 Ga0070679_100273620
857 Ga0070684_100001538
858 Ga0070684_100002233
859 Ga0070684_100003708
860 Ga0070684_100009352
861 Ga0070684_100012111
862 Ga0070684_100019666
863 Ga0070684_100122883
864 Ga0070684_100142114
865 Ga0070697_100014265
866 Ga0070697_100016432
867 Ga0070672_100019827
868 Ga0070672_100062393
869 Ga0070695_100000593
870 Ga0070695_100004421
871 Ga0070695_100008635
872 Ga0070695_100026272
873 Ga0070695_100041355
874 Ga0070695_100224453
875 Ga0070696_100006790
876 Ga0070704_100002718
877 Ga0070704_100005402
878 Ga0070704_100005499
879 Ga0070704_100017890
880 Ga0070704_100020889
881 Ga0070704_100046807
882 Ga0070704_100109892
883 Ga0068855_100026047
884 Ga0068855_100263904
885 Ga0070664_100016671
886 Ga0070664_100042464
887 Ga0070664_100072535
888 Ga0070664_100116507
889 Ga0068857_100017595
890 Ga0068857_100021985
891 Ga0068857_100061097
892 Ga0068857_100125703
893 Ga0068856_100001784
894 Ga0068856_100049458
895 Ga0070702_100001139
896 Ga0070702_100006252
897 Ga0068852_100005183
898 Ga0068852_100036924
899 Ga0068852_100061770
900 Ga0068852_100077773
901 Ga0068852_100157024
902 Ga0068859_100010511
903 Ga0068859_100026803
904 Ga0068859_100113817
905 Ga0068859_100260496
906 Ga0068864_100041387
907 Ga0068864_100096722
908 Ga0068864_100133802
909 Ga0068866_10000802
910 Ga0068861_100004829
911 Ga0068861_100041249
912 Ga0068870_10038564
913 Ga0068870_10040908
914 Ga0068858_100048765
915 Ga0068858_100221402
916 Ga0068860_100003765
917 Ga0068860_100069300
918 Ga0068862_100005150
919 Ga0068862_100012977
920 Ga0068862_100041926
921 Ga0081539_10000131
922 Ga0081539_10033964
923 Ga0070717_10019150
924 Ga0070716_100036604
925 Ga0070716_100067757
926 Ga0070712_100005384
927 Ga0070712_100075874
928 Ga0097621_100040274
929 Ga0097621_100105057
930 Ga0097621_100339938
931 Ga0068871_100061024
932 Ga0068871_100113870
933 Ga0068871_100140786
934 Ga0075428_100046168
935 Ga0075428_100069388
936 Ga0075428_100076846
937 Ga0075428_100197995
938 Ga0075430_100014787
939 Ga0075431_100010206
940 Ga0075431_100079421
941 Ga0075431_100106219
942 Ga0075431_100304536
943 Ga0075433_10000656
944 Ga0075433_10009738
945 Ga0075433_10018433
946 Ga0075433_10021323
947 Ga0075434_100000545
948 Ga0075434_100000640
949 Ga0075434_100006465
950 Ga0075434_100036983
951 Ga0075434_100079898
952 Ga0075434_100233889
953 Ga0075429_100009485
954 Ga0068865_100003500
955 Ga0068865_100022872
956 Ga0075436_100003674
957 Ga0075436_100005735
958 Ga0075436_100050137
959 Ga0097620_100010511
960 Ga0097620_100026803
961 Ga0097620_100113818
962 Ga0097620_100260473
963 Ga0075435_100015200
964 Ga0075435_100132881
965 Ga0075435_100306438
966 Ga0099794_10000131
967 Ga0105240_10020323
968 Ga0105240_10129826
969 Ga0105240_10298478
970 Ga0111539_10004126
971 Ga0111539_10016058
972 Ga0111539_10061007
973 Ga0111539_10103557
974 Ga0111539_10114546
975 Ga0105245_10007450
976 Ga0114129_10039535
