F477914
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 730 | 279 | 724 | 636 |
Family's Representative Sequence
| Representative Sequence | 3300009148|Ga0105243_10033422|Ga0105243_100334222 |
| Length | 711 |
| Sequence | VGAAGAWARIGVGIRAVYRQGKADALCYIRTALARCHAAGSEARIVVSRGCRRASKKMTHTLQLILLXXATSVVAVVICRLVRLPPILGYLAIGIAVGPHALGWVPDDANVRDLAEFGVVFLMFSIGLEFSLPQLKTMRRAVFGLGLAQVAITTLVAMVGLHFLHFSWLAGFALGGALAMSSTAIVSKLLAERSELNSPHGRDVMGILLFQDLAVVAFLIAVPTVAEGGTDLWKPLAIAAGKAAFALAAILFFGQKLMHGWFFIVARLRSPELFMLNVLLVTLGLAELTELAGLSFALGAFLAGMLIAETEYRYQVEEDIKPFRDVLLGLFFVSVGMYLNLTIVADHLGWVLLLLIGPVLAKLVLIVILARAFRSPLATALRTGFYLAQAGEFAIVLLALSTDLHILDSTFPQLVLAAMVLSMLAAPFMIQLAEPLVRRMTANDWLARAAQVTQIAARTISRQDHVIICGYGRSGQNLGRLLEAEGITFLALDSDPQRVAEAAHGGGNVVYADAGRREALTAAGLQKARAVAITFTDTAIAIKILHHIQHTRPEVPVIVRTFDDTELDRLLKAGAAEVVPEALEGSLMLASHSLLLLGVPLNRVLARIQAVREERYSIFRGFFHGATDAADAEDNLQPRLHSVLLNERSTAVGKSLAELNLEGRVEVNSVRRRGARAAAPSPDFRFEAGDVLVLLGKPGDLAFAERRLLRG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2547132103 | Chromobacterium sp. C-61 | Isolate | Rhizosphere |
| 2 | 2574179768 | Azoarcus communis DSM 12120 | Isolate | Unclassified |
| 3 | 2843690924 | Chromobacterium rhizoryzae JP2-74 | Isolate | Rhizosphere |
| 4 | 2846033681 | Chromobacterium sinusclupearum MWU13-2610 | Isolate | Rhizosphere |
| 5 | 2846037992 | Chromobacterium alticapitis MWU14-2602 | Isolate | Rhizosphere |
| 6 | 2998344455 | Vogesella urethralis SLBN-145 | Isolate | Rhizosphere |
| 7 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 62 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 75 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 76 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 78 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 80 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 81 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 82 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 83 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 84 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 87 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 116 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 175 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 179 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 180 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 181 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 182 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 183 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 184 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 185 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 186 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 187 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 188 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 189 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 190 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 191 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 192 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 193 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 194 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 195 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 196 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 197 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 198 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 199 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 200 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 201 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 202 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 203 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 204 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 205 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 206 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 207 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 208 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 209 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 210 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 211 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 212 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 213 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 214 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 215 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 216 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 217 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 218 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 219 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 220 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 221 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 222 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 223 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 224 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 225 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 226 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 227 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 228 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 229 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 230 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 245 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 246 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 247 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 248 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 249 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 250 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 251 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 252 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 253 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 254 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 255 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 256 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 257 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 267 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 270 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 272 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.18 |
| Metatranscriptomes | 0 |
| Isolates | 0.82 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.41 |
| Nodule | 0 |
| Rhizoplane | 2.47 |
| Rhizosphere | 96.71 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.41 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24034J26672_10003189 | 3300002239 | Bacteria | 2282 |
| 2 | Ga0070658_10013552 | 3300005327 | Bacteria | 6542 |
| 3 | Ga0070676_10000676 | 3300005328 | Bacteria | 16667 |
| 4 | Ga0070676_10004210 | 3300005328 | Bacteria | 7558 |
| 5 | Ga0070683_100001455 | 3300005329 | Bacteria | 18228 |
| 6 | Ga0070683_100018710 | 3300005329 | Bacteria | 6139 |
| 7 | Ga0070690_100003769 | 3300005330 | Bacteria | 8351 |
| 8 | Ga0070690_100006548 | 3300005330 | Bacteria | 6613 |
| 9 | Ga0070690_100019575 | 3300005330 | Bacteria | 4111 |
| 10 | Ga0070670_100005445 | 3300005331 | Bacteria | 10737 |
| 11 | Ga0070670_100013210 | 3300005331 | Bacteria | 7073 |
| 12 | Ga0070670_100028628 | 3300005331 | Bacteria | 4794 |
| 13 | Ga0068869_100000356 | 3300005334 | Bacteria | 24579 |
| 14 | Ga0068869_100001214 | 3300005334 | Bacteria | 15152 |
| 15 | Ga0068869_100001670 | 3300005334 | Bacteria | 13252 |
| 16 | Ga0068869_100010219 | 3300005334 | Bacteria | 6112 |
| 17 | Ga0068869_100036161 | 3300005334 | Bacteria | 3505 |
| 18 | Ga0070666_10006099 | 3300005335 | Bacteria | 7408 |
| 19 | Ga0070666_10021435 | 3300005335 | Bacteria | 4189 |
| 20 | Ga0070666_10050557 | 3300005335 | Bacteria | 2796 |
| 21 | Ga0068868_100006178 | 3300005338 | Bacteria | 8474 |
| 22 | Ga0068868_100009123 | 3300005338 | Bacteria | 7122 |
| 23 | Ga0068868_100009896 | 3300005338 | Bacteria | 6885 |
| 24 | Ga0068868_100027032 | 3300005338 | Bacteria | 4375 |
| 25 | Ga0070660_100002638 | 3300005339 | Bacteria | 12331 |
| 26 | Ga0070660_100041724 | 3300005339 | Bacteria | 3498 |
| 27 | Ga0070689_100000418 | 3300005340 | Bacteria | 25038 |
| 28 | Ga0070689_100001098 | 3300005340 | Bacteria | 16989 |
| 29 | Ga0070689_100002060 | 3300005340 | Bacteria | 13046 |
| 30 | Ga0070689_100005740 | 3300005340 | Bacteria | 8509 |
| 31 | Ga0070689_100009989 | 3300005340 | Bacteria | 6754 |
| 32 | Ga0070689_100065481 | 3300005340 | Bacteria | 2830 |
| 33 | Ga0070691_10004112 | 3300005341 | Bacteria | 6604 |
| 34 | Ga0070687_100000491 | 3300005343 | Bacteria | 13181 |
| 35 | Ga0070692_10001668 | 3300005345 | Bacteria | 8207 |
| 36 | Ga0070692_10008430 | 3300005345 | Bacteria | 4600 |
| 37 | Ga0070668_100001492 | 3300005347 | Bacteria | 16911 |
| 38 | Ga0070668_100025056 | 3300005347 | Bacteria | 4521 |
| 39 | Ga0070668_100051091 | 3300005347 | Bacteria | 3185 |
| 40 | Ga0070668_100066284 | 3300005347 | Bacteria | 2802 |
| 41 | Ga0070669_100023612 | 3300005353 | Bacteria | 4404 |
| 42 | Ga0070669_100048427 | 3300005353 | Bacteria | 3102 |
| 43 | Ga0070675_100000225 | 3300005354 | Bacteria | 36121 |
| 44 | Ga0070675_100007207 | 3300005354 | Bacteria | 8573 |
| 45 | Ga0070675_100014034 | 3300005354 | Bacteria | 6309 |
| 46 | Ga0070675_100015218 | 3300005354 | Bacteria | 6076 |
| 47 | Ga0070675_100031039 | 3300005354 | Bacteria | 4318 |
| 48 | Ga0070671_100000251 | 3300005355 | Bacteria | 35949 |
| 49 | Ga0070671_100023981 | 3300005355 | Bacteria | 4992 |
| 50 | Ga0070674_100000161 | 3300005356 | Bacteria | 30979 |
| 51 | Ga0070674_100012063 | 3300005356 | Bacteria | 5294 |
| 52 | Ga0070674_100017037 | 3300005356 | Bacteria | 4561 |
| 53 | Ga0070674_100080152 | 3300005356 | Bacteria | 2330 |
| 54 | Ga0070673_100004380 | 3300005364 | Bacteria | 8919 |
| 55 | Ga0070673_100015411 | 3300005364 | Bacteria | 5368 |
| 56 | Ga0070673_100025598 | 3300005364 | Bacteria | 4346 |
| 57 | Ga0070688_100004606 | 3300005365 | Bacteria | 7195 |
| 58 | Ga0070659_100002320 | 3300005366 | Bacteria | 13538 |
| 59 | Ga0070659_100049731 | 3300005366 | Bacteria | 3297 |
| 60 | Ga0070659_100052347 | 3300005366 | Bacteria | 3211 |
| 61 | Ga0070659_100076911 | 3300005366 | Bacteria | 2661 |
| 62 | Ga0070667_100001403 | 3300005367 | Bacteria | 21557 |
| 63 | Ga0070667_100002052 | 3300005367 | Bacteria | 17830 |
| 64 | Ga0070667_100023492 | 3300005367 | Bacteria | 5115 |
| 65 | Ga0070667_100044691 | 3300005367 | Bacteria | 3721 |
| 66 | Ga0070667_100047683 | 3300005367 | Bacteria | 3605 |
| 67 | Ga0070667_100049868 | 3300005367 | Bacteria | 3527 |
| 68 | Ga0070709_10003074 | 3300005434 | Bacteria | 8966 |
| 69 | Ga0070714_100000984 | 3300005435 | Bacteria | 20360 |
| 70 | Ga0070713_100000035 | 3300005436 | Bacteria | 86284 |
| 71 | Ga0070713_100010958 | 3300005436 | Bacteria | 6574 |
| 72 | Ga0070713_100048590 | 3300005436 | Bacteria | 3494 |
| 73 | Ga0070710_10003607 | 3300005437 | Bacteria | 7329 |
| 74 | Ga0070711_100000407 | 3300005439 | Bacteria | 22299 |
| 75 | Ga0070705_100000455 | 3300005440 | Bacteria | 23509 |
| 76 | Ga0070700_100004312 | 3300005441 | Bacteria | 7422 |
| 77 | Ga0070694_100000773 | 3300005444 | Bacteria | 17884 |
| 78 | Ga0070708_100000226 | 3300005445 | Bacteria | 42003 |
| 79 | Ga0070708_100044597 | 3300005445 | Bacteria | 3900 |
| 80 | Ga0070663_100006564 | 3300005455 | Bacteria | 7011 |
| 81 | Ga0070678_100000567 | 3300005456 | Bacteria | 18120 |
| 82 | Ga0070678_100006917 | 3300005456 | Bacteria | 6691 |
| 83 | Ga0070678_100016254 | 3300005456 | Bacteria | 4755 |
| 84 | Ga0070662_100000286 | 3300005457 | Bacteria | 29988 |
| 85 | Ga0070662_100026680 | 3300005457 | Bacteria | 4003 |
| 86 | Ga0070662_100036909 | 3300005457 | Bacteria | 3462 |
| 87 | Ga0070681_10004725 | 3300005458 | Bacteria | 13042 |
| 88 | Ga0070681_10005670 | 3300005458 | Bacteria | 12070 |
| 89 | Ga0070681_10006206 | 3300005458 | Bacteria | 11617 |
| 90 | Ga0070681_10021120 | 3300005458 | Bacteria | 6523 |
| 91 | Ga0070681_10085719 | 3300005458 | Bacteria | 3103 |
| 92 | Ga0068867_100002290 | 3300005459 | Bacteria | 13458 |
| 93 | Ga0068867_100004418 | 3300005459 | Bacteria | 9887 |
| 94 | Ga0068867_100005689 | 3300005459 | Bacteria | 8836 |
| 95 | Ga0068867_100009172 | 3300005459 | Bacteria | 6984 |
| 96 | Ga0068867_100023285 | 3300005459 | Bacteria | 4434 |
| 97 | Ga0068867_100036656 | 3300005459 | Bacteria | 3562 |
| 98 | Ga0070685_10000779 | 3300005466 | Bacteria | 17344 |
| 99 | Ga0070685_10005932 | 3300005466 | Bacteria | 6216 |
| 100 | Ga0070706_100033267 | 3300005467 | Bacteria | 4758 |
| 101 | Ga0070706_100072884 | 3300005467 | Bacteria | 3177 |
| 102 | Ga0070707_100076761 | 3300005468 | Bacteria | 3223 |
| 103 | Ga0070698_100009607 | 3300005471 | Bacteria | 10348 |
| 104 | Ga0070699_100007236 | 3300005518 | Bacteria | 9655 |
| 105 | Ga0070679_100008685 | 3300005530 | Bacteria | 9578 |
| 106 | Ga0070679_100023626 | 3300005530 | Bacteria | 6021 |
| 107 | Ga0070679_100025515 | 3300005530 | Bacteria | 5801 |
| 108 | Ga0070679_100026619 | 3300005530 | Bacteria | 5686 |
| 109 | Ga0070679_100048503 | 3300005530 | Bacteria | 4231 |
| 110 | Ga0070679_100070965 | 3300005530 | Bacteria | 3474 |
| 111 | Ga0070679_100085159 | 3300005530 | Bacteria | 3148 |
| 112 | Ga0070684_100010095 | 3300005535 | Bacteria | 7467 |
| 113 | Ga0070684_100061128 | 3300005535 | Bacteria | 3296 |
| 114 | Ga0068853_100004460 | 3300005539 | Bacteria | 10851 |
| 115 | Ga0068853_100006560 | 3300005539 | Bacteria | 9268 |
| 116 | Ga0068853_100011189 | 3300005539 | Bacteria | 7280 |
| 117 | Ga0068853_100026555 | 3300005539 | Bacteria | 4863 |
| 118 | Ga0068853_100034916 | 3300005539 | Bacteria | 4269 |
| 119 | Ga0070672_100000543 | 3300005543 | Bacteria | 22143 |
| 120 | Ga0070672_100002112 | 3300005543 | Bacteria | 12545 |
| 121 | Ga0070672_100052601 | 3300005543 | Bacteria | 3180 |
| 122 | Ga0070686_100004246 | 3300005544 | Bacteria | 7894 |
| 123 | Ga0070686_100021461 | 3300005544 | Bacteria | 3839 |
| 124 | Ga0070695_100001745 | 3300005545 | Bacteria | 12236 |
| 125 | Ga0070696_100012564 | 3300005546 | Bacteria | 5686 |
| 126 | Ga0070693_100000237 | 3300005547 | Bacteria | 25748 |
| 127 | Ga0070665_100001743 | 3300005548 | Bacteria | 24897 |
| 128 | Ga0070665_100003736 | 3300005548 | Bacteria | 16125 |
| 129 | Ga0070665_100007569 | 3300005548 | Bacteria | 11040 |
| 130 | Ga0070665_100014704 | 3300005548 | Bacteria | 7852 |
| 131 | Ga0070665_100022529 | 3300005548 | Bacteria | 6340 |
| 132 | Ga0070665_100040914 | 3300005548 | Bacteria | 4658 |
| 133 | Ga0070665_100073184 | 3300005548 | Bacteria | 3434 |
| 134 | Ga0070704_100000008 | 3300005549 | Bacteria | 71641 |
| 135 | Ga0070704_100008692 | 3300005549 | Bacteria | 6108 |
| 136 | Ga0070704_100035952 | 3300005549 | Bacteria | 3371 |
| 137 | Ga0070704_100065040 | 3300005549 | Bacteria | 2624 |
| 138 | Ga0068855_100000852 | 3300005563 | Bacteria | 37837 |
| 139 | Ga0068855_100004693 | 3300005563 | Bacteria | 16702 |
| 140 | Ga0068855_100005852 | 3300005563 | Bacteria | 15009 |
| 141 | Ga0068855_100014386 | 3300005563 | Bacteria | 9526 |
| 142 | Ga0068855_100019510 | 3300005563 | Bacteria | 8147 |
| 143 | Ga0068855_100046323 | 3300005563 | Bacteria | 5141 |
| 144 | Ga0068855_100089417 | 3300005563 | Bacteria | 3555 |
| 145 | Ga0068855_100092941 | 3300005563 | Bacteria | 3478 |
| 146 | Ga0070664_100008744 | 3300005564 | Bacteria | 8200 |
| 147 | Ga0068857_100000165 | 3300005577 | Bacteria | 41423 |
| 148 | Ga0068857_100020112 | 3300005577 | Bacteria | 5868 |
| 149 | Ga0068857_100024323 | 3300005577 | Bacteria | 5331 |
| 150 | Ga0068857_100029178 | 3300005577 | Bacteria | 4868 |
| 151 | Ga0068854_100001272 | 3300005578 | Bacteria | 15149 |
| 152 | Ga0068854_100030079 | 3300005578 | Bacteria | 3765 |
| 153 | Ga0068854_100030295 | 3300005578 | Bacteria | 3753 |
| 154 | Ga0068854_100064765 | 3300005578 | Bacteria | 2656 |
| 155 | Ga0068856_100000375 | 3300005614 | Bacteria | 49163 |
| 156 | Ga0068856_100000664 | 3300005614 | Bacteria | 37278 |
| 157 | Ga0068856_100022733 | 3300005614 | Bacteria | 6096 |
| 158 | Ga0068856_100039603 | 3300005614 | Bacteria | 4627 |
| 159 | Ga0068856_100088512 | 3300005614 | Bacteria | 3079 |
| 160 | Ga0068856_100114761 | 3300005614 | Bacteria | 2693 |
| 161 | Ga0070702_100000012 | 3300005615 | Bacteria | 58298 |
| 162 | Ga0068852_100000254 | 3300005616 | Bacteria | 36057 |
| 163 | Ga0068852_100000371 | 3300005616 | Bacteria | 30327 |
| 164 | Ga0068852_100009106 | 3300005616 | Bacteria | 7349 |
| 165 | Ga0068852_100080051 | 3300005616 | Bacteria | 2895 |
| 166 | Ga0068859_100009197 | 3300005617 | Bacteria | 9975 |
| 167 | Ga0068859_100009660 | 3300005617 | Bacteria | 9738 |
| 168 | Ga0068859_100010133 | 3300005617 | Bacteria | 9494 |
| 169 | Ga0068859_100014353 | 3300005617 | Bacteria | 7946 |
| 170 | Ga0068859_100021791 | 3300005617 | Bacteria | 6426 |
| 171 | Ga0068859_100048127 | 3300005617 | Bacteria | 4283 |
| 172 | Ga0068864_100000221 | 3300005618 | Bacteria | 51532 |
| 173 | Ga0068864_100000981 | 3300005618 | Bacteria | 23881 |
| 174 | Ga0068864_100001197 | 3300005618 | Bacteria | 21532 |
| 175 | Ga0068864_100001506 | 3300005618 | Bacteria | 19184 |
| 176 | Ga0068866_10001702 | 3300005718 | Bacteria | 9263 |
| 177 | Ga0068866_10002776 | 3300005718 | Bacteria | 7222 |
| 178 | Ga0068861_100001987 | 3300005719 | Bacteria | 13207 |
| 179 | Ga0068861_100013391 | 3300005719 | Bacteria | 5740 |
| 180 | Ga0068861_100040242 | 3300005719 | Bacteria | 3494 |
| 181 | Ga0068851_10006845 | 3300005834 | Bacteria | 5219 |
| 182 | Ga0068851_10007141 | 3300005834 | Bacteria | 5118 |
| 183 | Ga0068851_10020462 | 3300005834 | Bacteria | 3205 |
| 184 | Ga0068851_10020725 | 3300005834 | Bacteria | 3186 |
| 185 | Ga0068863_100000366 | 3300005841 | Bacteria | 45953 |
| 186 | Ga0068863_100004197 | 3300005841 | Bacteria | 14231 |
| 187 | Ga0068863_100004419 | 3300005841 | Bacteria | 13865 |
| 188 | Ga0068863_100004890 | 3300005841 | Bacteria | 13205 |
| 189 | Ga0068863_100082438 | 3300005841 | Bacteria | 3048 |
| 190 | Ga0068858_100001946 | 3300005842 | Bacteria | 21056 |
| 191 | Ga0068858_100003588 | 3300005842 | Bacteria | 15356 |
| 192 | Ga0068858_100005717 | 3300005842 | Bacteria | 12153 |
| 193 | Ga0068858_100005913 | 3300005842 | Bacteria | 11941 |
| 194 | Ga0068858_100009188 | 3300005842 | Bacteria | 9446 |
| 195 | Ga0068858_100013483 | 3300005842 | Bacteria | 7711 |
| 196 | Ga0068858_100023474 | 3300005842 | Bacteria | 5744 |
| 197 | Ga0068858_100081854 | 3300005842 | Bacteria | 3001 |
| 198 | Ga0068860_100010866 | 3300005843 | Bacteria | 8978 |
| 199 | Ga0068860_100019348 | 3300005843 | Bacteria | 6605 |
| 200 | Ga0068860_100023185 | 3300005843 | Bacteria | 6001 |
| 201 | Ga0068860_100056157 | 3300005843 | Bacteria | 3744 |
| 202 | Ga0068860_100083907 | 3300005843 | Bacteria | 3030 |
| 203 | Ga0068860_100088409 | 3300005843 | Bacteria | 2949 |
| 204 | Ga0068860_100108955 | 3300005843 | Bacteria | 2647 |
| 205 | Ga0068862_100007718 | 3300005844 | Bacteria | 8898 |
| 206 | Ga0068862_100018173 | 3300005844 | Bacteria | 5853 |
| 207 | Ga0081539_10014045 | 3300005985 | Bacteria | 5961 |
| 208 | Ga0070715_10009123 | 3300006163 | Bacteria | 3484 |
| 209 | Ga0075366_10000907 | 3300006195 | Bacteria | 14346 |
| 210 | Ga0075366_10002203 | 3300006195 | Bacteria | 9941 |
| 211 | Ga0097621_100000762 | 3300006237 | Bacteria | 22583 |
| 212 | Ga0097621_100001879 | 3300006237 | Bacteria | 14384 |
| 213 | Ga0097621_100003001 | 3300006237 | Bacteria | 11593 |
| 214 | Ga0097621_100008117 | 3300006237 | Bacteria | 7546 |
| 215 | Ga0097621_100014367 | 3300006237 | Bacteria | 5924 |
| 216 | Ga0097621_100016878 | 3300006237 | Bacteria | 5533 |
| 217 | Ga0068871_100000594 | 3300006358 | Bacteria | 24896 |
| 218 | Ga0068871_100003366 | 3300006358 | Bacteria | 10985 |
| 219 | Ga0068871_100033066 | 3300006358 | Bacteria | 4091 |
| 220 | Ga0075428_100000089 | 3300006844 | Bacteria | 75097 |
| 221 | Ga0075428_100007373 | 3300006844 | Bacteria | 12193 |
| 222 | Ga0075428_100010121 | 3300006844 | Bacteria | 10477 |
| 223 | Ga0075428_100053815 | 3300006844 | Bacteria | 4411 |
| 224 | Ga0075431_100011080 | 3300006847 | Bacteria | 9074 |
| 225 | Ga0075429_100000293 | 3300006880 | Bacteria | 35379 |
| 226 | Ga0075429_100000461 | 3300006880 | Bacteria | 30365 |
| 227 | Ga0075429_100013949 | 3300006880 | Bacteria | 6965 |
| 228 | Ga0075429_100029138 | 3300006880 | Bacteria | 4794 |
| 229 | Ga0068865_100004473 | 3300006881 | Bacteria | 8433 |
| 230 | Ga0068865_100037043 | 3300006881 | Bacteria | 3292 |
| 231 | Ga0068865_100040940 | 3300006881 | Bacteria | 3151 |
| 232 | Ga0068865_100046293 | 3300006881 | Bacteria | 2984 |
| 233 | Ga0075436_100000095 | 3300006914 | Bacteria | 51876 |
| 234 | Ga0075436_100011908 | 3300006914 | Bacteria | 5968 |
| 235 | Ga0075436_100041126 | 3300006914 | Bacteria | 3189 |
| 236 | Ga0097620_100009197 | 3300006931 | Bacteria | 9975 |
| 237 | Ga0097620_100009661 | 3300006931 | Bacteria | 9738 |
| 238 | Ga0097620_100010133 | 3300006931 | Bacteria | 9494 |
| 239 | Ga0097620_100014355 | 3300006931 | Bacteria | 7946 |
| 240 | Ga0097620_100021791 | 3300006931 | Bacteria | 6426 |
| 241 | Ga0097620_100048125 | 3300006931 | Bacteria | 4283 |
| 242 | Ga0099794_10005789 | 3300007265 | Bacteria | 4979 |
| 243 | Ga0105240_10025293 | 3300009093 | Bacteria | 7805 |
| 244 | Ga0105240_10111167 | 3300009093 | Bacteria | 3315 |
| 245 | Ga0105240_10135381 | 3300009093 | Bacteria | 2951 |
| 246 | Ga0111539_10000086 | 3300009094 | Bacteria | 95435 |
| 247 | Ga0111539_10037333 | 3300009094 | Bacteria | 5867 |
| 248 | Ga0111539_10057184 | 3300009094 | Bacteria | 4632 |
| 249 | Ga0111539_10062750 | 3300009094 | Bacteria | 4398 |
| 250 | Ga0111539_10150910 | 3300009094 | Bacteria | 2720 |
| 251 | Ga0105245_10003077 | 3300009098 | Bacteria | 14936 |
| 252 | Ga0105245_10007877 | 3300009098 | Bacteria | 9319 |
| 253 | Ga0105245_10035403 | 3300009098 | Bacteria | 4430 |
| 254 | Ga0114129_10009970 | 3300009147 | Bacteria | 13542 |
| 255 | Ga0114129_10025059 | 3300009147 | Bacteria | 8454 |
| 256 | Ga0105243_10001330 | 3300009148 | Bacteria | 22041 |
| 257 | Ga0105243_10033422 | 3300009148 | Bacteria | 3978 |
| 258 | Ga0105241_10007877 | 3300009174 | Bacteria | 7832 |
| 259 | Ga0105241_10012139 | 3300009174 | Bacteria | 6323 |
| 260 | Ga0105241_10012648 | 3300009174 | Bacteria | 6194 |
| 261 | Ga0105241_10038696 | 3300009174 | Bacteria | 3596 |
| 262 | Ga0105241_10073800 | 3300009174 | Bacteria | 2655 |
| 263 | Ga0105242_10001759 | 3300009176 | Bacteria | 17096 |
| 264 | Ga0105242_10001867 | 3300009176 | Bacteria | 16545 |
| 265 | Ga0105242_10004748 | 3300009176 | Bacteria | 10522 |
| 266 | Ga0105242_10005169 | 3300009176 | Bacteria | 10071 |
| 267 | Ga0105242_10058534 | 3300009176 | Bacteria | 3159 |
| 268 | Ga0105248_10000874 | 3300009177 | Bacteria | 33787 |
| 269 | Ga0105248_10001115 | 3300009177 | Bacteria | 29857 |
| 270 | Ga0105248_10004254 | 3300009177 | Bacteria | 15845 |
| 271 | Ga0105248_10029748 | 3300009177 | Bacteria | 6096 |
| 272 | Ga0105248_10030277 | 3300009177 | Bacteria | 6043 |
| 273 | Ga0105248_10085045 | 3300009177 | Bacteria | 3560 |
| 274 | Ga0105237_10002707 | 3300009545 | Bacteria | 21648 |
| 275 | Ga0105237_10138221 | 3300009545 | Bacteria | 2431 |
| 276 | Ga0105238_10000556 | 3300009551 | Bacteria | 39015 |
| 277 | Ga0105238_10017261 | 3300009551 | Bacteria | 7331 |
| 278 | Ga0105249_10002333 | 3300009553 | Bacteria | 16475 |
| 279 | Ga0105249_10033505 | 3300009553 | Bacteria | 4650 |
| 280 | Ga0105249_10059080 | 3300009553 | Bacteria | 3516 |
| 281 | Ga0105239_10032408 | 3300010375 | Bacteria | 5742 |
| 282 | Ga0105246_10004097 | 3300011119 | Bacteria | 8848 |
| 283 | Ga0157373_10000524 | 3300013100 | Bacteria | 30046 |
| 284 | Ga0157371_10000614 | 3300013102 | Bacteria | 42414 |
| 285 | Ga0157370_10004576 | 3300013104 | Bacteria | 15836 |
| 286 | Ga0157370_10005207 | 3300013104 | Bacteria | 14653 |
| 287 | Ga0157370_10006054 | 3300013104 | Bacteria | 13428 |
| 288 | Ga0157370_10008837 | 3300013104 | Bacteria | 10828 |
| 289 | Ga0157370_10009782 | 3300013104 | Bacteria | 10170 |
| 290 | Ga0157370_10022627 | 3300013104 | Bacteria | 6254 |
| 291 | Ga0157370_10046746 | 3300013104 | Bacteria | 4150 |
| 292 | Ga0157369_10001463 | 3300013105 | Bacteria | 28936 |
| 293 | Ga0157369_10001573 | 3300013105 | Bacteria | 27941 |
| 294 | Ga0157369_10007995 | 3300013105 | Bacteria | 12148 |
| 295 | Ga0157369_10099455 | 3300013105 | Bacteria | 3101 |
| 296 | Ga0157369_10147251 | 3300013105 | Bacteria | 2489 |
| 297 | Ga0157374_10004187 | 3300013296 | Bacteria | 12119 |
| 298 | Ga0157374_10005148 | 3300013296 | Bacteria | 10967 |
| 299 | Ga0157374_10008385 | 3300013296 | Bacteria | 8826 |
| 300 | Ga0157374_10016750 | 3300013296 | Bacteria | 6448 |
| 301 | Ga0157378_10000637 | 3300013297 | Bacteria | 32918 |
| 302 | Ga0157378_10005782 | 3300013297 | Bacteria | 10838 |
| 303 | Ga0157378_10011674 | 3300013297 | Bacteria | 7688 |
| 304 | Ga0157378_10026305 | 3300013297 | Bacteria | 5129 |
| 305 | Ga0157378_10041784 | 3300013297 | Bacteria | 4068 |
| 306 | Ga0157378_10044886 | 3300013297 | Bacteria | 3925 |
| 307 | Ga0157378_10057268 | 3300013297 | Bacteria | 3473 |
| 308 | Ga0163162_10027766 | 3300013306 | Bacteria | 5598 |
| 309 | Ga0163162_10039972 | 3300013306 | Bacteria | 4688 |
| 310 | Ga0163162_10044761 | 3300013306 | Bacteria | 4434 |
| 311 | Ga0157372_10002357 | 3300013307 | Bacteria | 20425 |
| 312 | Ga0157372_10023642 | 3300013307 | Bacteria | 6666 |
| 313 | Ga0157372_10123879 | 3300013307 | Bacteria | 2971 |
| 314 | Ga0157375_10002640 | 3300013308 | Bacteria | 15524 |
| 315 | Ga0157375_10030513 | 3300013308 | Bacteria | 5084 |
| 316 | Ga0157375_10033853 | 3300013308 | Bacteria | 4860 |
| 317 | Ga0157375_10035251 | 3300013308 | Bacteria | 4774 |
| 318 | Ga0157375_10045021 | 3300013308 | Bacteria | 4293 |
| 319 | Ga0163163_10098921 | 3300014325 | Bacteria | 2938 |
| 320 | Ga0163163_10141160 | 3300014325 | Bacteria | 2451 |
| 321 | Ga0157380_10001950 | 3300014326 | Bacteria | 13731 |
| 322 | Ga0157380_10050666 | 3300014326 | Bacteria | 3281 |
| 323 | Ga0157377_10003422 | 3300014745 | Bacteria | 7181 |
| 324 | Ga0157377_10031656 | 3300014745 | Bacteria | 2876 |
| 325 | Ga0157377_10040958 | 3300014745 | Bacteria | 2567 |
| 326 | Ga0157379_10005730 | 3300014968 | Bacteria | 10684 |