977 Ga0114129_10198646
978 Ga0114129_10278060
979 Ga0105243_10002354
980 Ga0105241_10014823
981 Ga0105241_10073395
982 Ga0105242_10000259
983 Ga0105242_10263951
984 Ga0105248_10041331
985 Ga0105248_10066502
986 Ga0105248_10220313
987 Ga0105237_10195983
988 Ga0105237_10234743
989 Ga0105238_10001391
990 Ga0105238_10169297
991 Ga0105238_10382975
992 Ga0105249_10001176
993 Ga0105249_10108302
994 Ga0105239_10013524
995 Ga0105239_10276340
996 Ga0105246_10007787
997 Ga0105246_10023745
998 Ga0105246_10070830
999 Ga0157373_10020582
1000 Ga0157371_10039047
1001 Ga0157370_10000364
1002 Ga0157370_10039944
1003 Ga0157370_10191161
1004 Ga0157369_10425507
1005 Ga0157374_10080151
1006 Ga0157378_10067087
1007 Ga0163162_10002300
1008 Ga0163162_10017788
1009 Ga0157372_10001745
1010 Ga0157372_10016526
1011 Ga0157372_10020178
1012 Ga0157372_10055638
1013 Ga0157372_10066403
1014 Ga0157375_10016600
1015 Ga0157375_10022412
1016 Ga0157375_10065318
1017 Ga0157375_10104628
1018 Ga0163163_10031980
1019 Ga0163163_10039614
1020 Ga0163163_10122991
1021 Ga0157380_10008553
1022 Ga0157380_10033413
1023 Ga0157380_10054546
1024 Ga0157380_10143944
1025 Ga0157377_10010673
1026 Ga0157379_10017436
1027 Ga0157379_10026619
1028 Ga0157376_10202833
1029 Ga0163161_10007256
1030 Ga0163161_10051599
1031 Ga0207697_10003869
1032 Ga0207656_10021618
1033 Ga0207653_10000147
1034 Ga0207653_10006468
1035 Ga0207642_10014461
1036 Ga0207642_10047211
1037 Ga0207688_10045914
1038 Ga0207680_10007200
1039 Ga0207699_10002415
1040 Ga0207699_10006674
1041 Ga0207645_10000159
1042 Ga0207645_10002586
1043 Ga0207645_10003441
1044 Ga0207645_10057519
1045 Ga0207643_10002397
1046 Ga0207643_10011811
1047 Ga0207643_10032903
1048 Ga0207705_10006920
1049 Ga0207705_10022583
1050 Ga0207705_10025070
1051 Ga0207684_10007540
1052 Ga0207684_10011317
1053 Ga0207684_10119171
1054 Ga0207684_10194218
1055 Ga0207654_10006256
1056 Ga0207654_10139947
1057 Ga0207707_10070917
1058 Ga0207707_10178439
1059 Ga0207695_10000803
1060 Ga0207695_10120743
1061 Ga0207693_10021294
1062 Ga0207693_10066382
1063 Ga0207663_10000053
1064 Ga0207663_10033260
1065 Ga0207663_10073174
1066 Ga0207660_10004496
1067 Ga0207660_10006018
1068 Ga0207660_10009757
1069 Ga0207660_10010094
1070 Ga0207660_10013704
1071 Ga0207660_10015394
1072 Ga0207660_10121423
1073 Ga0207660_10199651
1074 Ga0207662_10001829
1075 Ga0207657_10003488
1076 Ga0207657_10010128
1077 Ga0207657_10029521
1078 Ga0207657_10045016
1079 Ga0207657_10080162
1080 Ga0207657_10144821
1081 Ga0207649_10026955
1082 Ga0207649_10065938
1083 Ga0207652_10003358
1084 Ga0207652_10078577
1085 Ga0207652_10144502
1086 Ga0207646_10003926
1087 Ga0207646_10004004
1088 Ga0207646_10049811
1089 Ga0207646_10283862
1090 Ga0207681_10015094
1091 Ga0207681_10018871
1092 Ga0207681_10115849
1093 Ga0207694_10000038
1094 Ga0207694_10053892
1095 Ga0207659_10022011
1096 Ga0207659_10024328
1097 Ga0207659_10024391
1098 Ga0207659_10032688
1099 Ga0207659_10116244
1100 Ga0207687_10036945
1101 Ga0207687_10143667
1102 Ga0207700_10003899
1103 Ga0207700_10022119
1104 Ga0207664_10148095
1105 Ga0207644_10203661
1106 Ga0207690_10005968
1107 Ga0207706_10000215
1108 Ga0207706_10002234
1109 Ga0207706_10003371
1110 Ga0207706_10006000
1111 Ga0207706_10144205
1112 Ga0207686_10000068
1113 Ga0207686_10044267
1114 Ga0207709_10004505
1115 Ga0207670_10024478
1116 Ga0207670_10196872
1117 Ga0207669_10002821
1118 Ga0207669_10027693
1119 Ga0207669_10056510
1120 Ga0207669_10159927
1121 Ga0207704_10000531
1122 Ga0207704_10067239
1123 Ga0207665_10014938
1124 Ga0207665_10018265
1125 Ga0207691_10001081
1126 Ga0207691_10003716
1127 Ga0207691_10004595
1128 Ga0207691_10039419
1129 Ga0207711_10001842
1130 Ga0207711_10204428
1131 Ga0207689_10000620
1132 Ga0207689_10001946
1133 Ga0207689_10058736
1134 Ga0207661_10002153
1135 Ga0207661_10008530
1136 Ga0207661_10016654
1137 Ga0207661_10016710
1138 Ga0207661_10026635
1139 Ga0207661_10029645
1140 Ga0207661_10035341
1141 Ga0207661_10036036
1142 Ga0207661_10049706
1143 Ga0207661_10083114
1144 Ga0207661_10115747
1145 Ga0207679_10001793
1146 Ga0207679_10110260
1147 Ga0207679_10117535
1148 Ga0207667_10022116
1149 Ga0207667_10036968
1150 Ga0207667_10045151
1151 Ga0207667_10059225
1152 Ga0207667_10139474
1153 Ga0207667_10151558
1154 Ga0207667_10154910
1155 Ga0207712_10023027
1156 Ga0207668_10004666
1157 Ga0207640_10002132
1158 Ga0207640_10080609
1159 Ga0207658_10071248
1160 Ga0207658_10100549
1161 Ga0207658_10106834
1162 Ga0207703_10072684
1163 Ga0207703_10222748
1164 Ga0207678_10002057
1165 Ga0207678_10052928
1166 Ga0207678_10078814
1167 Ga0207678_10128696
1168 Ga0207708_10011420
1169 Ga0207708_10039259
1170 Ga0207708_10058882
1171 Ga0207708_10125277
1172 Ga0207702_10034800
1173 Ga0207702_10062893
1174 Ga0207702_10411803
1175 Ga0207648_10000196
1176 Ga0207648_10003258
1177 Ga0207648_10018691
1178 Ga0207676_10002313
1179 Ga0207676_10013497
1180 Ga0207676_10087212
1181 Ga0207676_10098074
1182 Ga0207674_10000033
1183 Ga0207674_10002793
1184 Ga0207674_10010447
1185 Ga0207674_10028765
1186 Ga0207674_10087835
1187 Ga0207675_100000209
1188 Ga0207675_100001013
1189 Ga0207675_100016877
1190 Ga0207675_100218347
1191 Ga0207683_10000999
1192 Ga0207683_10064659
1193 Ga0207683_10069138
1194 Ga0207698_10017201
1195 Ga0207698_10025313
1196 Ga0207698_10140401
1197 Ga0209970_1003539
1198 Ga0210002_1002491
1199 Ga0209983_1002646
1200 Ga0209588_1003163
1201 Ga0209588_1004925
1202 Ga0209588_1015858
1203 Ga0209971_1004726
1204 Ga0209998_10005562
1205 Ga0207428_10002246
1206 Ga0207428_10101105
1207 Ga0268265_10004895
1208 Ga0268265_10090652
1209 Ga0268265_10160450
1210 Ga0268264_10003466
1211 Ga0268264_10035307
1212 Ga0307408_100000917
1213 Ga0307408_100015897
1214 Ga0307405_10034677
1215 Ga0307413_10005772
1216 Ga0307413_10076559
1217 Ga0307410_10003949
1218 Ga0307410_10113126