| 327 | Ga0157379_10008738 | 3300014968 | Bacteria | 8830 |
| 328 | Ga0157379_10009459 | 3300014968 | Bacteria | 8495 |
| 329 | Ga0157379_10015696 | 3300014968 | Bacteria | 6656 |
| 330 | Ga0157379_10038383 | 3300014968 | Bacteria | 4274 |
| 331 | Ga0157379_10045960 | 3300014968 | Bacteria | 3897 |
| 332 | Ga0157376_10004250 | 3300014969 | Bacteria | 9942 |
| 333 | Ga0157376_10004622 | 3300014969 | Bacteria | 9589 |
| 334 | Ga0157376_10013604 | 3300014969 | Bacteria | 6078 |
| 335 | Ga0157376_10014757 | 3300014969 | Bacteria | 5876 |
| 336 | Ga0157376_10039044 | 3300014969 | Bacteria | 3868 |
| 337 | Ga0163161_10012976 | 3300017792 | Bacteria | 5789 |
| 338 | Ga0163161_10014898 | 3300017792 | Bacteria | 5416 |
| 339 | Ga0163161_10032262 | 3300017792 | Bacteria | 3738 |
| 340 | Ga0163161_10037977 | 3300017792 | Bacteria | 3452 |
| 341 | Ga0213872_10001917 | 3300021361 | Bacteria | 12723 |
| 342 | Ga0213872_10014786 | 3300021361 | Bacteria | 3635 |
| 343 | Ga0207697_10000020 | 3300025315 | Bacteria | 55999 |
| 344 | Ga0207697_10001039 | 3300025315 | Bacteria | 15417 |
| 345 | Ga0207656_10000665 | 3300025321 | Bacteria | 11258 |
| 346 | Ga0207656_10001267 | 3300025321 | Bacteria | 8323 |
| 347 | Ga0207682_10000303 | 3300025893 | Bacteria | 22258 |
| 348 | Ga0207682_10000532 | 3300025893 | Bacteria | 17502 |
| 349 | Ga0207682_10002866 | 3300025893 | Bacteria | 7615 |
| 350 | Ga0207642_10000532 | 3300025899 | Bacteria | 11649 |
| 351 | Ga0207642_10002880 | 3300025899 | Bacteria | 5379 |
| 352 | Ga0207688_10000534 | 3300025901 | Bacteria | 18439 |
| 353 | Ga0207688_10000877 | 3300025901 | Bacteria | 15196 |
| 354 | Ga0207680_10037591 | 3300025903 | Bacteria | 2796 |
| 355 | Ga0207645_10000209 | 3300025907 | Bacteria | 48175 |
| 356 | Ga0207645_10000353 | 3300025907 | Bacteria | 38206 |
| 357 | Ga0207645_10000516 | 3300025907 | Bacteria | 32079 |
| 358 | Ga0207645_10002067 | 3300025907 | Bacteria | 16065 |
| 359 | Ga0207645_10014473 | 3300025907 | Bacteria | 5279 |
| 360 | Ga0207645_10023134 | 3300025907 | Bacteria | 4039 |
| 361 | Ga0207645_10045381 | 3300025907 | Bacteria | 2809 |
| 362 | Ga0207643_10000131 | 3300025908 | Bacteria | 50934 |
| 363 | Ga0207643_10009895 | 3300025908 | Bacteria | 5124 |
| 364 | Ga0207684_10054469 | 3300025910 | Bacteria | 3393 |
| 365 | Ga0207684_10060008 | 3300025910 | Bacteria | 3230 |
| 366 | Ga0207654_10012293 | 3300025911 | Bacteria | 4385 |
| 367 | Ga0207654_10019181 | 3300025911 | Bacteria | 3605 |
| 368 | Ga0207654_10020614 | 3300025911 | Bacteria | 3497 |
| 369 | Ga0207707_10054059 | 3300025912 | Bacteria | 3495 |
| 370 | Ga0207707_10081109 | 3300025912 | Bacteria | 2832 |
| 371 | Ga0207707_10082099 | 3300025912 | Bacteria | 2814 |
| 372 | Ga0207695_10014997 | 3300025913 | Bacteria | 9142 |
| 373 | Ga0207695_10134541 | 3300025913 | Bacteria | 2426 |
| 374 | Ga0207671_10005819 | 3300025914 | Bacteria | 11203 |
| 375 | Ga0207693_10001140 | 3300025915 | Bacteria | 23800 |
| 376 | Ga0207693_10014396 | 3300025915 | Bacteria | 6361 |
| 377 | Ga0207660_10029187 | 3300025917 | Bacteria | 3780 |
| 378 | Ga0207660_10033376 | 3300025917 | Bacteria | 3560 |
| 379 | Ga0207662_10000366 | 3300025918 | Bacteria | 20312 |
| 380 | Ga0207662_10003310 | 3300025918 | Bacteria | 8266 |
| 381 | Ga0207662_10026857 | 3300025918 | Bacteria | 3322 |
| 382 | Ga0207662_10045095 | 3300025918 | Bacteria | 2606 |
| 383 | Ga0207657_10000469 | 3300025919 | Bacteria | 42688 |
| 384 | Ga0207657_10011489 | 3300025919 | Bacteria | 8792 |
| 385 | Ga0207657_10013684 | 3300025919 | Bacteria | 7947 |
| 386 | Ga0207657_10038941 | 3300025919 | Bacteria | 4227 |
| 387 | Ga0207649_10002994 | 3300025920 | Bacteria | 9302 |
| 388 | Ga0207649_10003391 | 3300025920 | Bacteria | 8712 |
| 389 | Ga0207649_10016743 | 3300025920 | Bacteria | 4143 |
| 390 | Ga0207652_10099601 | 3300025921 | Bacteria | 2564 |
| 391 | Ga0207652_10101030 | 3300025921 | Bacteria | 2547 |
| 392 | Ga0207681_10088894 | 3300025923 | Bacteria | 2201 |
| 393 | Ga0207694_10020244 | 3300025924 | Bacteria | 5031 |
| 394 | Ga0207650_10002173 | 3300025925 | Bacteria | 13703 |
| 395 | Ga0207650_10004339 | 3300025925 | Bacteria | 9687 |
| 396 | Ga0207650_10007990 | 3300025925 | Bacteria | 7211 |
| 397 | Ga0207650_10008205 | 3300025925 | Bacteria | 7124 |
| 398 | Ga0207650_10036045 | 3300025925 | Bacteria | 3597 |
| 399 | Ga0207659_10001463 | 3300025926 | Bacteria | 14084 |
| 400 | Ga0207659_10004796 | 3300025926 | Bacteria | 8201 |
| 401 | Ga0207659_10008089 | 3300025926 | Bacteria | 6509 |
| 402 | Ga0207659_10016044 | 3300025926 | Bacteria | 4868 |
| 403 | Ga0207659_10031655 | 3300025926 | Bacteria | 3624 |
| 404 | Ga0207687_10003076 | 3300025927 | Bacteria | 11319 |
| 405 | Ga0207687_10003673 | 3300025927 | Bacteria | 10333 |
| 406 | Ga0207687_10010221 | 3300025927 | Bacteria | 6131 |
| 407 | Ga0207700_10000023 | 3300025928 | Bacteria | 152285 |
| 408 | Ga0207664_10005012 | 3300025929 | Bacteria | 9005 |
| 409 | Ga0207664_10007905 | 3300025929 | Bacteria | 7387 |
| 410 | Ga0207644_10002353 | 3300025931 | Bacteria | 12207 |
| 411 | Ga0207644_10002396 | 3300025931 | Bacteria | 12087 |
| 412 | Ga0207644_10028208 | 3300025931 | Bacteria | 3884 |
| 413 | Ga0207644_10034656 | 3300025931 | Bacteria | 3533 |
| 414 | Ga0207690_10001675 | 3300025932 | Bacteria | 13677 |
| 415 | Ga0207706_10000052 | 3300025933 | Bacteria | 115553 |
| 416 | Ga0207706_10001855 | 3300025933 | Bacteria | 20691 |
| 417 | Ga0207706_10002254 | 3300025933 | Bacteria | 18826 |
| 418 | Ga0207706_10003781 | 3300025933 | Bacteria | 14439 |
| 419 | Ga0207706_10014160 | 3300025933 | Bacteria | 7231 |
| 420 | Ga0207706_10035632 | 3300025933 | Bacteria | 4423 |
| 421 | Ga0207686_10000387 | 3300025934 | Bacteria | 30664 |
| 422 | Ga0207686_10000894 | 3300025934 | Bacteria | 17991 |
| 423 | Ga0207686_10011407 | 3300025934 | Bacteria | 4866 |
| 424 | Ga0207686_10043703 | 3300025934 | Bacteria | 2747 |
| 425 | Ga0207709_10001289 | 3300025935 | Bacteria | 17884 |
| 426 | Ga0207669_10021866 | 3300025937 | Bacteria | 3386 |
| 427 | Ga0207669_10023987 | 3300025937 | Bacteria | 3270 |
| 428 | Ga0207704_10023795 | 3300025938 | Bacteria | 3308 |
| 429 | Ga0207691_10000153 | 3300025940 | Bacteria | 64312 |
| 430 | Ga0207691_10000663 | 3300025940 | Bacteria | 33984 |
| 431 | Ga0207691_10001224 | 3300025940 | Bacteria | 25608 |
| 432 | Ga0207691_10003074 | 3300025940 | Bacteria | 16284 |
| 433 | Ga0207691_10003500 | 3300025940 | Bacteria | 15280 |
| 434 | Ga0207691_10008959 | 3300025940 | Bacteria | 9602 |
| 435 | Ga0207691_10026283 | 3300025940 | Bacteria | 5464 |
| 436 | Ga0207691_10070561 | 3300025940 | Bacteria | 3154 |
| 437 | Ga0207691_10127843 | 3300025940 | Bacteria | 2247 |
| 438 | Ga0207711_10002569 | 3300025941 | Bacteria | 16150 |
| 439 | Ga0207711_10007090 | 3300025941 | Bacteria | 9388 |
| 440 | Ga0207711_10017016 | 3300025941 | Bacteria | 6039 |
| 441 | Ga0207711_10048642 | 3300025941 | Bacteria | 3628 |
| 442 | Ga0207689_10000091 | 3300025942 | Bacteria | 73260 |
| 443 | Ga0207689_10001242 | 3300025942 | Bacteria | 24579 |
| 444 | Ga0207689_10001481 | 3300025942 | Bacteria | 22457 |
| 445 | Ga0207689_10002415 | 3300025942 | Bacteria | 17381 |
| 446 | Ga0207689_10002543 | 3300025942 | Bacteria | 16925 |
| 447 | Ga0207689_10002580 | 3300025942 | Bacteria | 16786 |
| 448 | Ga0207689_10005478 | 3300025942 | Bacteria | 11358 |
| 449 | Ga0207689_10022530 | 3300025942 | Bacteria | 5295 |
| 450 | Ga0207689_10070944 | 3300025942 | Bacteria | 2861 |
| 451 | Ga0207661_10012124 | 3300025944 | Bacteria | 6260 |
| 452 | Ga0207679_10004581 | 3300025945 | Bacteria | 8609 |
| 453 | Ga0207679_10008523 | 3300025945 | Bacteria | 6531 |
| 454 | Ga0207679_10009411 | 3300025945 | Bacteria | 6261 |
| 455 | Ga0207679_10014353 | 3300025945 | Bacteria | 5207 |
| 456 | Ga0207679_10016018 | 3300025945 | Bacteria | 4969 |
| 457 | Ga0207679_10016187 | 3300025945 | Bacteria | 4945 |
| 458 | Ga0207667_10001296 | 3300025949 | Bacteria | 31332 |
| 459 | Ga0207667_10009605 | 3300025949 | Bacteria | 11381 |
| 460 | Ga0207667_10016708 | 3300025949 | Bacteria | 8280 |
| 461 | Ga0207667_10045578 | 3300025949 | Bacteria | 4643 |
| 462 | Ga0207667_10083787 | 3300025949 | Bacteria | 3301 |
| 463 | Ga0207667_10124154 | 3300025949 | Bacteria | 2659 |
| 464 | Ga0207651_10005833 | 3300025960 | Bacteria | 6366 |
| 465 | Ga0207651_10008998 | 3300025960 | Bacteria | 5428 |
| 466 | Ga0207651_10010046 | 3300025960 | Bacteria | 5221 |
| 467 | Ga0207651_10015586 | 3300025960 | Bacteria | 4423 |
| 468 | Ga0207712_10008029 | 3300025961 | Bacteria | 6675 |
| 469 | Ga0207712_10014061 | 3300025961 | Bacteria | 5138 |
| 470 | Ga0207712_10048522 | 3300025961 | Bacteria | 2954 |
| 471 | Ga0207668_10003307 | 3300025972 | Bacteria | 9446 |
| 472 | Ga0207668_10040382 | 3300025972 | Bacteria | 3148 |
| 473 | Ga0207668_10084494 | 3300025972 | Bacteria | 2313 |
| 474 | Ga0207640_10006016 | 3300025981 | Bacteria | 6631 |
| 475 | Ga0207640_10014498 | 3300025981 | Bacteria | 4540 |
| 476 | Ga0207640_10015486 | 3300025981 | Bacteria | 4415 |
| 477 | Ga0207658_10039861 | 3300025986 | Bacteria | 3391 |
| 478 | Ga0207658_10061724 | 3300025986 | Bacteria | 2802 |
| 479 | Ga0207677_10000717 | 3300026023 | Bacteria | 19569 |
| 480 | Ga0207677_10001127 | 3300026023 | Bacteria | 14559 |
| 481 | Ga0207677_10017670 | 3300026023 | Bacteria | 4260 |
| 482 | Ga0207677_10018204 | 3300026023 | Bacteria | 4212 |
| 483 | Ga0207677_10023282 | 3300026023 | Bacteria | 3823 |
| 484 | Ga0207677_10024749 | 3300026023 | Bacteria | 3734 |
| 485 | Ga0207703_10001000 | 3300026035 | Bacteria | 27175 |
| 486 | Ga0207703_10003742 | 3300026035 | Bacteria | 12656 |
| 487 | Ga0207703_10005598 | 3300026035 | Bacteria | 10087 |
| 488 | Ga0207639_10005452 | 3300026041 | Bacteria | 8593 |
| 489 | Ga0207639_10007463 | 3300026041 | Bacteria | 7459 |
| 490 | Ga0207639_10050170 | 3300026041 | Bacteria | 3168 |
| 491 | Ga0207678_10006203 | 3300026067 | Bacteria | 10620 |
| 492 | Ga0207678_10033999 | 3300026067 | Bacteria | 4441 |
| 493 | Ga0207708_10001492 | 3300026075 | Bacteria | 17450 |
| 494 | Ga0207708_10006999 | 3300026075 | Bacteria | 8337 |
| 495 | Ga0207708_10054780 | 3300026075 | Bacteria | 3041 |
| 496 | Ga0207702_10000248 | 3300026078 | Bacteria | 62667 |
| 497 | Ga0207702_10015292 | 3300026078 | Bacteria | 6362 |
| 498 | Ga0207702_10030720 | 3300026078 | Bacteria | 4475 |
| 499 | Ga0207702_10033649 | 3300026078 | Bacteria | 4282 |
| 500 | Ga0207641_10015731 | 3300026088 | Bacteria | 6199 |
| 501 | Ga0207641_10042121 | 3300026088 | Bacteria | 3829 |
| 502 | Ga0207641_10046825 | 3300026088 | Bacteria | 3646 |
| 503 | Ga0207648_10000415 | 3300026089 | Bacteria | 47449 |
| 504 | Ga0207648_10001004 | 3300026089 | Bacteria | 31794 |
| 505 | Ga0207648_10004079 | 3300026089 | Bacteria | 15140 |
| 506 | Ga0207648_10004860 | 3300026089 | Bacteria | 13699 |
| 507 | Ga0207648_10011801 | 3300026089 | Bacteria | 8211 |
| 508 | Ga0207648_10012903 | 3300026089 | Bacteria | 7803 |
| 509 | Ga0207648_10013321 | 3300026089 | Bacteria | 7656 |
| 510 | Ga0207676_10001564 | 3300026095 | Bacteria | 16874 |
| 511 | Ga0207676_10003875 | 3300026095 | Bacteria | 10565 |
| 512 | Ga0207676_10006171 | 3300026095 | Bacteria | 8461 |
| 513 | Ga0207676_10009655 | 3300026095 | Bacteria | 6866 |
| 514 | Ga0207674_10000180 | 3300026116 | Bacteria | 77710 |
| 515 | Ga0207674_10001995 | 3300026116 | Bacteria | 25882 |
| 516 | Ga0207674_10003455 | 3300026116 | Bacteria | 19327 |
| 517 | Ga0207674_10022759 | 3300026116 | Bacteria | 6725 |
| 518 | Ga0207674_10023835 | 3300026116 | Bacteria | 6549 |
| 519 | Ga0207674_10054406 | 3300026116 | Bacteria | 4074 |
| 520 | Ga0207674_10079979 | 3300026116 | Bacteria | 3272 |
| 521 | Ga0207675_100000930 | 3300026118 | Bacteria | 29253 |
| 522 | Ga0207675_100007047 | 3300026118 | Bacteria | 10620 |
| 523 | Ga0207675_100007242 | 3300026118 | Bacteria | 10485 |
| 524 | Ga0207675_100029295 | 3300026118 | Bacteria | 5130 |
| 525 | Ga0207675_100066232 | 3300026118 | Bacteria | 3376 |
| 526 | Ga0207675_100093635 | 3300026118 | Bacteria | 2826 |
| 527 | Ga0207683_10000140 | 3300026121 | Bacteria | 59648 |
| 528 | Ga0207683_10001329 | 3300026121 | Bacteria | 22302 |
| 529 | Ga0207683_10001697 | 3300026121 | Bacteria | 19718 |
| 530 | Ga0207683_10001790 | 3300026121 | Bacteria | 19021 |
| 531 | Ga0207683_10006146 | 3300026121 | Bacteria | 10290 |
| 532 | Ga0207683_10019924 | 3300026121 | Bacteria | 5732 |
| 533 | Ga0207698_10000661 | 3300026142 | Bacteria | 19977 |
| 534 | Ga0207698_10079729 | 3300026142 | Bacteria | 2634 |
| 535 | Ga0209983_1001921 | 3300027665 | Bacteria | 4609 |
| 536 | Ga0207428_10005166 | 3300027907 | Bacteria | 12220 |
| 537 | Ga0207428_10017464 | 3300027907 | Bacteria | 6157 |
| 538 | Ga0268266_10016322 | 3300028379 | Bacteria | 6348 |
| 539 | Ga0268265_10019134 | 3300028380 | Bacteria | 4753 |
| 540 | Ga0268265_10088157 | 3300028380 | Bacteria | 2471 |
| 541 | Ga0268264_10000599 | 3300028381 | Bacteria | 43601 |
| 542 | Ga0268264_10000903 | 3300028381 | Bacteria | 31199 |
| 543 | Ga0268264_10006736 | 3300028381 | Bacteria | 9653 |