1219 Ga0307406_10010515
1220 Ga0307406_10032097
1221 Ga0307406_10050008
1222 Ga0307406_10139153
1223 Ga0307407_10021581
1224 Ga0307412_10001081
1225 Ga0307412_10009827
1226 Ga0307409_100026742
1227 Ga0307409_100033368
1228 Ga0307409_100036735
1229 Ga0307409_100037613
1230 Ga0307409_100350329
1231 Ga0307416_100001594
1232 Ga0307416_100054735
1233 Ga0307416_100076108
1234 Ga0307416_100118720
1235 Ga0307416_100254549
1236 Ga0307414_10075930
1237 Ga0307414_10173077
1238 Ga0307411_10004373
1239 Ga0307411_10028496
1240 Ga0307411_10043265
1241 Ga0307411_10086811
1242 Ga0307415_100050697
1243 Ga0307415_100079685
1244 Ga0373934_0000939
1245 Ga0373923_0008175
1246 Ga0373953_0022967
1247 Ga0373954_0009334
1248 Ga0373956_0073777
1249 Ga0373960_0017304
1250 Ga0373943_0001928
1251 Ga0373943_0036306
1252 Ga0373946_0001769
1253 Ga0373955_0008333
1254 Ga0373955_0018838
1255 Ga0373935_0005553
1256 Ga0373927_0003285
1257 Ga0373927_0124561
1258 Ga0373933_0000586
1259 Ga0373933_0007451
1260 Ga0373933_0026941
1261 Ga0373933_0093857
1262 Ga0373947_0029673
1263 Ga0373937_0000043
1264 Ga0373937_0000105
1265 Ga0373937_0002432
1266 Ga0373937_0010062
1267 Ga0373925_0008429
1268 Ga0373925_0017773
1269 Ga0395899_0084381
1270 Ga0395900_0008793
1271 Ga0395905_0016860
1272 Ga0395905_0026727
1273 Ga0242420_000442
1274 Ga0436365_0171095
1275 Ga0436365_0725081
1276 Ga0436365_1596989
1277 Ga0436363_0413121
1278 Ga0439431_0002374
1279 Ga0450923_015094
1280 Ga0451577_0009243
1281 Ga0451577_0009911
1282 Ga0451577_0042814
1283 Ga0451577_0046228
1284 Ga0451577_0070501
1285 Ga0451577_0106606
1286 Ga0453683_0024719
1287 Ga0466966_0144050
1288 Ga0466963_0144160
1289 Ga0453684_0000332
1290 Ga0453684_0051332
1291 Ga0453684_0217724
1292 Ga0466959_0062386
1293 Ga0451576_0005790
1294 Ga0451576_0014776
1295 Ga0451576_0049577
1296 Ga0451576_0057606
1297 Ga0451576_0174112
1298 Ga0451576_0175148
1299 Ga0451576_0188455
1300 Ga0451576_0218385
1301 Ga0451576_0228195
1302 Ga0466967_0023894
1303 Ga0466967_0033928
1304 Ga0466967_0212567
1305 Ga0495603_0000253
1306 Ga0495629_0001592
1307 Ga0495629_0018183
1308 Ga0495629_0196220
1309 Ga0495651_0001415
1310 Ga0495651_0009151
1311 Ga0495651_0160092
1312 Ga0495653_0000224
1313 Ga0495580_0002193
1314 Ga0495580_0180612
1315 Ga0495582_0004961
1316 Ga0495639_0000850
1317 Ga0495639_0051920
1318 Ga0495664_0015075
1319 Ga0495594_0002756
1320 Ga0495594_0013123
1321 Ga0495594_0029996
1322 Ga0495594_0046579
1323 Ga0495608_0007577
1324 Ga0495608_0092918
1325 Ga0495618_0037710
1326 Ga0495628_0007479
1327 Ga0495628_0020059
1328 Ga0495630_0002301
1329 Ga0495630_0032328
1330 Ga0495643_0000008
1331 Ga0495652_0002064
1332 Ga0495665_0014829
1333 Ga0495640_0093468
1334 Ga0495586_0004677
1335 Ga0495587_0000832
1336 Ga0495587_0003148
1337 Ga0495587_0003161
1338 Ga0495587_0015785
1339 Ga0495621_0006884
1340 Ga0495645_0000165
1341 Ga0495645_0002257
1342 Ga0495645_0029719