| 544 | Ga0268264_10031782 | 3300028381 | Bacteria | 4329 |
| 545 | Ga0268264_10062312 | 3300028381 | Bacteria | 3131 |
| 546 | Ga0265336_10007064 | 3300028666 | Bacteria | 4011 |
| 547 | Ga0265324_10000004 | 3300029957 | Bacteria | 356972 |
| 548 | Ga0265324_10001102 | 3300029957 | Bacteria | 16245 |
| 549 | Ga0265330_10006254 | 3300031235 | Bacteria | 5886 |
| 550 | Ga0265332_10001350 | 3300031238 | Bacteria | 13902 |
| 551 | Ga0265332_10005682 | 3300031238 | Bacteria | 5732 |
| 552 | Ga0265325_10000146 | 3300031241 | Bacteria | 49815 |
| 553 | Ga0265329_10001643 | 3300031242 | Bacteria | 10683 |
| 554 | Ga0265339_10029021 | 3300031249 | Bacteria | 3142 |
| 555 | Ga0265331_10002588 | 3300031250 | Bacteria | 12163 |
| 556 | Ga0265331_10007731 | 3300031250 | Bacteria | 6181 |
| 557 | Ga0265331_10011916 | 3300031250 | Bacteria | 4738 |
| 558 | Ga0265331_10043358 | 3300031250 | Bacteria | 2179 |
| 559 | Ga0265327_10000116 | 3300031251 | Bacteria | 173745 |
| 560 | Ga0265327_10001001 | 3300031251 | Bacteria | 40152 |
| 561 | Ga0265327_10023172 | 3300031251 | Bacteria | 3684 |
| 562 | Ga0265316_10024673 | 3300031344 | Bacteria | 5030 |
| 563 | Ga0307408_100019736 | 3300031548 | Bacteria | 4541 |
| 564 | Ga0316575_10000088 | 3300031665 | Bacteria | 21957 |
| 565 | Ga0316575_10001975 | 3300031665 | Bacteria | 6800 |
| 566 | Ga0265314_10000805 | 3300031711 | Bacteria | 37292 |
| 567 | Ga0265314_10004095 | 3300031711 | Bacteria | 13734 |
| 568 | Ga0265314_10017301 | 3300031711 | Bacteria | 5662 |
| 569 | Ga0265314_10019191 | 3300031711 | Bacteria | 5302 |
| 570 | Ga0265342_10021049 | 3300031712 | Bacteria | 4172 |
| 571 | Ga0307413_10069257 | 3300031824 | Bacteria | 2213 |
| 572 | Ga0307410_10000539 | 3300031852 | Bacteria | 15527 |
| 573 | Ga0307410_10007189 | 3300031852 | Bacteria | 6074 |
| 574 | Ga0307410_10034141 | 3300031852 | Bacteria | 3291 |
| 575 | Ga0307406_10001458 | 3300031901 | Bacteria | 13084 |
| 576 | Ga0307406_10033432 | 3300031901 | Bacteria | 3148 |
| 577 | Ga0307406_10049673 | 3300031901 | Bacteria | 2655 |
| 578 | Ga0307407_10000212 | 3300031903 | Bacteria | 17550 |
| 579 | Ga0307407_10059371 | 3300031903 | Bacteria | 2227 |
| 580 | Ga0307412_10016813 | 3300031911 | Bacteria | 4368 |
| 581 | Ga0307412_10024072 | 3300031911 | Bacteria | 3755 |
| 582 | Ga0307409_100009515 | 3300031995 | Bacteria | 5976 |
| 583 | Ga0307409_100015897 | 3300031995 | Bacteria | 4958 |
| 584 | Ga0307409_100075040 | 3300031995 | Bacteria | 2705 |
| 585 | Ga0307416_100005850 | 3300032002 | Bacteria | 7625 |
| 586 | Ga0307416_100081807 | 3300032002 | Bacteria | 2732 |
| 587 | Ga0307411_10053451 | 3300032005 | Bacteria | 2646 |
| 588 | Ga0307415_100012415 | 3300032126 | Bacteria | 4925 |
| 589 | Ga0373940_0000154 | 3300035088 | Bacteria | 8966 |
| 590 | Ga0373949_0005416 | 3300035090 | Bacteria | 2849 |
| 591 | Ga0373952_0000495 | 3300035092 | Bacteria | 6851 |
| 592 | Ga0373945_0000908 | 3300035116 | Bacteria | 8764 |
| 593 | Ga0373954_0001074 | 3300035118 | Bacteria | 10913 |
| 594 | Ga0373946_0003481 | 3300035171 | Bacteria | 5583 |
| 595 | Ga0316574_0002518 | 3300035398 | Bacteria | 9209 |
| 596 | Ga0373924_0007745 | 3300035410 | Bacteria | 3882 |
| 597 | Ga0373931_0001495 | 3300035691 | Bacteria | 10057 |
| 598 | Ga0373935_0044374 | 3300035692 | Bacteria | 2801 |
| 599 | Ga0373927_0003205 | 3300035695 | Bacteria | 11785 |
| 600 | Ga0373947_0014038 | 3300035725 | Bacteria | 4592 |
| 601 | Ga0373937_0005419 | 3300036401 | Bacteria | 10918 |
| 602 | Ga0373937_0105332 | 3300036401 | Bacteria | 2621 |
| 603 | Ga0373937_0145140 | 3300036401 | Bacteria | 2221 |
| 604 | Ga0373925_0020604 | 3300037068 | Bacteria | 4803 |
| 605 | Ga0373925_0033488 | 3300037068 | Bacteria | 3786 |
| 606 | Ga0395900_0000981 | 3300037418 | Bacteria | 37107 |
| 607 | Ga0395898_0000872 | 3300037466 | Bacteria | 49248 |
| 608 | Ga0395898_0042031 | 3300037466 | Bacteria | 4512 |
| 609 | Ga0395901_0081543 | 3300038443 | Bacteria | 3379 |
| 610 | Ga0436365_1120368 | 3300039437 | Bacteria | 5020 |
| 611 | Ga0436361_0017830 | 3300039447 | Bacteria | 17066 |
| 612 | Ga0436361_0085764 | 3300039447 | Bacteria | 21430 |
| 613 | Ga0436361_1093254 | 3300039447 | Bacteria | 6544 |
| 614 | Ga0451577_0000002 | 3300042876 | Bacteria | 1731375 |
| 615 | Ga0451577_0000603 | 3300042876 | Bacteria | 57862 |
| 616 | Ga0451577_0008439 | 3300042876 | Bacteria | 10026 |
| 617 | Ga0451577_0019979 | 3300042876 | Bacteria | 6153 |
| 618 | Ga0451577_0023919 | 3300042876 | Bacteria | 5565 |
| 619 | Ga0451577_0038891 | 3300042876 | Bacteria | 4277 |
| 620 | Ga0451577_0045100 | 3300042876 | Bacteria | 3946 |
| 621 | Ga0451577_0088843 | 3300042876 | Bacteria | 2757 |
| 622 | Ga0466969_0003427 | 3300044656 | Bacteria | 8433 |
| 623 | Ga0453683_0000011 | 3300044673 | Bacteria | 412765 |
| 624 | Ga0466965_0024023 | 3300044683 | Bacteria | 2947 |
| 625 | Ga0466966_0026854 | 3300044684 | Bacteria | 3756 |
| 626 | Ga0466961_0000231 | 3300044693 | Bacteria | 37788 |
| 627 | Ga0466964_0007763 | 3300044706 | Bacteria | 4016 |
| 628 | Ga0453684_0000002 | 3300044712 | Bacteria | 1731375 |
| 629 | Ga0453684_0000014 | 3300044712 | Bacteria | 993311 |
| 630 | Ga0453684_0000040 | 3300044712 | Bacteria | 690210 |
| 631 | Ga0453684_0000114 | 3300044712 | Bacteria | 356610 |
| 632 | Ga0453684_0000369 | 3300044712 | Bacteria | 184784 |
| 633 | Ga0453684_0001602 | 3300044712 | Bacteria | 62203 |
| 634 | Ga0453684_0005149 | 3300044712 | Bacteria | 26304 |
| 635 | Ga0453684_0027107 | 3300044712 | Bacteria | 8234 |
| 636 | Ga0453684_0080484 | 3300044712 | Bacteria | 4067 |
| 637 | Ga0453684_0095278 | 3300044712 | Bacteria | 3659 |
| 638 | Ga0466959_0008790 | 3300045049 | Bacteria | 7155 |
| 639 | Ga0451576_0000004 | 3300045051 | Bacteria | 1312238 |
| 640 | Ga0451576_0000060 | 3300045051 | Bacteria | 290345 |
| 641 | Ga0451576_0000168 | 3300045051 | Bacteria | 165624 |
| 642 | Ga0451576_0000313 | 3300045051 | Bacteria | 117520 |
| 643 | Ga0451576_0004696 | 3300045051 | Bacteria | 17570 |
| 644 | Ga0451576_0005200 | 3300045051 | Bacteria | 16437 |
| 645 | Ga0451576_0005859 | 3300045051 | Bacteria | 15264 |
| 646 | Ga0451576_0006582 | 3300045051 | Bacteria | 14211 |
| 647 | Ga0451576_0048192 | 3300045051 | Bacteria | 4477 |
| 648 | Ga0451576_0068412 | 3300045051 | Bacteria | 3695 |
| 649 | Ga0451576_0123887 | 3300045051 | Bacteria | 2692 |
| 650 | Ga0451576_0142644 | 3300045051 | Bacteria | 2498 |
| 651 | Ga0495603_0013925 | 3300046455 | Bacteria | 4864 |
| 652 | Ga0495580_0006840 | 3300046472 | Bacteria | 9235 |
| 653 | Ga0495580_0030164 | 3300046472 | Bacteria | 3928 |
| 654 | Ga0495639_0004676 | 3300046475 | Bacteria | 5879 |
| 655 | Ga0495664_0009419 | 3300046477 | Bacteria | 5465 |
| 656 | Ga0495594_0040835 | 3300046499 | Bacteria | 2540 |
| 657 | Ga0495586_0007760 | 3300046535 | Bacteria | 5721 |
| 658 | Ga0495587_0016278 | 3300046536 | Bacteria | 4628 |
| 659 | Ga0495621_0012611 | 3300046539 | Bacteria | 2638 |
| 660 | Ga0495645_0002022 | 3300046543 | Bacteria | 13815 |
| 661 | Ga0495645_0056327 | 3300046543 | Bacteria | 2854 |
| 662 | Ga0495658_0016036 | 3300046683 | Bacteria | 3854 |
| 663 | Ga0495613_0016801 | 3300046689 | Bacteria | 5449 |
| 664 | Ga0495676_0043684 | 3300047321 | Bacteria | 3664 |
| 665 | Ga0495680_0037036 | 3300047322 | Bacteria | 3910 |
| 666 | Ga0495602_0057613 | 3300048088 | Bacteria | 3407 |
| 667 | Ga0496100_0025109 | 3300048903 | Bacteria | 3641 |
| 668 | Ga0496100_0063092 | 3300048903 | Bacteria | 2447 |
| 669 | Ga0496102_0001476 | 3300048905 | Bacteria | 20754 |
| 670 | Ga0496102_0019848 | 3300048905 | Bacteria | 5926 |
| 671 | Ga0496104_0005678 | 3300048907 | Bacteria | 10925 |
| 672 | Ga0496104_0071700 | 3300048907 | Bacteria | 3294 |
| 673 | Ga0496105_0001094 | 3300048908 | Bacteria | 18813 |
| 674 | Ga0496106_0000071 | 3300048909 | Bacteria | 82296 |
| 675 | Ga0496107_0055393 | 3300048910 | Bacteria | 2864 |
| 676 | Ga0496108_0005943 | 3300048911 | Bacteria | 9886 |
| 677 | Ga0496108_0084474 | 3300048911 | Bacteria | 2694 |
| 678 | Ga0496109_0003575 | 3300048912 | Bacteria | 12981 |
| 679 | Ga0496111_0029893 | 3300048914 | Bacteria | 3872 |
| 680 | Ga0496112_0000965 | 3300048915 | Bacteria | 20914 |
| 681 | Ga0496112_0011743 | 3300048915 | Bacteria | 8019 |
| 682 | Ga0496112_0052895 | 3300048915 | Bacteria | 3987 |
| 683 | Ga0496113_0033825 | 3300048916 | Bacteria | 3725 |
| 684 | Ga0496115_0057466 | 3300048918 | Bacteria | 3130 |
| 685 | Ga0496126_0069861 | 3300048929 | Bacteria | 3131 |
| 686 | Ga0501032_0001858 | 3300049569 | Bacteria | 16696 |
| 687 | Ga0501034_0014335 | 3300049571 | Bacteria | 8170 |
| 688 | Ga0501038_0052633 | 3300049574 | Bacteria | 3509 |
| 689 | Ga0501043_0000024 | 3300049579 | Bacteria | 154045 |
| 690 | Ga0501046_0000173 | 3300049580 | Bacteria | 65571 |
| 691 | Ga0501047_0000051 | 3300049581 | Bacteria | 154281 |
| 692 | Ga0501047_0042588 | 3300049581 | Bacteria | 4387 |
| 693 | Ga0501048_0000650 | 3300049582 | Bacteria | 25020 |
| 694 | Ga0501070_0111300 | 3300049586 | Bacteria | 2263 |
| 695 | Ga0501074_0025894 | 3300049590 | Bacteria | 4256 |
| 696 | Ga0501209_000060 | 3300049656 | Bacteria | 10768 |
| 697 | Ga0501080_0003344 | 3300049742 | Bacteria | 14161 |
| 698 | Ga0501080_0073539 | 3300049742 | Bacteria | 3180 |
| 699 | Ga0501083_0007626 | 3300049744 | Bacteria | 7667 |
| 700 | Ga0501083_0051526 | 3300049744 | Bacteria | 2767 |
| 701 | Ga0501280_000270 | 3300049776 | Bacteria | 13172 |
| 702 | Ga0501045_0003244 | 3300049824 | Bacteria | 11107 |
| 703 | nmdc:mga0k408_743_c1 | 3300050493 | Bacteria | 17886 |
| 704 | nmdc:mga05p37_12551_c1 | 3300050507 | Bacteria | 10115 |
| 705 | nmdc:mga05p37_2739_c1 | 3300050507 | Bacteria | 20490 |
| 706 | nmdc:mga09592_166_c1 | 3300050508 | Bacteria | 46469 |
| 707 | nmdc:mga09592_2082_c1 | 3300050508 | Bacteria | 16134 |
| 708 | nmdc:mga09592_2899_c1 | 3300050508 | Bacteria | 13899 |
| 709 | nmdc:mga06r32_58749_c1 | 3300050510 | Bacteria | 3697 |
| 710 | nmdc:mga08y16_18073_c1 | 3300050511 | Bacteria | 7426 |
| 711 | nmdc:mga08y16_23820_c1 | 3300050511 | Bacteria | 6465 |
| 712 | nmdc:mga08y16_25033_c1 | 3300050511 | Bacteria | 6296 |
| 713 | nmdc:mga08y16_8834_c1 | 3300050511 | Bacteria | 10575 |
| 714 | nmdc:mga0n895_35092_c1 | 3300050512 | Bacteria | 4834 |
| 715 | nmdc:mga0n895_6694_c1 | 3300050512 | Bacteria | 9821 |
| 716 | nmdc:mga0rr50_11221_c1 | 3300050513 | Bacteria | 5721 |
| 717 | nmdc:mga0rr50_1122_c1 | 3300050513 | Bacteria | 14549 |
| 718 | nmdc:mga0rr50_14310_c1 | 3300050513 | Bacteria | 5199 |
| 719 | nmdc:mga08x19_1037_c1 | 3300050514 | Bacteria | 17365 |
| 720 | nmdc:mga08x19_1250_c1 | 3300050514 | Bacteria | 15761 |
| 721 | nmdc:mga08x19_5213_c1 | 3300050514 | Bacteria | 7688 |
| 722 | nmdc:mga0a205_17234_c1 | 3300050515 | Bacteria | 6766 |
| 723 | nmdc:mga0a205_33507_c2 | 3300050515 | Bacteria | 4535 |
| 724 | nmdc:mga0a205_6672_c2 | 3300050515 | Bacteria | 9654 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300014745 | Ga0157377_10040958 | Ga0157377_100409582 | 529 |
| 2 | 3300050512 | nmdc:mga0n895_35092_c1 | nmdc:mga0n895_35092_c1_1355_3322 | 560 |
| 3 | 3300032002 | Ga0307416_100081807 | Ga0307416_1000818072 | 561 |
| 4 | 3300031548 | Ga0307408_100019736 | Ga0307408_1000197363 | 565 |
| 5 | 3300009177 | Ga0105248_10030277 | Ga0105248_100302773 | 570 |
| 6 | 3300025917 | Ga0207660_10029187 | Ga0207660_100291872 | 570 |
| 7 | 3300049579 | Ga0501043_0000024 | Ga0501043_0000024_34297_36366 | 570 |
| 8 | 3300049580 | Ga0501046_0000173 | Ga0501046_0000173_34297_36366 | 570 |
| 9 | 3300049581 | Ga0501047_0000051 | Ga0501047_0000051_117916_119985 | 570 |
| 10 | 3300049582 | Ga0501048_0000650 | Ga0501048_0000650_17145_19214 | 570 |
| 11 | 3300049824 | Ga0501045_0003244 | Ga0501045_0003244_5844_7913 | 570 |
| 12 | 3300046536 | Ga0495587_0016278 | Ga0495587_0016278_997_2958 | 571 |
| 13 | 3300046543 | Ga0495645_0002022 | Ga0495645_0002022_11267_13228 | 571 |
| 14 | 3300048088 | Ga0495602_0057613 | Ga0495602_0057613_57_2018 | 571 |
| 15 | 3300006880 | Ga0075429_100029138 | Ga0075429_1000291383 | 573 |
| 16 | 3300006844 | Ga0075428_100010121 | Ga0075428_1000101215 | 574 |
| 17 | 3300006847 | Ga0075431_100011080 | Ga0075431_1000110804 | 574 |
| 18 | 3300050510 | nmdc:mga06r32_58749_c1 | nmdc:mga06r32_58749_c1_1074_3053 | 575 |
| 19 | 3300035090 | Ga0373949_0005416 | Ga0373949_0005416_511_2484 | 578 |
| 20 | 3300005340 | Ga0070689_100065481 | Ga0070689_1000654812 | 579 |
| 21 | 3300005330 | Ga0070690_100006548 | Ga0070690_1000065487 | 582 |
| 22 | 3300005334 | Ga0068869_100001670 | Ga0068869_1000016705 | 582 |
| 23 | 3300005338 | Ga0068868_100009123 | Ga0068868_1000091233 | 582 |
| 24 | 3300005340 | Ga0070689_100001098 | Ga0070689_10000109817 | 582 |
| 25 | 3300005341 | Ga0070691_10004112 | Ga0070691_100041125 | 582 |
| 26 | 3300005343 | Ga0070687_100000491 | Ga0070687_10000049115 | 582 |
| 27 | 3300005345 | Ga0070692_10001668 | Ga0070692_100016683 | 582 |
| 28 | 3300005353 | Ga0070669_100048427 | Ga0070669_1000484272 | 582 |
| 29 | 3300005440 | Ga0070705_100000455 | Ga0070705_10000045515 | 582 |
| 30 | 3300005444 | Ga0070694_100000773 | Ga0070694_1000007736 | 582 |
| 31 | 3300005459 | Ga0068867_100002290 | Ga0068867_1000022905 | 582 |
| 32 | 3300005530 | Ga0070679_100023626 | Ga0070679_1000236267 | 582 |
| 33 | 3300005544 | Ga0070686_100004246 | Ga0070686_1000042465 | 582 |
| 34 | 3300005545 | Ga0070695_100001745 | Ga0070695_1000017457 | 582 |
| 35 | 3300005547 | Ga0070693_100000237 | Ga0070693_1000002377 | 582 |
| 36 | 3300005549 | Ga0070704_100000008 | Ga0070704_10000000868 | 582 |
| 37 | 3300005563 | Ga0068855_100005852 | Ga0068855_1000058525 | 582 |
| 38 | 3300005578 | Ga0068854_100030295 | Ga0068854_1000302952 | 582 |
| 39 | 3300005614 | Ga0068856_100088512 | Ga0068856_1000885122 | 582 |
| 40 | 3300005615 | Ga0070702_100000012 | Ga0070702_10000001212 | 582 |
| 41 | 3300005617 | Ga0068859_100009197 | Ga0068859_1000091978 | 582 |
| 42 | 3300005718 | Ga0068866_10001702 | Ga0068866_100017027 | 582 |
| 43 | 3300005719 | Ga0068861_100001987 | Ga0068861_10000198711 | 582 |
| 44 | 3300005842 | Ga0068858_100005913 | Ga0068858_1000059137 | 582 |
| 45 | 3300005843 | Ga0068860_100010866 | Ga0068860_1000108666 | 582 |
| 46 | 3300006237 | Ga0097621_100003001 | Ga0097621_1000030019 | 582 |
| 47 | 3300006358 | Ga0068871_100000594 | Ga0068871_1000005942 | 582 |
| 48 | 3300006881 | Ga0068865_100004473 | Ga0068865_1000044733 | 582 |
| 49 | 3300006931 | Ga0097620_100009197 | Ga0097620_1000091978 | 582 |
| 50 | 3300009098 | Ga0105245_10003077 | Ga0105245_100030778 | 582 |
| 51 | 3300009148 | Ga0105243_10001330 | Ga0105243_1000133022 | 582 |
| 52 | 3300009176 | Ga0105242_10001867 | Ga0105242_1000186711 | 582 |
| 53 | 3300009553 | Ga0105249_10002333 | Ga0105249_100023337 | 582 |
| 54 | 3300013297 | Ga0157378_10000637 | Ga0157378_1000063726 | 582 |
| 55 | 3300014326 | Ga0157380_10050666 | Ga0157380_100506663 | 582 |
| 56 | 3300014969 | Ga0157376_10004622 | Ga0157376_100046227 | 582 |
| 57 | 3300025918 | Ga0207662_10000366 | Ga0207662_1000036619 | 582 |
| 58 | 3300025921 | Ga0207652_10099601 | Ga0207652_100996011 | 582 |
| 59 | 3300025923 | Ga0207681_10088894 | Ga0207681_100888941 | 582 |
| 60 | 3300025927 | Ga0207687_10003076 | Ga0207687_1000307611 | 582 |
| 61 | 3300025934 | Ga0207686_10000894 | Ga0207686_1000089412 | 582 |
| 62 | 3300025935 | Ga0207709_10001289 | Ga0207709_1000128911 | 582 |
| 63 | 3300025942 | Ga0207689_10002415 | Ga0207689_100024157 | 582 |
| 64 | 3300025961 | Ga0207712_10008029 | Ga0207712_100080293 | 582 |
| 65 | 3300025981 | Ga0207640_10006016 | Ga0207640_100060166 | 582 |
| 66 | 3300026035 | Ga0207703_10005598 | Ga0207703_100055988 | 582 |
| 67 | 3300026089 | Ga0207648_10004860 | Ga0207648_100048608 | 582 |
| 68 | 3300026118 | Ga0207675_100007242 | Ga0207675_1000072425 | 582 |
| 69 | 3300028381 | Ga0268264_10000903 | Ga0268264_100009033 | 582 |
| 70 | 3300035088 | Ga0373940_0000154 | Ga0373940_0000154_2758_4731 | 583 |
| 71 | 3300035691 | Ga0373931_0001495 | Ga0373931_0001495_7204_9177 | 583 |
| 72 | 3300005616 | Ga0068852_100000254 | Ga0068852_10000025441 | 584 |
| 73 | 3300005834 | Ga0068851_10007141 | Ga0068851_100071412 | 584 |
| 74 | 3300006237 | Ga0097621_100016878 | Ga0097621_1000168783 | 584 |
| 75 | 3300009093 | Ga0105240_10135381 | Ga0105240_101353812 | 584 |
| 76 | 3300010375 | Ga0105239_10032408 | Ga0105239_100324085 | 584 |
| 77 | 3300025321 | Ga0207656_10001267 | Ga0207656_100012672 | 584 |
| 78 | 3300025913 | Ga0207695_10134541 | Ga0207695_101345412 | 584 |
| 79 | 3300048907 | Ga0496104_0071700 | Ga0496104_0071700_1243_3213 | 584 |
| 80 | 3300005459 | Ga0068867_100023285 | Ga0068867_1000232852 | 586 |
| 81 | 3300006914 | Ga0075436_100000095 | Ga0075436_10000009522 | 593 |
| 82 | 3300050514 | nmdc:mga08x19_1037_c1 | nmdc:mga08x19_1037_c1_10966_12936 | 593 |
| 83 | 3300005458 | Ga0070681_10006206 | Ga0070681_1000620612 | 596 |
| 84 | 3300005614 | Ga0068856_100022733 | Ga0068856_1000227335 | 596 |
| 85 | 3300025912 | Ga0207707_10054059 | Ga0207707_100540592 | 596 |
| 86 | 3300025920 | Ga0207649_10016743 | Ga0207649_100167433 | 596 |
| 87 | 3300025931 | Ga0207644_10028208 | Ga0207644_100282083 | 596 |
| 88 | 3300026078 | Ga0207702_10033649 | Ga0207702_100336492 | 596 |
| 89 | 3300026116 | Ga0207674_10079979 | Ga0207674_100799792 | 596 |
| 90 | 3300009551 | Ga0105238_10017261 | Ga0105238_100172612 | 597 |
| 91 | 3300025949 | Ga0207667_10083787 | Ga0207667_100837872 | 597 |
| 92 | 3300036401 | Ga0373937_0145140 | Ga0373937_0145140_31_2016 | 597 |
| 93 | 3300037418 | Ga0395900_0000981 | Ga0395900_0000981_27116_29110 | 597 |
| 94 | 3300037466 | Ga0395898_0000872 | Ga0395898_0000872_3907_5901 | 597 |
| 95 | 3300005563 | Ga0068855_100092941 | Ga0068855_1000929413 | 598 |
| 96 | 3300009174 | Ga0105241_10012648 | Ga0105241_100126485 | 598 |
| 97 | 3300025911 | Ga0207654_10019181 | Ga0207654_100191812 | 598 |
| 98 | 3300006163 | Ga0070715_10009123 | Ga0070715_100091233 | 601 |
| 99 | 3300027665 | Ga0209983_1001921 | Ga0209983_10019212 | 602 |
| 100 | 3300045051 | Ga0451576_0005859 | Ga0451576_0005859_10557_12584 | 603 |
| 101 | 3300005834 | Ga0068851_10006845 | Ga0068851_100068455 | 604 |
| 102 | 3300013296 | Ga0157374_10016750 | Ga0157374_100167502 | 604 |
| 103 | 3300049656 | Ga0501209_000060 | Ga0501209_000060_2718_4691 | 604 |
| 104 | 3300005530 | Ga0070679_100026619 | Ga0070679_1000266194 | 605 |
| 105 | 3300005458 | Ga0070681_10021120 | Ga0070681_100211206 | 606 |
| 106 | 3300025945 | Ga0207679_10009411 | Ga0207679_100094115 | 607 |
| 107 | 3300031235 | Ga0265330_10006254 | Ga0265330_100062544 | 607 |
| 108 | 3300031238 | Ga0265332_10001350 | Ga0265332_100013504 | 607 |
| 109 | 3300031242 | Ga0265329_10001643 | Ga0265329_100016439 | 607 |
| 110 | 3300031251 | Ga0265327_10001001 | Ga0265327_1000100112 | 607 |
| 111 | 3300031344 | Ga0265316_10024673 | Ga0265316_100246732 | 607 |
| 112 | 3300031711 | Ga0265314_10019191 | Ga0265314_100191916 | 607 |
| 113 | 3300005548 | Ga0070665_100073184 | Ga0070665_1000731842 | 608 |
| 114 | 3300009094 | Ga0111539_10037333 | Ga0111539_100373334 | 609 |
| 115 | 3300050512 | nmdc:mga0n895_6694_c1 | nmdc:mga0n895_6694_c1_678_2651 | 609 |
| 116 | 3300050513 | nmdc:mga0rr50_1122_c1 | nmdc:mga0rr50_1122_c1_11858_13831 | 609 |
| 117 | 3300050514 | nmdc:mga08x19_5213_c1 | nmdc:mga08x19_5213_c1_1629_3602 | 609 |
| 118 | 3300050515 | nmdc:mga0a205_6672_c2 | nmdc:mga0a205_6672_c2_7013_8986 | 609 |
| 119 | 3300005617 | Ga0068859_100048127 | Ga0068859_1000481273 | 610 |
| 120 | 3300005842 | Ga0068858_100009188 | Ga0068858_1000091883 | 610 |
| 121 | 3300006237 | Ga0097621_100008117 | Ga0097621_1000081177 | 610 |
| 122 | 3300006237 | Ga0097621_100014367 | Ga0097621_1000143673 | 610 |
| 123 | 3300006358 | Ga0068871_100003366 | Ga0068871_1000033665 | 610 |
| 124 | 3300006358 | Ga0068871_100033066 | Ga0068871_1000330664 | 610 |
| 125 | 3300006881 | Ga0068865_100037043 | Ga0068865_1000370432 | 610 |
| 126 | 3300006931 | Ga0097620_100048125 | Ga0097620_1000481253 | 610 |
| 127 | 3300009098 | Ga0105245_10007877 | Ga0105245_100078777 | 610 |
| 128 | 3300009176 | Ga0105242_10005169 | Ga0105242_100051697 | 610 |
| 129 | 3300009177 | Ga0105248_10029748 | Ga0105248_100297486 | 610 |
| 130 | 3300014968 | Ga0157379_10005730 | Ga0157379_100057303 | 610 |
| 131 | 3300025942 | Ga0207689_10070944 | Ga0207689_100709442 | 610 |
| 132 | 3300038443 | Ga0395901_0081543 | Ga0395901_0081543_1355_3319 | 610 |
| 133 | 3300042876 | Ga0451577_0019979 | Ga0451577_0019979_1182_3155 | 611 |
| 134 | 3300045051 | Ga0451576_0004696 | Ga0451576_0004696_2673_4646 | 611 |
| 135 | 3300049574 | Ga0501038_0052633 | Ga0501038_0052633_1181_3217 | 612 |
| 136 | 3300005563 | Ga0068855_100014386 | Ga0068855_1000143862 | 614 |
| 137 | 3300013104 | Ga0157370_10008837 | Ga0157370_100088374 | 614 |
| 138 | 3300025933 | Ga0207706_10014160 | Ga0207706_100141607 | 614 |
| 139 | 3300025949 | Ga0207667_10045578 | Ga0207667_100455783 | 614 |
| 140 | 3300042876 | Ga0451577_0000002 | Ga0451577_0000002_1346545_1348521 | 614 |
| 141 | 3300044673 | Ga0453683_0000011 | Ga0453683_0000011_401064_403040 | 614 |
| 142 | 3300044712 | Ga0453684_0000002 | Ga0453684_0000002_382855_384831 | 614 |
| 143 | 3300045051 | Ga0451576_0000004 | Ga0451576_0000004_9495_11471 | 614 |
| 144 | 3300005563 | Ga0068855_100046323 | Ga0068855_1000463235 | 615 |
| 145 | 3300035116 | Ga0373945_0000908 | Ga0373945_0000908_78_2051 | 615 |
| 146 | 3300046455 | Ga0495603_0013925 | Ga0495603_0013925_63_2036 | 615 |
| 147 | 3300046472 | Ga0495580_0006840 | Ga0495580_0006840_63_2036 | 615 |
| 148 | 3300046475 | Ga0495639_0004676 | Ga0495639_0004676_492_2465 | 615 |
| 149 | 3300046535 | Ga0495586_0007760 | Ga0495586_0007760_831_2804 | 615 |
| 150 | 3300046683 | Ga0495658_0016036 | Ga0495658_0016036_955_2928 | 615 |
| 151 | 3300047321 | Ga0495676_0043684 | Ga0495676_0043684_858_2831 | 615 |
| 152 | 3300005366 | Ga0070659_100076911 | Ga0070659_1000769112 | 616 |
| 153 | 3300005614 | Ga0068856_100039603 | Ga0068856_1000396032 | 616 |
| 154 | 3300026078 | Ga0207702_10030720 | Ga0207702_100307204 | 616 |
| 155 | 3300029957 | Ga0265324_10001102 | Ga0265324_1000110212 | 616 |
| 156 | 3300031711 | Ga0265314_10017301 | Ga0265314_100173014 | 616 |
| 157 | 3300037466 | Ga0395898_0042031 | Ga0395898_0042031_1997_3997 | 616 |
| 158 | 3300039437 | Ga0436365_1120368 | Ga0436365_1120368_2853_4817 | 616 |
| 159 | 3300048915 | Ga0496112_0011743 | Ga0496112_0011743_432_2456 | 617 |
| 160 | 3300048916 | Ga0496113_0033825 | Ga0496113_0033825_748_2772 | 617 |
| 161 | 3300005843 | Ga0068860_100056157 | Ga0068860_1000561571 | 618 |
| 162 | 3300048905 | Ga0496102_0019848 | Ga0496102_0019848_1870_3819 | 618 |
| 163 | 3300005329 | Ga0070683_100001455 | Ga0070683_1000014556 | 619 |
| 164 | 3300005334 | Ga0068869_100001214 | Ga0068869_1000012145 | 619 |
| 165 | 3300005340 | Ga0070689_100009989 | Ga0070689_1000099896 | 619 |
| 166 | 3300005466 | Ga0070685_10000779 | Ga0070685_100007796 | 619 |
| 167 | 3300005535 | Ga0070684_100061128 | Ga0070684_1000611282 | 619 |
| 168 | 3300005577 | Ga0068857_100029178 | Ga0068857_1000291784 | 619 |
| 169 | 3300005618 | Ga0068864_100001197 | Ga0068864_10000119711 | 619 |
| 170 | 3300005834 | Ga0068851_10020462 | Ga0068851_100204622 | 619 |
| 171 | 3300005842 | Ga0068858_100005717 | Ga0068858_1000057172 | 619 |
| 172 | 3300005843 | Ga0068860_100088409 | Ga0068860_1000884092 | 619 |
| 173 | 3300009553 | Ga0105249_10059080 | Ga0105249_100590802 | 619 |
| 174 | 3300013296 | Ga0157374_10004187 | Ga0157374_100041872 | 619 |
| 175 | 3300013297 | Ga0157378_10011674 | Ga0157378_100116742 | 619 |
| 176 | 3300025315 | Ga0207697_10000020 | Ga0207697_1000002021 | 619 |
| 177 | 3300025893 | Ga0207682_10000532 | Ga0207682_1000053218 | 619 |
| 178 | 3300025901 | Ga0207688_10000534 | Ga0207688_1000053411 | 619 |
| 179 | 3300025907 | Ga0207645_10000516 | Ga0207645_1000051612 | 619 |
| 180 | 3300025908 | Ga0207643_10000131 | Ga0207643_1000013138 | 619 |
| 181 | 3300025918 | Ga0207662_10026857 | Ga0207662_100268571 | 619 |
| 182 | 3300025925 | Ga0207650_10004339 | Ga0207650_100043392 | 619 |
| 183 | 3300025926 | Ga0207659_10001463 | Ga0207659_100014638 | 619 |
| 184 | 3300025933 | Ga0207706_10002254 | Ga0207706_1000225411 | 619 |
| 185 | 3300025940 | Ga0207691_10003500 | Ga0207691_1000350013 | 619 |
| 186 | 3300025942 | Ga0207689_10000091 | Ga0207689_100000918 | 619 |
| 187 | 3300025945 | Ga0207679_10008523 | Ga0207679_100085232 | 619 |
| 188 | 3300026075 | Ga0207708_10001492 | Ga0207708_1000149217 | 619 |
| 189 | 3300026089 | Ga0207648_10000415 | Ga0207648_1000041542 | 619 |
| 190 | 3300026095 | Ga0207676_10009655 | Ga0207676_100096555 | 619 |
| 191 | 3300026116 | Ga0207674_10001995 | Ga0207674_1000199526 | 619 |
| 192 | 3300026118 | Ga0207675_100000930 | Ga0207675_10000093022 | 619 |
| 193 | 3300026121 | Ga0207683_10001697 | Ga0207683_1000169712 | 619 |
| 194 | 3300048903 | Ga0496100_0025109 | Ga0496100_0025109_160_2124 | 619 |
| 195 | 3300048911 | Ga0496108_0005943 | Ga0496108_0005943_3651_5615 | 619 |
| 196 | 3300048912 | Ga0496109_0003575 | Ga0496109_0003575_2949_4913 | 619 |
| 197 | 3300005367 | Ga0070667_100047683 | Ga0070667_1000476832 | 620 |
| 198 | 3300005471 | Ga0070698_100009607 | Ga0070698_1000096074 | 620 |
| 199 | 3300005530 | Ga0070679_100025515 | Ga0070679_1000255154 | 620 |
| 200 | 3300005842 | Ga0068858_100081854 | Ga0068858_1000818541 | 620 |
| 201 | 3300006914 | Ga0075436_100011908 | Ga0075436_1000119082 | 620 |
| 202 | 3300009174 | Ga0105241_10012139 | Ga0105241_100121393 | 620 |
| 203 | 3300014968 | Ga0157379_10038383 | Ga0157379_100383832 | 620 |
| 204 | 3300025925 | Ga0207650_10036045 | Ga0207650_100360452 | 620 |
| 205 | 3300050514 | nmdc:mga08x19_1250_c1 | nmdc:mga08x19_1250_c1_11741_13708 | 620 |
| 206 | 3300005434 | Ga0070709_10003074 | Ga0070709_100030745 | 621 |
| 207 | 3300005437 | Ga0070710_10003607 | Ga0070710_100036076 | 621 |
| 208 | 3300005546 | Ga0070696_100012564 | Ga0070696_1000125645 | 621 |
| 209 | 3300005617 | Ga0068859_100009660 | Ga0068859_1000096607 | 621 |
| 210 | 3300005843 | Ga0068860_100108955 | Ga0068860_1001089552 | 621 |
| 211 | 3300006844 | Ga0075428_100007373 | Ga0075428_10000737312 | 621 |