1343 Ga0495645_0048683
1344 Ga0495622_0049207
1345 Ga0495667_0000538
1346 Ga0495667_0001933
1347 Ga0495667_0002068
1348 Ga0495635_0000486
1349 Ga0495635_0103766
1350 Ga0495588_0000360
1351 Ga0495657_0000031
1352 Ga0495657_0067767
1353 Ga0495657_0107988
1354 Ga0495599_0001012
1355 Ga0495599_0001165
1356 Ga0495599_0040360
1357 Ga0495623_0000150
1358 Ga0495623_0002759
1359 Ga0495623_0018528
1360 Ga0495646_0006059
1361 Ga0495658_0000184
1362 Ga0495658_0009058
1363 Ga0495669_0036318
1364 Ga0495613_0046281
1365 Ga0495600_0000793
1366 Ga0495600_0032221
1367 Ga0495581_0013005
1368 Ga0495604_0000068
1369 Ga0495604_0146365
1370 Ga0495674_0013069
1371 Ga0495680_0008415
1372 Ga0495675_0005272
1373 Ga0495675_0010895
1374 Ga0495675_0012684
1375 Ga0495675_0013273
1376 Ga0495675_0082649
1377 Ga0495675_0162326
1378 Ga0495684_0000829
1379 Ga0495684_0002697
1380 Ga0495684_0086856
1381 Ga0495593_0000876
1382 Ga0495602_0003605
1383 Ga0495602_0064541
1384 Ga0496101_0161139
1385 Ga0496104_0003566
1386 Ga0496106_0082344
1387 Ga0496112_0132830
1388 Ga0496113_0038997
1389 Ga0496113_0113236
1390 Ga0496114_0001877
1391 Ga0496115_0002432
1392 Ga0501032_0033060
1393 Ga0501032_0053891
1394 Ga0501033_0037743
1395 Ga0501034_0047254
1396 Ga0501034_0058480
1397 Ga0501037_0116426
1398 Ga0501038_0076360
1399 Ga0501038_0128620
1400 Ga0501039_0087936
1401 Ga0501042_0016997
1402 Ga0501047_0002515
1403 Ga0501067_0084054
1404 Ga0501068_0047867
1405 Ga0501069_0031672
1406 Ga0501070_0145371
1407 Ga0501072_0217302
1408 Ga0501073_0037641
1409 Ga0501073_0067573
1410 Ga0501077_0025769
1411 Ga0501077_0122884
1412 Ga0501079_0209972
1413 Ga0501080_0112694
1414 Ga0501035_0008635
1415 Ga0501035_0030834
1416 Ga0501044_0019342
1417 Ga0501044_0024088
1418 Ga0501044_0220361
1419 nmdc:mga0qj67_45786_c1
1420 nmdc:mga0qj67_55437_c1
1421 nmdc:mga06r32_3276_c1
1422 nmdc:mga06r32_66532_c1
1423 nmdc:mga08y16_149427_c1
1424 nmdc:mga08y16_16305_c1
1425 nmdc:mga08y16_236074_c1
1426 nmdc:mga08y16_41787_c1
1427 nmdc:mga08y16_472635_c1
1428 nmdc:mga0n895_11060_c1
1429 nmdc:mga0n895_1332_c1
1430 nmdc:mga0n895_17183_c1
1431 nmdc:mga0n895_252537_c1
1432 nmdc:mga0n895_28203_c1
1433 nmdc:mga0n895_37182_c1
1434 nmdc:mga0n895_74012_c1
1435 nmdc:mga0n895_85317_c1
1436 nmdc:mga0n895_89238_c1
1437 nmdc:mga0rr50_111517_c1
1438 nmdc:mga0rr50_121099_c1
1439 nmdc:mga0rr50_7352_c1
1440 nmdc:mga08x19_101039_c1
1441 nmdc:mga08x19_21323_c1
1442 nmdc:mga08x19_32558_c1
1443 nmdc:mga08x19_3976_c1
1444 nmdc:mga08x19_80328_c1
1445 nmdc:mga0a205_153571_c1
1446 nmdc:mga0a205_170773_c1
1447 nmdc:mga0a205_19017_c1
1448 nmdc:mga0a205_3361_c1
1449 nmdc:mga0a205_42513_c1
1450 nmdc:mga0a205_57080_c1
1451 nmdc:mga0a205_79206_c1
1452 Ga0495601_0070327
1453 Ga0495612_0007913
1454 Ga0495612_0010231
1455 Ga0495595_0032647
1456 Ga0495619_0011899
1457 Ga0500628_000431
1458 Ga0590077_002148
1459 Ga0530510_0012049
1460 Ga0530510_0245246