| 212 | 3300006880 | Ga0075429_100000461 | Ga0075429_10000046119 | 621 |
| 213 | 3300006931 | Ga0097620_100009661 | Ga0097620_1000096614 | 621 |
| 214 | 3300009094 | Ga0111539_10062750 | Ga0111539_100627502 | 621 |
| 215 | 3300009147 | Ga0114129_10025059 | Ga0114129_100250597 | 621 |
| 216 | 3300025929 | Ga0207664_10005012 | Ga0207664_100050126 | 621 |
| 217 | 3300027907 | Ga0207428_10005166 | Ga0207428_100051664 | 621 |
| 218 | 3300028381 | Ga0268264_10062312 | Ga0268264_100623122 | 621 |
| 219 | 3300050507 | nmdc:mga05p37_12551_c1 | nmdc:mga05p37_12551_c1_930_2903 | 621 |
| 220 | 3300050508 | nmdc:mga09592_166_c1 | nmdc:mga09592_166_c1_7600_9573 | 621 |
| 221 | 3300050511 | nmdc:mga08y16_8834_c1 | nmdc:mga08y16_8834_c1_6422_8395 | 621 |
| 222 | 3300005331 | Ga0070670_100013210 | Ga0070670_1000132102 | 622 |
| 223 | 3300005334 | Ga0068869_100000356 | Ga0068869_10000035618 | 622 |
| 224 | 3300005335 | Ga0070666_10050557 | Ga0070666_100505572 | 622 |
| 225 | 3300005338 | Ga0068868_100027032 | Ga0068868_1000270323 | 622 |
| 226 | 3300005347 | Ga0070668_100066284 | Ga0070668_1000662842 | 622 |
| 227 | 3300005364 | Ga0070673_100025598 | Ga0070673_1000255983 | 622 |
| 228 | 3300005367 | Ga0070667_100001403 | Ga0070667_10000140314 | 622 |
| 229 | 3300005459 | Ga0068867_100036656 | Ga0068867_1000366561 | 622 |
| 230 | 3300005577 | Ga0068857_100020112 | Ga0068857_1000201121 | 622 |
| 231 | 3300005617 | Ga0068859_100014353 | Ga0068859_1000143539 | 622 |
| 232 | 3300005618 | Ga0068864_100000981 | Ga0068864_10000098115 | 622 |
| 233 | 3300005719 | Ga0068861_100013391 | Ga0068861_1000133911 | 622 |
| 234 | 3300005841 | Ga0068863_100004419 | Ga0068863_1000044198 | 622 |
| 235 | 3300005842 | Ga0068858_100001946 | Ga0068858_10000194618 | 622 |
| 236 | 3300005843 | Ga0068860_100023185 | Ga0068860_1000231851 | 622 |
| 237 | 3300005844 | Ga0068862_100007718 | Ga0068862_10000771811 | 622 |
| 238 | 3300006931 | Ga0097620_100014355 | Ga0097620_1000143559 | 622 |
| 239 | 3300009177 | Ga0105248_10001115 | Ga0105248_1000111520 | 622 |
| 240 | 3300013297 | Ga0157378_10044886 | Ga0157378_100448863 | 622 |
| 241 | 3300013308 | Ga0157375_10035251 | Ga0157375_100352512 | 622 |
| 242 | 3300014325 | Ga0163163_10141160 | Ga0163163_101411602 | 622 |
| 243 | 3300014968 | Ga0157379_10009459 | Ga0157379_1000945910 | 622 |
| 244 | 3300025903 | Ga0207680_10037591 | Ga0207680_100375912 | 622 |
| 245 | 3300025907 | Ga0207645_10002067 | Ga0207645_1000206718 | 622 |
| 246 | 3300025925 | Ga0207650_10008205 | Ga0207650_100082057 | 622 |
| 247 | 3300025940 | Ga0207691_10127843 | Ga0207691_101278432 | 622 |
| 248 | 3300025942 | Ga0207689_10001242 | Ga0207689_1000124218 | 622 |
| 249 | 3300025960 | Ga0207651_10010046 | Ga0207651_100100465 | 622 |
| 250 | 3300025972 | Ga0207668_10084494 | Ga0207668_100844942 | 622 |
| 251 | 3300026023 | Ga0207677_10023282 | Ga0207677_100232823 | 622 |
| 252 | 3300026035 | Ga0207703_10003742 | Ga0207703_100037422 | 622 |
| 253 | 3300026088 | Ga0207641_10042121 | Ga0207641_100421211 | 622 |
| 254 | 3300026095 | Ga0207676_10006171 | Ga0207676_100061716 | 622 |
| 255 | 3300026116 | Ga0207674_10022759 | Ga0207674_100227594 | 622 |
| 256 | 3300026118 | Ga0207675_100007047 | Ga0207675_10000704712 | 622 |
| 257 | 3300028381 | Ga0268264_10000599 | Ga0268264_1000059946 | 622 |
| 258 | 3300005329 | Ga0070683_100018710 | Ga0070683_1000187104 | 623 |
| 259 | 3300005339 | Ga0070660_100002638 | Ga0070660_10000263816 | 623 |
| 260 | 3300005535 | Ga0070684_100010095 | Ga0070684_1000100952 | 623 |
| 261 | 3300005577 | Ga0068857_100000165 | Ga0068857_10000016545 | 623 |
| 262 | 3300005578 | Ga0068854_100064765 | Ga0068854_1000647652 | 623 |
| 263 | 3300005614 | Ga0068856_100000375 | Ga0068856_10000037512 | 623 |
| 264 | 3300005616 | Ga0068852_100000371 | Ga0068852_10000037130 | 623 |
| 265 | 3300009551 | Ga0105238_10000556 | Ga0105238_1000055612 | 623 |
| 266 | 3300013104 | Ga0157370_10005207 | Ga0157370_100052079 | 623 |
| 267 | 3300013105 | Ga0157369_10001573 | Ga0157369_1000157324 | 623 |
| 268 | 3300025919 | Ga0207657_10011489 | Ga0207657_100114893 | 623 |
| 269 | 3300025925 | Ga0207650_10007990 | Ga0207650_100079903 | 623 |
| 270 | 3300025945 | Ga0207679_10014353 | Ga0207679_100143533 | 623 |
| 271 | 3300025981 | Ga0207640_10014498 | Ga0207640_100144985 | 623 |
| 272 | 3300026116 | Ga0207674_10000180 | Ga0207674_1000018053 | 623 |
| 273 | 3300044684 | Ga0466966_0026854 | Ga0466966_0026854_1848_3728 | 624 |
| 274 | 3300031665 | Ga0316575_10001975 | Ga0316575_100019752 | 625 |
| 275 | 3300037068 | Ga0373925_0033488 | Ga0373925_0033488_1201_3165 | 625 |
| 276 | 3300044712 | Ga0453684_0000040 | Ga0453684_0000040_320777_322756 | 626 |
| 277 | 3300050515 | nmdc:mga0a205_17234_c1 | nmdc:mga0a205_17234_c1_3164_5125 | 626 |
| 278 | 3300005331 | Ga0070670_100005445 | Ga0070670_1000054455 | 627 |
| 279 | 3300005445 | Ga0070708_100000226 | Ga0070708_10000022610 | 627 |
| 280 | 3300005563 | Ga0068855_100004693 | Ga0068855_1000046934 | 627 |
| 281 | 3300005618 | Ga0068864_100000221 | Ga0068864_10000022136 | 627 |
| 282 | 3300005841 | Ga0068863_100004890 | Ga0068863_10000489015 | 627 |
| 283 | 3300006195 | Ga0075366_10002203 | Ga0075366_100022036 | 627 |
| 284 | 3300009093 | Ga0105240_10025293 | Ga0105240_100252937 | 627 |
| 285 | 3300009094 | Ga0111539_10150910 | Ga0111539_101509102 | 627 |
| 286 | 3300025913 | Ga0207695_10014997 | Ga0207695_100149972 | 627 |
| 287 | 3300025925 | Ga0207650_10002173 | Ga0207650_100021736 | 627 |
| 288 | 3300025949 | Ga0207667_10009605 | Ga0207667_100096054 | 627 |
| 289 | 3300026088 | Ga0207641_10015731 | Ga0207641_100157313 | 627 |
| 290 | 3300026095 | Ga0207676_10003875 | Ga0207676_1000387512 | 627 |
| 291 | 3300048915 | Ga0496112_0052895 | Ga0496112_0052895_446_2410 | 627 |
| 292 | 3300050511 | nmdc:mga08y16_25033_c1 | nmdc:mga08y16_25033_c1_312_2276 | 627 |
| 293 | 3300005366 | Ga0070659_100052347 | Ga0070659_1000523472 | 628 |
| 294 | 3300013104 | Ga0157370_10004576 | Ga0157370_100045763 | 628 |
| 295 | 3300013105 | Ga0157369_10007995 | Ga0157369_100079952 | 628 |
| 296 | 3300021361 | Ga0213872_10001917 | Ga0213872_100019172 | 628 |
| 297 | 3300039447 | Ga0436361_0017830 | Ga0436361_0017830_13962_15929 | 628 |
| 298 | 3300042876 | Ga0451577_0088843 | Ga0451577_0088843_219_2198 | 628 |
| 299 | 3300045051 | Ga0451576_0068412 | Ga0451576_0068412_272_2251 | 628 |
| 300 | 3300050513 | nmdc:mga0rr50_14310_c1 | nmdc:mga0rr50_14310_c1_1077_3056 | 628 |
| 301 | 3300005467 | Ga0070706_100033267 | Ga0070706_1000332674 | 629 |
| 302 | 3300025910 | Ga0207684_10060008 | Ga0207684_100600082 | 629 |
| 303 | 3300005458 | Ga0070681_10004725 | Ga0070681_100047252 | 630 |
| 304 | 3300005530 | Ga0070679_100008685 | Ga0070679_1000086852 | 630 |
| 305 | 3300005539 | Ga0068853_100011189 | Ga0068853_1000111896 | 630 |
| 306 | 3300006195 | Ga0075366_10000907 | Ga0075366_100009079 | 630 |
| 307 | 3300013104 | Ga0157370_10009782 | Ga0157370_100097823 | 630 |
| 308 | 3300013104 | Ga0157370_10022627 | Ga0157370_100226274 | 630 |
| 309 | 3300025912 | Ga0207707_10082099 | Ga0207707_100820992 | 630 |
| 310 | 3300025920 | Ga0207649_10003391 | Ga0207649_100033917 | 630 |
| 311 | 3300028666 | Ga0265336_10007064 | Ga0265336_100070644 | 630 |
| 312 | 3300029957 | Ga0265324_10000004 | Ga0265324_10000004330 | 630 |
| 313 | 3300031241 | Ga0265325_10000146 | Ga0265325_1000014647 | 630 |
| 314 | 3300031711 | Ga0265314_10004095 | Ga0265314_100040952 | 630 |
| 315 | 3300039447 | Ga0436361_1093254 | Ga0436361_1093254_2207_4174 | 630 |
| 316 | 3300049571 | Ga0501034_0014335 | Ga0501034_0014335_1369_3336 | 630 |
| 317 | 3300049590 | Ga0501074_0025894 | Ga0501074_0025894_981_2948 | 630 |
| 318 | 3300049742 | Ga0501080_0003344 | Ga0501080_0003344_1278_3245 | 630 |
| 319 | 3300049744 | Ga0501083_0007626 | Ga0501083_0007626_3648_5615 | 630 |
| 320 | 3300050493 | nmdc:mga0k408_743_c1 | nmdc:mga0k408_743_c1_6176_8146 | 630 |
| 321 | 3300005347 | Ga0070668_100051091 | Ga0070668_1000510912 | 631 |
| 322 | 3300005367 | Ga0070667_100044691 | Ga0070667_1000446913 | 631 |
| 323 | 3300005548 | Ga0070665_100001743 | Ga0070665_10000174324 | 631 |
| 324 | 3300014969 | Ga0157376_10039044 | Ga0157376_100390442 | 631 |
| 325 | 3300025940 | Ga0207691_10008959 | Ga0207691_1000895911 | 631 |
| 326 | 3300025972 | Ga0207668_10040382 | Ga0207668_100403822 | 631 |
| 327 | 3300005355 | Ga0070671_100023981 | Ga0070671_1000239813 | 632 |
| 328 | 3300005549 | Ga0070704_100065040 | Ga0070704_1000650401 | 632 |
| 329 | 3300009177 | Ga0105248_10000874 | Ga0105248_100008749 | 632 |
| 330 | 3300013297 | Ga0157378_10026305 | Ga0157378_100263054 | 632 |
| 331 | 3300025941 | Ga0207711_10007090 | Ga0207711_100070907 | 632 |
| 332 | 3300005436 | Ga0070713_100000035 | Ga0070713_10000003540 | 633 |
| 333 | 3300006844 | Ga0075428_100053815 | Ga0075428_1000538152 | 633 |
| 334 | 3300009176 | Ga0105242_10058534 | Ga0105242_100585343 | 633 |
| 335 | 3300025899 | Ga0207642_10002880 | Ga0207642_100028802 | 633 |
| 336 | 3300025918 | Ga0207662_10045095 | Ga0207662_100450952 | 633 |
| 337 | 3300025928 | Ga0207700_10000023 | Ga0207700_10000023122 | 633 |
| 338 | 3300025934 | Ga0207686_10043703 | Ga0207686_100437032 | 633 |
| 339 | 3300025940 | Ga0207691_10026283 | Ga0207691_100262836 | 633 |
| 340 | 3300025942 | Ga0207689_10002580 | Ga0207689_1000258021 | 633 |
| 341 | 3300026075 | Ga0207708_10054780 | Ga0207708_100547802 | 633 |
| 342 | 3300028380 | Ga0268265_10088157 | Ga0268265_100881571 | 633 |
| 343 | 3300035092 | Ga0373952_0000495 | Ga0373952_0000495_1185_3155 | 634 |
| 344 | 3300044712 | Ga0453684_0000369 | Ga0453684_0000369_116877_118850 | 634 |
| 345 | 3300048918 | Ga0496115_0057466 | Ga0496115_0057466_369_2327 | 634 |
| 346 | 3300049581 | Ga0501047_0042588 | Ga0501047_0042588_2144_4111 | 634 |
| 347 | 3300049586 | Ga0501070_0111300 | Ga0501070_0111300_44_2011 | 634 |
| 348 | 3300049744 | Ga0501083_0051526 | Ga0501083_0051526_262_2229 | 634 |
| 349 | 3300050513 | nmdc:mga0rr50_11221_c1 | nmdc:mga0rr50_11221_c1_3488_5452 | 634 |
| 350 | 3300050515 | nmdc:mga0a205_33507_c2 | nmdc:mga0a205_33507_c2_1631_3595 | 634 |
| 351 | 3300005436 | Ga0070713_100048590 | Ga0070713_1000485903 | 635 |
| 352 | 3300005458 | Ga0070681_10005670 | Ga0070681_100056709 | 635 |
| 353 | 3300005530 | Ga0070679_100048503 | Ga0070679_1000485033 | 635 |
| 354 | 3300005539 | Ga0068853_100004460 | Ga0068853_1000044607 | 635 |
| 355 | 3300013307 | Ga0157372_10123879 | Ga0157372_101238792 | 635 |
| 356 | 3300025919 | Ga0207657_10038941 | Ga0207657_100389412 | 635 |
| 357 | 3300042876 | Ga0451577_0023919 | Ga0451577_0023919_2763_4733 | 635 |
| 358 | 3300042876 | Ga0451577_0045100 | Ga0451577_0045100_1074_3053 | 635 |
| 359 | 3300044712 | Ga0453684_0005149 | Ga0453684_0005149_8313_10283 | 635 |
| 360 | 3300044712 | Ga0453684_0027107 | Ga0453684_0027107_2502_4481 | 635 |
| 361 | 3300045051 | Ga0451576_0000313 | Ga0451576_0000313_40895_42865 | 635 |
| 362 | 3300048909 | Ga0496106_0000071 | Ga0496106_0000071_68033_70021 | 635 |
| 363 | 3300005843 | Ga0068860_100083907 | Ga0068860_1000839072 | 636 |
| 364 | 3300026118 | Ga0207675_100066232 | Ga0207675_1000662322 | 636 |
| 365 | 3300031238 | Ga0265332_10005682 | Ga0265332_100056822 | 636 |
| 366 | 3300031250 | Ga0265331_10002588 | Ga0265331_100025889 | 636 |
| 367 | 3300031711 | Ga0265314_10000805 | Ga0265314_1000080516 | 636 |
| 368 | 3300031712 | Ga0265342_10021049 | Ga0265342_100210492 | 636 |
| 369 | 3300031824 | Ga0307413_10069257 | Ga0307413_100692571 | 636 |
| 370 | 3300031852 | Ga0307410_10007189 | Ga0307410_100071891 | 636 |
| 371 | 3300031901 | Ga0307406_10049673 | Ga0307406_100496731 | 636 |
| 372 | 3300031903 | Ga0307407_10059371 | Ga0307407_100593711 | 636 |
| 373 | 3300031911 | Ga0307412_10024072 | Ga0307412_100240721 | 636 |
| 374 | 3300031995 | Ga0307409_100075040 | Ga0307409_1000750401 | 636 |
| 375 | 3300032005 | Ga0307411_10053451 | Ga0307411_100534511 | 636 |
| 376 | 3300042876 | Ga0451577_0038891 | Ga0451577_0038891_362_2326 | 636 |
| 377 | 3300005354 | Ga0070675_100014034 | Ga0070675_1000140345 | 637 |
| 378 | 3300005366 | Ga0070659_100002320 | Ga0070659_10000232016 | 637 |
| 379 | 3300005367 | Ga0070667_100049868 | Ga0070667_1000498682 | 637 |
| 380 | 3300005455 | Ga0070663_100006564 | Ga0070663_1000065642 | 637 |
| 381 | 3300005457 | Ga0070662_100000286 | Ga0070662_10000028621 | 637 |
| 382 | 3300005539 | Ga0068853_100006560 | Ga0068853_1000065602 | 637 |
| 383 | 3300005548 | Ga0070665_100022529 | Ga0070665_1000225297 | 637 |
| 384 | 3300005548 | Ga0070665_100040914 | Ga0070665_1000409143 | 637 |
| 385 | 3300005563 | Ga0068855_100000852 | Ga0068855_10000085241 | 637 |
| 386 | 3300005564 | Ga0070664_100008744 | Ga0070664_1000087444 | 637 |
| 387 | 3300005578 | Ga0068854_100030079 | Ga0068854_1000300791 | 637 |
| 388 | 3300005614 | Ga0068856_100000664 | Ga0068856_10000066441 | 637 |
| 389 | 3300005614 | Ga0068856_100114761 | Ga0068856_1001147612 | 637 |
| 390 | 3300005616 | Ga0068852_100080051 | Ga0068852_1000800512 | 637 |
| 391 | 3300009174 | Ga0105241_10038696 | Ga0105241_100386963 | 637 |
| 392 | 3300013100 | Ga0157373_10000524 | Ga0157373_1000052430 | 637 |
| 393 | 3300013102 | Ga0157371_10000614 | Ga0157371_1000061416 | 637 |
| 394 | 3300013104 | Ga0157370_10006054 | Ga0157370_1000605411 | 637 |
| 395 | 3300013105 | Ga0157369_10147251 | Ga0157369_101472512 | 637 |
| 396 | 3300013307 | Ga0157372_10002357 | Ga0157372_100023571 | 637 |
| 397 | 3300025907 | Ga0207645_10023134 | Ga0207645_100231343 | 637 |
| 398 | 3300025911 | Ga0207654_10020614 | Ga0207654_100206142 | 637 |
| 399 | 3300025914 | Ga0207671_10005819 | Ga0207671_100058198 | 637 |
| 400 | 3300025919 | Ga0207657_10013684 | Ga0207657_100136849 | 637 |
| 401 | 3300025920 | Ga0207649_10002994 | Ga0207649_1000299410 | 637 |
| 402 | 3300025926 | Ga0207659_10008089 | Ga0207659_100080895 | 637 |
| 403 | 3300025926 | Ga0207659_10016044 | Ga0207659_100160446 | 637 |
| 404 | 3300025931 | Ga0207644_10002353 | Ga0207644_100023539 | 637 |
| 405 | 3300025932 | Ga0207690_10001675 | Ga0207690_1000167512 | 637 |
| 406 | 3300025933 | Ga0207706_10000052 | Ga0207706_1000005297 | 637 |
| 407 | 3300025933 | Ga0207706_10035632 | Ga0207706_100356323 | 637 |
| 408 | 3300025945 | Ga0207679_10016018 | Ga0207679_100160181 | 637 |
| 409 | 3300025945 | Ga0207679_10016187 | Ga0207679_100161873 | 637 |
| 410 | 3300025949 | Ga0207667_10001296 | Ga0207667_1000129634 | 637 |
| 411 | 3300025981 | Ga0207640_10015486 | Ga0207640_100154861 | 637 |
| 412 | 3300025986 | Ga0207658_10039861 | Ga0207658_100398612 | 637 |
| 413 | 3300025986 | Ga0207658_10061724 | Ga0207658_100617242 | 637 |
| 414 | 3300026041 | Ga0207639_10005452 | Ga0207639_100054524 | 637 |
| 415 | 3300026041 | Ga0207639_10007463 | Ga0207639_100074637 | 637 |
| 416 | 3300026067 | Ga0207678_10006203 | Ga0207678_100062036 | 637 |
| 417 | 3300026078 | Ga0207702_10000248 | Ga0207702_1000024820 | 637 |
| 418 | 3300028379 | Ga0268266_10016322 | Ga0268266_100163226 | 637 |
| 419 | 3300031249 | Ga0265339_10029021 | Ga0265339_100290212 | 637 |
| 420 | 3300036401 | Ga0373937_0005419 | Ga0373937_0005419_3327_5384 | 637 |
| 421 | 3300036401 | Ga0373937_0105332 | Ga0373937_0105332_36_2000 | 637 |
| 422 | 3300048905 | Ga0496102_0001476 | Ga0496102_0001476_3088_5052 | 637 |
| 423 | 3300048910 | Ga0496107_0055393 | Ga0496107_0055393_771_2735 | 637 |
| 424 | 3300005347 | Ga0070668_100025056 | Ga0070668_1000250562 | 638 |
| 425 | 3300005563 | Ga0068855_100019510 | Ga0068855_1000195103 | 638 |
| 426 | 3300005616 | Ga0068852_100009106 | Ga0068852_1000091062 | 638 |
| 427 | 3300005844 | Ga0068862_100018173 | Ga0068862_1000181735 | 638 |
| 428 | 3300005985 | Ga0081539_10014045 | Ga0081539_100140453 | 638 |
| 429 | 3300013105 | Ga0157369_10001463 | Ga0157369_100014632 | 638 |
| 430 | 3300013307 | Ga0157372_10023642 | Ga0157372_100236423 | 638 |
| 431 | 3300025924 | Ga0207694_10020244 | Ga0207694_100202442 | 638 |
| 432 | 3300025949 | Ga0207667_10016708 | Ga0207667_100167083 | 638 |
| 433 | 3300026118 | Ga0207675_100093635 | Ga0207675_1000936352 | 638 |
| 434 | 3300026142 | Ga0207698_10079729 | Ga0207698_100797291 | 638 |
| 435 | 3300046539 | Ga0495621_0012611 | Ga0495621_0012611_438_2402 | 638 |
| 436 | 3300005328 | Ga0070676_10004210 | Ga0070676_100042104 | 639 |
| 437 | 3300005330 | Ga0070690_100019575 | Ga0070690_1000195752 | 639 |
| 438 | 3300005367 | Ga0070667_100002052 | Ga0070667_1000020526 | 639 |
| 439 | 3300005617 | Ga0068859_100021791 | Ga0068859_1000217914 | 639 |
| 440 | 3300005843 | Ga0068860_100019348 | Ga0068860_1000193484 | 639 |
| 441 | 3300006931 | Ga0097620_100021791 | Ga0097620_1000217914 | 639 |
| 442 | 3300013296 | Ga0157374_10008385 | Ga0157374_100083856 | 639 |
| 443 | 3300013306 | Ga0163162_10044761 | Ga0163162_100447612 | 639 |
| 444 | 3300013308 | Ga0157375_10045021 | Ga0157375_100450214 | 639 |
| 445 | 3300014968 | Ga0157379_10008738 | Ga0157379_1000873810 | 639 |
| 446 | 3300014969 | Ga0157376_10013604 | Ga0157376_100136047 | 639 |
| 447 | 3300017792 | Ga0163161_10012976 | Ga0163161_100129762 | 639 |
| 448 | 3300025907 | Ga0207645_10000353 | Ga0207645_1000035339 | 639 |
| 449 | 3300025940 | Ga0207691_10000663 | Ga0207691_1000066337 | 639 |
| 450 | 3300025942 | Ga0207689_10001481 | Ga0207689_1000148124 | 639 |
| 451 | 3300025961 | Ga0207712_10014061 | Ga0207712_100140612 | 639 |
| 452 | 3300026089 | Ga0207648_10004079 | Ga0207648_1000407914 | 639 |
| 453 | 3300026121 | Ga0207683_10001329 | Ga0207683_100013299 | 639 |
| 454 | 3300028381 | Ga0268264_10031782 | Ga0268264_100317823 | 639 |
| 455 | 3300042876 | Ga0451577_0008439 | Ga0451577_0008439_945_2924 | 639 |
| 456 | 3300048929 | Ga0496126_0069861 | Ga0496126_0069861_1140_3113 | 639 |
| 457 | 3300005436 | Ga0070713_100010958 | Ga0070713_1000109583 | 640 |
| 458 | 3300007265 | Ga0099794_10005789 | Ga0099794_100057893 | 640 |
| 459 | 3300013296 | Ga0157374_10005148 | Ga0157374_100051484 | 640 |
| 460 | 3300035118 | Ga0373954_0001074 | Ga0373954_0001074_1089_3224 | 640 |
| 461 | 3300035410 | Ga0373924_0007745 | Ga0373924_0007745_198_2333 | 640 |
| 462 | 3300035695 | Ga0373927_0003205 | Ga0373927_0003205_5239_7206 | 640 |
| 463 | 3300044712 | Ga0453684_0095278 | Ga0453684_0095278_1571_3550 | 640 |
| 464 | 3300045051 | Ga0451576_0000168 | Ga0451576_0000168_87977_89956 | 640 |
| 465 | 3300045051 | Ga0451576_0142644 | Ga0451576_0142644_324_2300 | 640 |
| 466 | 3300046472 | Ga0495580_0030164 | Ga0495580_0030164_1206_3341 | 640 |
| 467 | 3300046499 | Ga0495594_0040835 | Ga0495594_0040835_102_2237 | 640 |
| 468 | 3300046689 | Ga0495613_0016801 | Ga0495613_0016801_1874_4009 | 640 |
| 469 | 3300047322 | Ga0495680_0037036 | Ga0495680_0037036_1418_3553 | 640 |
| 470 | 3300048903 | Ga0496100_0063092 | Ga0496100_0063092_63_2198 | 640 |
| 471 | 3300048907 | Ga0496104_0005678 | Ga0496104_0005678_7459_9594 | 640 |
| 472 | 3300048908 | Ga0496105_0001094 | Ga0496105_0001094_9080_11215 | 640 |
| 473 | 3300048915 | Ga0496112_0000965 | Ga0496112_0000965_1562_3697 | 640 |
| 474 | iso_pu_bacteria | 2574179768 | 2574430189 | 640 |
| 475 | 3300005549 | Ga0070704_100008692 | Ga0070704_1000086924 | 641 |
| 476 | 3300006880 | Ga0075429_100000293 | Ga0075429_10000029320 | 641 |
| 477 | 3300009147 | Ga0114129_10009970 | Ga0114129_100099709 | 641 |
| 478 | 3300031665 | Ga0316575_10000088 | Ga0316575_100000881 | 641 |
| 479 | 3300031852 | Ga0307410_10034141 | Ga0307410_100341411 | 641 |
| 480 | 3300031901 | Ga0307406_10033432 | Ga0307406_100334321 | 641 |
| 481 | 3300031911 | Ga0307412_10016813 | Ga0307412_100168132 | 641 |
| 482 | 3300031995 | Ga0307409_100009515 | Ga0307409_1000095155 | 641 |
| 483 | 3300032126 | Ga0307415_100012415 | Ga0307415_1000124152 | 641 |
| 484 | 3300045051 | Ga0451576_0048192 | Ga0451576_0048192_1919_3898 | 641 |
| 485 | 3300049569 | Ga0501032_0001858 | Ga0501032_0001858_1822_3792 | 641 |
| 486 | 3300050507 | nmdc:mga05p37_2739_c1 | nmdc:mga05p37_2739_c1_5732_7750 | 641 |
| 487 | 3300050508 | nmdc:mga09592_2082_c1 | nmdc:mga09592_2082_c1_6301_8319 | 641 |
| 488 | iso_pu_bacteria | 2846037992 | 2846040053 | 641 |
| 489 | 3300005339 | Ga0070660_100041724 | Ga0070660_1000417243 | 642 |
| 490 | 3300005345 | Ga0070692_10008430 | Ga0070692_100084301 | 642 |
| 491 | 3300005356 | Ga0070674_100080152 | Ga0070674_1000801522 | 642 |
| 492 | 3300005366 | Ga0070659_100049731 | Ga0070659_1000497311 | 642 |
| 493 | 3300005435 | Ga0070714_100000984 | Ga0070714_10000098419 | 642 |
| 494 | 3300005445 | Ga0070708_100044597 | Ga0070708_1000445972 | 642 |
| 495 | 3300005457 | Ga0070662_100026680 | Ga0070662_1000266803 | 642 |
| 496 | 3300005468 | Ga0070707_100076761 | Ga0070707_1000767612 | 642 |
| 497 | 3300005518 | Ga0070699_100007236 | Ga0070699_1000072362 | 642 |
| 498 | 3300005834 | Ga0068851_10020725 | Ga0068851_100207252 | 642 |
| 499 | 3300006844 | Ga0075428_100000089 | Ga0075428_10000008948 | 642 |
| 500 | 3300006880 | Ga0075429_100013949 | Ga0075429_1000139493 | 642 |
| 501 | 3300006914 | Ga0075436_100041126 | Ga0075436_1000411262 | 642 |
| 502 | 3300009093 | Ga0105240_10111167 | Ga0105240_101111672 | 642 |
| 503 | 3300009094 | Ga0111539_10000086 | Ga0111539_1000008620 | 642 |
| 504 | 3300009098 | Ga0105245_10035403 | Ga0105245_100354033 | 642 |
| 505 | 3300009174 | Ga0105241_10073800 | Ga0105241_100738001 | 642 |
| 506 | 3300011119 | Ga0105246_10004097 | Ga0105246_100040976 | 642 |
| 507 | 3300013104 | Ga0157370_10046746 | Ga0157370_100467463 | 642 |
| 508 | 3300013105 | Ga0157369_10099455 | Ga0157369_100994552 | 642 |
| 509 | 3300025910 | Ga0207684_10054469 | Ga0207684_100544693 | 642 |
| 510 | 3300025912 | Ga0207707_10081109 | Ga0207707_100811092 | 642 |
| 511 | 3300025915 | Ga0207693_10014396 | Ga0207693_100143964 | 642 |
| 512 | 3300025917 | Ga0207660_10033376 | Ga0207660_100333762 | 642 |
| 513 | 3300025919 | Ga0207657_10000469 | Ga0207657_1000046940 | 642 |
| 514 | 3300025929 | Ga0207664_10007905 | Ga0207664_100079052 | 642 |
| 515 | 3300025942 | Ga0207689_10022530 | Ga0207689_100225304 | 642 |
| 516 | 3300026041 | Ga0207639_10050170 | Ga0207639_100501702 | 642 |
| 517 | 3300026067 | Ga0207678_10033999 | Ga0207678_100339992 | 642 |
| 518 | 3300026078 | Ga0207702_10015292 | Ga0207702_100152925 | 642 |
| 519 | 3300026089 | Ga0207648_10013321 | Ga0207648_100133218 | 642 |
| 520 | 3300026116 | Ga0207674_10003455 | Ga0207674_1000345515 | 642 |
| 521 | 3300027907 | Ga0207428_10017464 | Ga0207428_100174643 | 642 |
| 522 | 3300035171 | Ga0373946_0003481 | Ga0373946_0003481_3229_5193 | 642 |
| 523 | 3300035725 | Ga0373947_0014038 | Ga0373947_0014038_1634_3598 | 642 |
| 524 | 3300037068 | Ga0373925_0020604 | Ga0373925_0020604_1215_3179 | 642 |
| 525 | 3300046477 | Ga0495664_0009419 | Ga0495664_0009419_2372_4336 | 642 |
| 526 | 3300050508 | nmdc:mga09592_2899_c1 | nmdc:mga09592_2899_c1_1803_3767 | 642 |
| 527 | 3300050511 | nmdc:mga08y16_23820_c1 | nmdc:mga08y16_23820_c1_2951_4915 | 642 |
| 528 | iso_pu_bacteria | 2846033681 | 2846035177 | 642 |
| 529 | iso_pu_bacteria | 2998344455 | 2998348155 | 642 |
| 530 | 3300005334 | Ga0068869_100010219 | Ga0068869_1000102193 | 643 |
| 531 | 3300005338 | Ga0068868_100009896 | Ga0068868_1000098966 | 643 |
| 532 | 3300005340 | Ga0070689_100002060 | Ga0070689_1000020607 | 643 |
| 533 | 3300005354 | Ga0070675_100000225 | Ga0070675_1000002252 | 643 |
| 534 | 3300005354 | Ga0070675_100007207 | Ga0070675_1000072075 | 643 |
| 535 | 3300005355 | Ga0070671_100000251 | Ga0070671_1000002512 | 643 |
| 536 | 3300005365 | Ga0070688_100004606 | Ga0070688_1000046065 | 643 |
| 537 | 3300005456 | Ga0070678_100000567 | Ga0070678_1000005672 | 643 |
| 538 | 3300005459 | Ga0068867_100005689 | Ga0068867_10000568910 | 643 |
| 539 | 3300005467 | Ga0070706_100072884 | Ga0070706_1000728841 | 643 |
| 540 | 3300005543 | Ga0070672_100000543 | Ga0070672_10000054316 | 643 |
| 541 | 3300005548 | Ga0070665_100014704 | Ga0070665_1000147046 | 643 |
| 542 | 3300005577 | Ga0068857_100024323 | Ga0068857_1000243232 | 643 |
| 543 | 3300005617 | Ga0068859_100010133 | Ga0068859_1000101335 | 643 |
| 544 | 3300006237 | Ga0097621_100000762 | Ga0097621_1000007623 | 643 |
| 545 | 3300006237 | Ga0097621_100001879 | Ga0097621_1000018797 | 643 |
| 546 | 3300006931 | Ga0097620_100010133 | Ga0097620_1000101335 | 643 |
| 547 | 3300009177 | Ga0105248_10004254 | Ga0105248_1000425412 | 643 |
| 548 | 3300009177 | Ga0105248_10085045 | Ga0105248_100850452 | 643 |
| 549 | 3300013306 | Ga0163162_10027766 | Ga0163162_100277661 | 643 |
| 550 | 3300013308 | Ga0157375_10002640 | Ga0157375_1000264012 | 643 |
| 551 | 3300014969 | Ga0157376_10004250 | Ga0157376_100042508 | 643 |
| 552 | 3300014969 | Ga0157376_10014757 | Ga0157376_100147573 | 643 |
| 553 | 3300025926 | Ga0207659_10004796 | Ga0207659_100047968 | 643 |
| 554 | 3300025931 | Ga0207644_10002396 | Ga0207644_100023962 | 643 |
| 555 | 3300025940 | Ga0207691_10001224 | Ga0207691_100012248 | 643 |
| 556 | 3300025940 | Ga0207691_10003074 | Ga0207691_100030747 | 643 |
| 557 | 3300025941 | Ga0207711_10017016 | Ga0207711_100170166 | 643 |
| 558 | 3300025942 | Ga0207689_10002543 | Ga0207689_100025433 | 643 |
| 559 | 3300025944 | Ga0207661_10012124 | Ga0207661_100121245 | 643 |
| 560 | 3300025945 | Ga0207679_10004581 | Ga0207679_100045811 | 643 |
| 561 | 3300026023 | Ga0207677_10000717 | Ga0207677_100007171 | 643 |
| 562 | 3300026023 | Ga0207677_10024749 | Ga0207677_100247493 | 643 |
| 563 | 3300026089 | Ga0207648_10012903 | Ga0207648_100129032 | 643 |
| 564 | 3300026116 | Ga0207674_10023835 | Ga0207674_100238354 | 643 |
| 565 | 3300026121 | Ga0207683_10001790 | Ga0207683_100017904 | 643 |
| 566 | 3300026142 | Ga0207698_10000661 | Ga0207698_100006612 | 643 |
| 567 | 3300031250 | Ga0265331_10007731 | Ga0265331_100077315 | 643 |
| 568 | 3300031251 | Ga0265327_10000116 | Ga0265327_1000011618 | 643 |
| 569 | 3300048911 | Ga0496108_0084474 | Ga0496108_0084474_444_2450 | 643 |
| 570 | 3300048914 | Ga0496111_0029893 | Ga0496111_0029893_722_2728 | 643 |
| 571 | iso_pu_bacteria | 2547132103 | 2547373118 | 643 |
| 572 | iso_pu_bacteria | 2843690924 | 2843691809 | 643 |
| 573 | 3300005327 | Ga0070658_10013552 | Ga0070658_100135521 | 644 |
| 574 | 3300005356 | Ga0070674_100012063 | Ga0070674_1000120635 | 644 |