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01408

GFO_IDH_MocA

Oxidoreductase family, NAD-binding Rossmann fold

6

135

0.9

PF02894

GFO_IDH_MocA_C

Oxidoreductase family, C-terminal alpha/beta domain

163

394

0.83

PF22725

GFO_IDH_MocA_C3

GFO/IDH/MocA C-terminal domain

156

301

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
6jw7-assembly1.cif.gz_A "the crystal structure of kand2 in complex with nadh and 3""-deamino-3""-hydroxykanamycin a" 0.9074 7 393
6jw7-assembly1.cif.gz_A "the crystal structure of kand2 in complex with nadh and 3""-deamino-3""-hydroxykanamycin a" 0.8873 7 393
6nor-assembly1.cif.gz_A crystal structure of gend2 from gentamicin a biosynthesis in complex with nad 0.8849 2 396
6nor-assembly1.cif.gz_A crystal structure of gend2 from gentamicin a biosynthesis in complex with nad 0.8683 2 396
3d1l-assembly1.cif.gz_A crystal structure of putative nadp oxidoreductase bf3122 from bacteroides fragilis 0.8464 7 113
ID Description Score Start End Superfamily
af_D4A903_1_122_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8662 7 135 3.40.50.720
af_M9PE54_6_126_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8615 8 135 3.40.50.720
3uuwB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.86 6 138 3.40.50.720
af_P39353_1_125_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8588 8 137 3.40.50.720
3e18A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8583 6 137 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2V7L038-F1-model_v4 Dehydrogenase 0.9957 3 129 GO:0000166
AF-A0A2V7L038-F1-model_v4 Dehydrogenase 0.9803 3 129 GO:0000166
AF-A0A7C8LK34-F1-model_v4 Oxidoreductase domain-containing protein 0.9756 5 84 GO:0000166
AF-A0A521WLX7-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9739 3 216 GO:0000166
AF-A0A1E4BDB1-F1-model_v4 Dehydrogenase 0.9738 7 413 GO:0000166
GO:0016491

Map