| 575 | 3300005530 | Ga0070679_100070965 | Ga0070679_1000709651 | 644 |
| 576 | 3300005842 | Ga0068858_100023474 | Ga0068858_1000234747 | 644 |
| 577 | 3300009176 | Ga0105242_10004748 | Ga0105242_100047482 | 644 |
| 578 | 3300014326 | Ga0157380_10001950 | Ga0157380_1000195013 | 644 |
| 579 | 3300014968 | Ga0157379_10045960 | Ga0157379_100459603 | 644 |
| 580 | 3300025921 | Ga0207652_10101030 | Ga0207652_101010302 | 644 |
| 581 | 3300025937 | Ga0207669_10021866 | Ga0207669_100218662 | 644 |
| 582 | 3300049742 | Ga0501080_0073539 | Ga0501080_0073539_53_2029 | 644 |
| 583 | 3300005328 | Ga0070676_10000676 | Ga0070676_100006764 | 645 |
| 584 | 3300005330 | Ga0070690_100003769 | Ga0070690_1000037693 | 645 |
| 585 | 3300005331 | Ga0070670_100028628 | Ga0070670_1000286282 | 645 |
| 586 | 3300005335 | Ga0070666_10006099 | Ga0070666_100060995 | 645 |
| 587 | 3300005338 | Ga0068868_100006178 | Ga0068868_1000061782 | 645 |
| 588 | 3300005340 | Ga0070689_100000418 | Ga0070689_10000041822 | 645 |
| 589 | 3300005347 | Ga0070668_100001492 | Ga0070668_1000014921 | 645 |
| 590 | 3300005353 | Ga0070669_100023612 | Ga0070669_1000236122 | 645 |
| 591 | 3300005354 | Ga0070675_100015218 | Ga0070675_1000152182 | 645 |
| 592 | 3300005354 | Ga0070675_100031039 | Ga0070675_1000310394 | 645 |
| 593 | 3300005356 | Ga0070674_100000161 | Ga0070674_1000001613 | 645 |
| 594 | 3300005364 | Ga0070673_100004380 | Ga0070673_1000043809 | 645 |
| 595 | 3300005364 | Ga0070673_100015411 | Ga0070673_1000154116 | 645 |
| 596 | 3300005367 | Ga0070667_100023492 | Ga0070667_1000234921 | 645 |
| 597 | 3300005439 | Ga0070711_100000407 | Ga0070711_10000040711 | 645 |
| 598 | 3300005456 | Ga0070678_100006917 | Ga0070678_1000069172 | 645 |
| 599 | 3300005457 | Ga0070662_100036909 | Ga0070662_1000369092 | 645 |
| 600 | 3300005458 | Ga0070681_10085719 | Ga0070681_100857192 | 645 |
| 601 | 3300005459 | Ga0068867_100004418 | Ga0068867_1000044183 | 645 |
| 602 | 3300005459 | Ga0068867_100009172 | Ga0068867_1000091722 | 645 |
| 603 | 3300005530 | Ga0070679_100085159 | Ga0070679_1000851592 | 645 |
| 604 | 3300005539 | Ga0068853_100026555 | Ga0068853_1000265553 | 645 |
| 605 | 3300005539 | Ga0068853_100034916 | Ga0068853_1000349163 | 645 |
| 606 | 3300005543 | Ga0070672_100002112 | Ga0070672_1000021126 | 645 |
| 607 | 3300005548 | Ga0070665_100003736 | Ga0070665_10000373615 | 645 |
| 608 | 3300005563 | Ga0068855_100089417 | Ga0068855_1000894172 | 645 |
| 609 | 3300005578 | Ga0068854_100001272 | Ga0068854_10000127213 | 645 |
| 610 | 3300005618 | Ga0068864_100001506 | Ga0068864_10000150623 | 645 |
| 611 | 3300005718 | Ga0068866_10002776 | Ga0068866_100027764 | 645 |
| 612 | 3300005841 | Ga0068863_100000366 | Ga0068863_10000036615 | 645 |
| 613 | 3300005841 | Ga0068863_100004197 | Ga0068863_10000419716 | 645 |
| 614 | 3300005841 | Ga0068863_100082438 | Ga0068863_1000824382 | 645 |
| 615 | 3300005842 | Ga0068858_100003588 | Ga0068858_10000358812 | 645 |
| 616 | 3300006881 | Ga0068865_100040940 | Ga0068865_1000409402 | 645 |
| 617 | 3300009148 | Ga0105243_10033422 | Ga0105243_100334222 | 645 |
| 618 | 3300009174 | Ga0105241_10007877 | Ga0105241_100078776 | 645 |
| 619 | 3300009545 | Ga0105237_10138221 | Ga0105237_101382212 | 645 |
| 620 | 3300013297 | Ga0157378_10005782 | Ga0157378_100057826 | 645 |
| 621 | 3300013306 | Ga0163162_10039972 | Ga0163162_100399723 | 645 |
| 622 | 3300013308 | Ga0157375_10030513 | Ga0157375_100305132 | 645 |
| 623 | 3300013308 | Ga0157375_10033853 | Ga0157375_100338533 | 645 |
| 624 | 3300014745 | Ga0157377_10003422 | Ga0157377_100034226 | 645 |
| 625 | 3300017792 | Ga0163161_10014898 | Ga0163161_100148985 | 645 |
| 626 | 3300017792 | Ga0163161_10037977 | Ga0163161_100379772 | 645 |
| 627 | 3300021361 | Ga0213872_10014786 | Ga0213872_100147861 | 645 |
| 628 | 3300025321 | Ga0207656_10000665 | Ga0207656_100006655 | 645 |
| 629 | 3300025893 | Ga0207682_10000303 | Ga0207682_1000030319 | 645 |
| 630 | 3300025899 | Ga0207642_10000532 | Ga0207642_100005324 | 645 |
| 631 | 3300025907 | Ga0207645_10000209 | Ga0207645_1000020951 | 645 |
| 632 | 3300025907 | Ga0207645_10045381 | Ga0207645_100453811 | 645 |
| 633 | 3300025911 | Ga0207654_10012293 | Ga0207654_100122933 | 645 |
| 634 | 3300025915 | Ga0207693_10001140 | Ga0207693_100011404 | 645 |
| 635 | 3300025927 | Ga0207687_10003673 | Ga0207687_100036736 | 645 |
| 636 | 3300025927 | Ga0207687_10010221 | Ga0207687_100102216 | 645 |
| 637 | 3300025933 | Ga0207706_10003781 | Ga0207706_100037818 | 645 |
| 638 | 3300025934 | Ga0207686_10000387 | Ga0207686_1000038713 | 645 |
| 639 | 3300025940 | Ga0207691_10000153 | Ga0207691_1000015325 | 645 |
| 640 | 3300025941 | Ga0207711_10002569 | Ga0207711_100025699 | 645 |
| 641 | 3300025949 | Ga0207667_10124154 | Ga0207667_101241542 | 645 |
| 642 | 3300025960 | Ga0207651_10005833 | Ga0207651_100058336 | 645 |
| 643 | 3300025960 | Ga0207651_10015586 | Ga0207651_100155862 | 645 |
| 644 | 3300025972 | Ga0207668_10003307 | Ga0207668_1000330711 | 645 |
| 645 | 3300026023 | Ga0207677_10001127 | Ga0207677_1000112710 | 645 |
| 646 | 3300026023 | Ga0207677_10018204 | Ga0207677_100182043 | 645 |
| 647 | 3300026035 | Ga0207703_10001000 | Ga0207703_1000100021 | 645 |
| 648 | 3300026088 | Ga0207641_10046825 | Ga0207641_100468252 | 645 |
| 649 | 3300026089 | Ga0207648_10001004 | Ga0207648_100010045 | 645 |
| 650 | 3300026095 | Ga0207676_10001564 | Ga0207676_1000156412 | 645 |
| 651 | 3300026121 | Ga0207683_10000140 | Ga0207683_1000014057 | 645 |
| 652 | 3300026121 | Ga0207683_10006146 | Ga0207683_1000614611 | 645 |
| 653 | 3300028381 | Ga0268264_10006736 | Ga0268264_100067362 | 645 |
| 654 | 3300031852 | Ga0307410_10000539 | Ga0307410_1000053918 | 645 |
| 655 | 3300031901 | Ga0307406_10001458 | Ga0307406_100014587 | 645 |
| 656 | 3300031903 | Ga0307407_10000212 | Ga0307407_1000021213 | 645 |
| 657 | 3300031995 | Ga0307409_100015897 | Ga0307409_1000158974 | 645 |
| 658 | 3300032002 | Ga0307416_100005850 | Ga0307416_1000058502 | 645 |
| 659 | 3300035398 | Ga0316574_0002518 | Ga0316574_0002518_653_2632 | 645 |
| 660 | 3300035692 | Ga0373935_0044374 | Ga0373935_0044374_38_2002 | 645 |
| 661 | 3300039447 | Ga0436361_0085764 | Ga0436361_0085764_14796_16769 | 645 |
| 662 | 3300044656 | Ga0466969_0003427 | Ga0466969_0003427_878_2842 | 645 |
| 663 | 3300044683 | Ga0466965_0024023 | Ga0466965_0024023_123_2087 | 645 |
| 664 | 3300044693 | Ga0466961_0000231 | Ga0466961_0000231_33650_35614 | 645 |
| 665 | 3300044706 | Ga0466964_0007763 | Ga0466964_0007763_657_2621 | 645 |
| 666 | 3300044712 | Ga0453684_0000114 | Ga0453684_0000114_344080_346077 | 645 |
| 667 | 3300044712 | Ga0453684_0080484 | Ga0453684_0080484_216_2207 | 645 |
| 668 | 3300045049 | Ga0466959_0008790 | Ga0466959_0008790_2992_4956 | 645 |
| 669 | 3300045051 | Ga0451576_0000060 | Ga0451576_0000060_77237_79210 | 645 |
| 670 | 3300045051 | Ga0451576_0005200 | Ga0451576_0005200_2433_4424 | 645 |
| 671 | 3300045051 | Ga0451576_0123887 | Ga0451576_0123887_273_2264 | 645 |
| 672 | 3300046543 | Ga0495645_0056327 | Ga0495645_0056327_762_2816 | 645 |
| 673 | 3300049776 | Ga0501280_000270 | Ga0501280_000270_312_2282 | 645 |
| 674 | 3300005456 | Ga0070678_100016254 | Ga0070678_1000162543 | 646 |
| 675 | 3300005548 | Ga0070665_100007569 | Ga0070665_1000075693 | 646 |
| 676 | 3300009545 | Ga0105237_10002707 | Ga0105237_100027079 | 646 |
| 677 | 3300013297 | Ga0157378_10041784 | Ga0157378_100417841 | 646 |
| 678 | 3300014745 | Ga0157377_10031656 | Ga0157377_100316562 | 646 |
| 679 | 3300026121 | Ga0207683_10019924 | Ga0207683_100199243 | 646 |
| 680 | 3300031250 | Ga0265331_10011916 | Ga0265331_100119163 | 646 |
| 681 | 3300031250 | Ga0265331_10043358 | Ga0265331_100433581 | 646 |
| 682 | 3300031251 | Ga0265327_10023172 | Ga0265327_100231722 | 646 |
| 683 | 3300042876 | Ga0451577_0000603 | Ga0451577_0000603_31793_33763 | 646 |
| 684 | 3300044712 | Ga0453684_0000014 | Ga0453684_0000014_720957_722927 | 646 |
| 685 | 3300044712 | Ga0453684_0001602 | Ga0453684_0001602_41770_43740 | 646 |
| 686 | 3300045051 | Ga0451576_0006582 | Ga0451576_0006582_6164_8179 | 646 |
| 687 | 3300002239 | JGI24034J26672_10003189 | JGI24034J26672_100031891 | 648 |
| 688 | 3300005334 | Ga0068869_100036161 | Ga0068869_1000361612 | 648 |
| 689 | 3300005335 | Ga0070666_10021435 | Ga0070666_100214352 | 648 |
| 690 | 3300005340 | Ga0070689_100005740 | Ga0070689_1000057403 | 648 |
| 691 | 3300005356 | Ga0070674_100017037 | Ga0070674_1000170372 | 648 |
| 692 | 3300005441 | Ga0070700_100004312 | Ga0070700_1000043127 | 648 |
| 693 | 3300005466 | Ga0070685_10005932 | Ga0070685_100059326 | 648 |
| 694 | 3300005543 | Ga0070672_100052601 | Ga0070672_1000526012 | 648 |
| 695 | 3300005544 | Ga0070686_100021461 | Ga0070686_1000214612 | 648 |
| 696 | 3300005549 | Ga0070704_100035952 | Ga0070704_1000359522 | 648 |
| 697 | 3300005719 | Ga0068861_100040242 | Ga0068861_1000402422 | 648 |
| 698 | 3300005842 | Ga0068858_100013483 | Ga0068858_1000134833 | 648 |
| 699 | 3300006881 | Ga0068865_100046293 | Ga0068865_1000462932 | 648 |
| 700 | 3300009094 | Ga0111539_10057184 | Ga0111539_100571843 | 648 |
| 701 | 3300009176 | Ga0105242_10001759 | Ga0105242_1000175913 | 648 |
| 702 | 3300009553 | Ga0105249_10033505 | Ga0105249_100335054 | 648 |
| 703 | 3300013297 | Ga0157378_10057268 | Ga0157378_100572682 | 648 |
| 704 | 3300014325 | Ga0163163_10098921 | Ga0163163_100989212 | 648 |
| 705 | 3300014968 | Ga0157379_10015696 | Ga0157379_100156964 | 648 |
| 706 | 3300017792 | Ga0163161_10032262 | Ga0163161_100322622 | 648 |
| 707 | 3300025315 | Ga0207697_10001039 | Ga0207697_100010396 | 648 |
| 708 | 3300025893 | Ga0207682_10002866 | Ga0207682_100028662 | 648 |
| 709 | 3300025901 | Ga0207688_10000877 | Ga0207688_1000087711 | 648 |
| 710 | 3300025907 | Ga0207645_10014473 | Ga0207645_100144732 | 648 |
| 711 | 3300025908 | Ga0207643_10009895 | Ga0207643_100098954 | 648 |
| 712 | 3300025918 | Ga0207662_10003310 | Ga0207662_100033106 | 648 |
| 713 | 3300025926 | Ga0207659_10031655 | Ga0207659_100316552 | 648 |
| 714 | 3300025931 | Ga0207644_10034656 | Ga0207644_100346562 | 648 |
| 715 | 3300025933 | Ga0207706_10001855 | Ga0207706_100018559 | 648 |
| 716 | 3300025934 | Ga0207686_10011407 | Ga0207686_100114072 | 648 |
| 717 | 3300025937 | Ga0207669_10023987 | Ga0207669_100239872 | 648 |
| 718 | 3300025938 | Ga0207704_10023795 | Ga0207704_100237952 | 648 |
| 719 | 3300025940 | Ga0207691_10070561 | Ga0207691_100705612 | 648 |
| 720 | 3300025941 | Ga0207711_10048642 | Ga0207711_100486422 | 648 |
| 721 | 3300025942 | Ga0207689_10005478 | Ga0207689_100054786 | 648 |
| 722 | 3300025960 | Ga0207651_10008998 | Ga0207651_100089985 | 648 |
| 723 | 3300025961 | Ga0207712_10048522 | Ga0207712_100485222 | 648 |
| 724 | 3300026023 | Ga0207677_10017670 | Ga0207677_100176703 | 648 |
| 725 | 3300026075 | Ga0207708_10006999 | Ga0207708_100069998 | 648 |
| 726 | 3300026089 | Ga0207648_10011801 | Ga0207648_100118012 | 648 |
| 727 | 3300026116 | Ga0207674_10054406 | Ga0207674_100544062 | 648 |
| 728 | 3300026118 | Ga0207675_100029295 | Ga0207675_1000292953 | 648 |
| 729 | 3300028380 | Ga0268265_10019134 | Ga0268265_100191342 | 648 |
| 730 | 3300050511 | nmdc:mga08y16_18073_c1 | nmdc:mga08y16_18073_c1_761_2731 | 648 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5nmw-assembly2.cif.gz_D | crystal structure of the pyrrolizidine alkaloid n-oxygenase from zonocerus variegatus in complex with fad | 0.9408 | 398 | 429 |
| 5nmw-assembly1.cif.gz_A-2 | crystal structure of the pyrrolizidine alkaloid n-oxygenase from zonocerus variegatus in complex with fad | 0.9393 | 398 | 430 |
| 4zcc-assembly2.cif.gz_B | renalase in complex with nadh | 0.9352 | 399 | 431 |
| 4eiq-assembly2.cif.gz_B | chromopyrrolic acid-soaked rebc-10x with bound 7-carboxy-k252c | 0.9282 | 397 | 428 |
| 7al4-assembly2.cif.gz_C | ancestral flavin-containing monooxygenase (fmo) 1 (mammalian) | 0.9199 | 398 | 429 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6E7M3_47_537_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.965 | 400 | 429 | 3.50.50.60 |
| af_A0A1D6HY89_22_259_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9615 | 400 | 430 | 3.50.50.60 |
| af_B5BM30_1_361_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9515 | 398 | 429 | 3.50.50.60 |
| af_Q54F68_8_396_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9502 | 399 | 429 | 3.50.50.60 |
| 4hb9A01 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.946 | 398 | 429 | 3.50.50.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A522VXE5-F1-model_v4 | Potassium transporter | 0.9636 | 3 | 480 |
GO:0005886
GO:0006813 GO:0008324 GO:0015297 GO:1902600 |
| AF-A0A524PVD3-F1-model_v4 | deleted | 0.963 | 7 | 375 |
|
| AF-A0A2W5Q847-F1-model_v4 | Potassium transporter | 0.9525 | 3 | 439 |
GO:0005886
GO:0006813 GO:0008324 GO:0015297 GO:1902600 |
| AF-A0A3S4M0X1-F1-model_v4 | Transport protein | 0.9476 | 105 | 368 |
GO:0005886
GO:0015297 GO:1902600 |
| AF-A0A258BHW0-F1-model_v4 | Cation/H+ exchanger transmembrane domain-containing protein | 0.9446 | 31 | 373 |
GO:0005886
GO:0015297 GO:1902600 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar