F477914

General Info

Members Datasets Scaffolds Average Seq Length
730 279 724 636

Family's Representative Sequence

Representative Sequence 3300009148|Ga0105243_10033422|Ga0105243_100334222
Length 711
Sequence VGAAGAWARIGVGIRAVYRQGKADALCYIRTALARCHAAGSEARIVVSRGCRRASKKMTHTLQLILLXXATSVVAVVICRLVRLPPILGYLAIGIAVGPHALGWVPDDANVRDLAEFGVVFLMFSIGLEFSLPQLKTMRRAVFGLGLAQVAITTLVAMVGLHFLHFSWLAGFALGGALAMSSTAIVSKLLAERSELNSPHGRDVMGILLFQDLAVVAFLIAVPTVAEGGTDLWKPLAIAAGKAAFALAAILFFGQKLMHGWFFIVARLRSPELFMLNVLLVTLGLAELTELAGLSFALGAFLAGMLIAETEYRYQVEEDIKPFRDVLLGLFFVSVGMYLNLTIVADHLGWVLLLLIGPVLAKLVLIVILARAFRSPLATALRTGFYLAQAGEFAIVLLALSTDLHILDSTFPQLVLAAMVLSMLAAPFMIQLAEPLVRRMTANDWLARAAQVTQIAARTISRQDHVIICGYGRSGQNLGRLLEAEGITFLALDSDPQRVAEAAHGGGNVVYADAGRREALTAAGLQKARAVAITFTDTAIAIKILHHIQHTRPEVPVIVRTFDDTELDRLLKAGAAEVVPEALEGSLMLASHSLLLLGVPLNRVLARIQAVREERYSIFRGFFHGATDAADAEDNLQPRLHSVLLNERSTAVGKSLAELNLEGRVEVNSVRRRGARAAAPSPDFRFEAGDVLVLLGKPGDLAFAERRLLRG

Samples

Sample ID Description Type Environment
1 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
2 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
3 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
4 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
5 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
6 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
7 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
76 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
77 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
116 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
175 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
179 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
180 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
181 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
182 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
183 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
184 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
185 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
186 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
187 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
188 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
189 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
190 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
191 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
192 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
193 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
194 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
195 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
196 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
197 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
198 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
199 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
200 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
201 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
202 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
203 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
204 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
205 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
206 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
207 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
208 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
209 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
210 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
211 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
212 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
213 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
214 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
215 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
216 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
217 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
218 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
219 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
220 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
221 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
222 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
223 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
224 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
225 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
226 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
227 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
228 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
229 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
230 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
231 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
232 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
233 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
234 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
235 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
236 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
237 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
238 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
239 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
240 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
241 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
242 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
243 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
244 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
245 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
246 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
247 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
248 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
249 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
250 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
251 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
252 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
253 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
254 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
255 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
256 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
257 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
265 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
266 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
267 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
268 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
269 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
270 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
271 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
272 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
273 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
274 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
275 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
276 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
277 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
278 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
279 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.18
Metatranscriptomes 0
Isolates 0.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.41
Nodule 0
Rhizoplane 2.47
Rhizosphere 96.71
Stem 0
Stem Tuber 0
Unclassified 0.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24034J26672_10003189 3300002239 Bacteria 2282
2 Ga0070658_10013552 3300005327 Bacteria 6542
3 Ga0070676_10000676 3300005328 Bacteria 16667
4 Ga0070676_10004210 3300005328 Bacteria 7558
5 Ga0070683_100001455 3300005329 Bacteria 18228
6 Ga0070683_100018710 3300005329 Bacteria 6139
7 Ga0070690_100003769 3300005330 Bacteria 8351
8 Ga0070690_100006548 3300005330 Bacteria 6613
9 Ga0070690_100019575 3300005330 Bacteria 4111
10 Ga0070670_100005445 3300005331 Bacteria 10737
11 Ga0070670_100013210 3300005331 Bacteria 7073
12 Ga0070670_100028628 3300005331 Bacteria 4794
13 Ga0068869_100000356 3300005334 Bacteria 24579
14 Ga0068869_100001214 3300005334 Bacteria 15152
15 Ga0068869_100001670 3300005334 Bacteria 13252
16 Ga0068869_100010219 3300005334 Bacteria 6112
17 Ga0068869_100036161 3300005334 Bacteria 3505
18 Ga0070666_10006099 3300005335 Bacteria 7408
19 Ga0070666_10021435 3300005335 Bacteria 4189
20 Ga0070666_10050557 3300005335 Bacteria 2796
21 Ga0068868_100006178 3300005338 Bacteria 8474
22 Ga0068868_100009123 3300005338 Bacteria 7122
23 Ga0068868_100009896 3300005338 Bacteria 6885
24 Ga0068868_100027032 3300005338 Bacteria 4375
25 Ga0070660_100002638 3300005339 Bacteria 12331
26 Ga0070660_100041724 3300005339 Bacteria 3498
27 Ga0070689_100000418 3300005340 Bacteria 25038
28 Ga0070689_100001098 3300005340 Bacteria 16989
29 Ga0070689_100002060 3300005340 Bacteria 13046
30 Ga0070689_100005740 3300005340 Bacteria 8509
31 Ga0070689_100009989 3300005340 Bacteria 6754
32 Ga0070689_100065481 3300005340 Bacteria 2830
33 Ga0070691_10004112 3300005341 Bacteria 6604
34 Ga0070687_100000491 3300005343 Bacteria 13181
35 Ga0070692_10001668 3300005345 Bacteria 8207
36 Ga0070692_10008430 3300005345 Bacteria 4600
37 Ga0070668_100001492 3300005347 Bacteria 16911
38 Ga0070668_100025056 3300005347 Bacteria 4521
39 Ga0070668_100051091 3300005347 Bacteria 3185
40 Ga0070668_100066284 3300005347 Bacteria 2802
41 Ga0070669_100023612 3300005353 Bacteria 4404
42 Ga0070669_100048427 3300005353 Bacteria 3102
43 Ga0070675_100000225 3300005354 Bacteria 36121
44 Ga0070675_100007207 3300005354 Bacteria 8573
45 Ga0070675_100014034 3300005354 Bacteria 6309
46 Ga0070675_100015218 3300005354 Bacteria 6076
47 Ga0070675_100031039 3300005354 Bacteria 4318
48 Ga0070671_100000251 3300005355 Bacteria 35949
49 Ga0070671_100023981 3300005355 Bacteria 4992
50 Ga0070674_100000161 3300005356 Bacteria 30979
51 Ga0070674_100012063 3300005356 Bacteria 5294
52 Ga0070674_100017037 3300005356 Bacteria 4561
53 Ga0070674_100080152 3300005356 Bacteria 2330
54 Ga0070673_100004380 3300005364 Bacteria 8919
55 Ga0070673_100015411 3300005364 Bacteria 5368
56 Ga0070673_100025598 3300005364 Bacteria 4346
57 Ga0070688_100004606 3300005365 Bacteria 7195
58 Ga0070659_100002320 3300005366 Bacteria 13538
59 Ga0070659_100049731 3300005366 Bacteria 3297
60 Ga0070659_100052347 3300005366 Bacteria 3211
61 Ga0070659_100076911 3300005366 Bacteria 2661
62 Ga0070667_100001403 3300005367 Bacteria 21557
63 Ga0070667_100002052 3300005367 Bacteria 17830
64 Ga0070667_100023492 3300005367 Bacteria 5115
65 Ga0070667_100044691 3300005367 Bacteria 3721
66 Ga0070667_100047683 3300005367 Bacteria 3605
67 Ga0070667_100049868 3300005367 Bacteria 3527
68 Ga0070709_10003074 3300005434 Bacteria 8966
69 Ga0070714_100000984 3300005435 Bacteria 20360
70 Ga0070713_100000035 3300005436 Bacteria 86284
71 Ga0070713_100010958 3300005436 Bacteria 6574
72 Ga0070713_100048590 3300005436 Bacteria 3494
73 Ga0070710_10003607 3300005437 Bacteria 7329
74 Ga0070711_100000407 3300005439 Bacteria 22299
75 Ga0070705_100000455 3300005440 Bacteria 23509
76 Ga0070700_100004312 3300005441 Bacteria 7422
77 Ga0070694_100000773 3300005444 Bacteria 17884
78 Ga0070708_100000226 3300005445 Bacteria 42003
79 Ga0070708_100044597 3300005445 Bacteria 3900
80 Ga0070663_100006564 3300005455 Bacteria 7011
81 Ga0070678_100000567 3300005456 Bacteria 18120
82 Ga0070678_100006917 3300005456 Bacteria 6691
83 Ga0070678_100016254 3300005456 Bacteria 4755
84 Ga0070662_100000286 3300005457 Bacteria 29988
85 Ga0070662_100026680 3300005457 Bacteria 4003
86 Ga0070662_100036909 3300005457 Bacteria 3462
87 Ga0070681_10004725 3300005458 Bacteria 13042
88 Ga0070681_10005670 3300005458 Bacteria 12070
89 Ga0070681_10006206 3300005458 Bacteria 11617
90 Ga0070681_10021120 3300005458 Bacteria 6523
91 Ga0070681_10085719 3300005458 Bacteria 3103
92 Ga0068867_100002290 3300005459 Bacteria 13458
93 Ga0068867_100004418 3300005459 Bacteria 9887
94 Ga0068867_100005689 3300005459 Bacteria 8836
95 Ga0068867_100009172 3300005459 Bacteria 6984
96 Ga0068867_100023285 3300005459 Bacteria 4434
97 Ga0068867_100036656 3300005459 Bacteria 3562
98 Ga0070685_10000779 3300005466 Bacteria 17344
99 Ga0070685_10005932 3300005466 Bacteria 6216
100 Ga0070706_100033267 3300005467 Bacteria 4758
101 Ga0070706_100072884 3300005467 Bacteria 3177
102 Ga0070707_100076761 3300005468 Bacteria 3223
103 Ga0070698_100009607 3300005471 Bacteria 10348
104 Ga0070699_100007236 3300005518 Bacteria 9655
105 Ga0070679_100008685 3300005530 Bacteria 9578
106 Ga0070679_100023626 3300005530 Bacteria 6021
107 Ga0070679_100025515 3300005530 Bacteria 5801
108 Ga0070679_100026619 3300005530 Bacteria 5686
109 Ga0070679_100048503 3300005530 Bacteria 4231
110 Ga0070679_100070965 3300005530 Bacteria 3474
111 Ga0070679_100085159 3300005530 Bacteria 3148
112 Ga0070684_100010095 3300005535 Bacteria 7467
113 Ga0070684_100061128 3300005535 Bacteria 3296
114 Ga0068853_100004460 3300005539 Bacteria 10851
115 Ga0068853_100006560 3300005539 Bacteria 9268
116 Ga0068853_100011189 3300005539 Bacteria 7280
117 Ga0068853_100026555 3300005539 Bacteria 4863
118 Ga0068853_100034916 3300005539 Bacteria 4269
119 Ga0070672_100000543 3300005543 Bacteria 22143
120 Ga0070672_100002112 3300005543 Bacteria 12545
121 Ga0070672_100052601 3300005543 Bacteria 3180
122 Ga0070686_100004246 3300005544 Bacteria 7894
123 Ga0070686_100021461 3300005544 Bacteria 3839
124 Ga0070695_100001745 3300005545 Bacteria 12236
125 Ga0070696_100012564 3300005546 Bacteria 5686
126 Ga0070693_100000237 3300005547 Bacteria 25748
127 Ga0070665_100001743 3300005548 Bacteria 24897
128 Ga0070665_100003736 3300005548 Bacteria 16125
129 Ga0070665_100007569 3300005548 Bacteria 11040
130 Ga0070665_100014704 3300005548 Bacteria 7852
131 Ga0070665_100022529 3300005548 Bacteria 6340
132 Ga0070665_100040914 3300005548 Bacteria 4658
133 Ga0070665_100073184 3300005548 Bacteria 3434
134 Ga0070704_100000008 3300005549 Bacteria 71641
135 Ga0070704_100008692 3300005549 Bacteria 6108
136 Ga0070704_100035952 3300005549 Bacteria 3371
137 Ga0070704_100065040 3300005549 Bacteria 2624
138 Ga0068855_100000852 3300005563 Bacteria 37837
139 Ga0068855_100004693 3300005563 Bacteria 16702
140 Ga0068855_100005852 3300005563 Bacteria 15009
141 Ga0068855_100014386 3300005563 Bacteria 9526
142 Ga0068855_100019510 3300005563 Bacteria 8147
143 Ga0068855_100046323 3300005563 Bacteria 5141
144 Ga0068855_100089417 3300005563 Bacteria 3555
145 Ga0068855_100092941 3300005563 Bacteria 3478
146 Ga0070664_100008744 3300005564 Bacteria 8200
147 Ga0068857_100000165 3300005577 Bacteria 41423
148 Ga0068857_100020112 3300005577 Bacteria 5868
149 Ga0068857_100024323 3300005577 Bacteria 5331
150 Ga0068857_100029178 3300005577 Bacteria 4868
151 Ga0068854_100001272 3300005578 Bacteria 15149
152 Ga0068854_100030079 3300005578 Bacteria 3765
153 Ga0068854_100030295 3300005578 Bacteria 3753
154 Ga0068854_100064765 3300005578 Bacteria 2656
155 Ga0068856_100000375 3300005614 Bacteria 49163
156 Ga0068856_100000664 3300005614 Bacteria 37278
157 Ga0068856_100022733 3300005614 Bacteria 6096
158 Ga0068856_100039603 3300005614 Bacteria 4627
159 Ga0068856_100088512 3300005614 Bacteria 3079
160 Ga0068856_100114761 3300005614 Bacteria 2693
161 Ga0070702_100000012 3300005615 Bacteria 58298
162 Ga0068852_100000254 3300005616 Bacteria 36057
163 Ga0068852_100000371 3300005616 Bacteria 30327
164 Ga0068852_100009106 3300005616 Bacteria 7349
165 Ga0068852_100080051 3300005616 Bacteria 2895
166 Ga0068859_100009197 3300005617 Bacteria 9975
167 Ga0068859_100009660 3300005617 Bacteria 9738
168 Ga0068859_100010133 3300005617 Bacteria 9494
169 Ga0068859_100014353 3300005617 Bacteria 7946
170 Ga0068859_100021791 3300005617 Bacteria 6426
171 Ga0068859_100048127 3300005617 Bacteria 4283
172 Ga0068864_100000221 3300005618 Bacteria 51532
173 Ga0068864_100000981 3300005618 Bacteria 23881
174 Ga0068864_100001197 3300005618 Bacteria 21532
175 Ga0068864_100001506 3300005618 Bacteria 19184
176 Ga0068866_10001702 3300005718 Bacteria 9263
177 Ga0068866_10002776 3300005718 Bacteria 7222
178 Ga0068861_100001987 3300005719 Bacteria 13207
179 Ga0068861_100013391 3300005719 Bacteria 5740
180 Ga0068861_100040242 3300005719 Bacteria 3494
181 Ga0068851_10006845 3300005834 Bacteria 5219
182 Ga0068851_10007141 3300005834 Bacteria 5118
183 Ga0068851_10020462 3300005834 Bacteria 3205
184 Ga0068851_10020725 3300005834 Bacteria 3186
185 Ga0068863_100000366 3300005841 Bacteria 45953
186 Ga0068863_100004197 3300005841 Bacteria 14231
187 Ga0068863_100004419 3300005841 Bacteria 13865
188 Ga0068863_100004890 3300005841 Bacteria 13205
189 Ga0068863_100082438 3300005841 Bacteria 3048
190 Ga0068858_100001946 3300005842 Bacteria 21056
191 Ga0068858_100003588 3300005842 Bacteria 15356
192 Ga0068858_100005717 3300005842 Bacteria 12153
193 Ga0068858_100005913 3300005842 Bacteria 11941
194 Ga0068858_100009188 3300005842 Bacteria 9446
195 Ga0068858_100013483 3300005842 Bacteria 7711
196 Ga0068858_100023474 3300005842 Bacteria 5744
197 Ga0068858_100081854 3300005842 Bacteria 3001
198 Ga0068860_100010866 3300005843 Bacteria 8978
199 Ga0068860_100019348 3300005843 Bacteria 6605
200 Ga0068860_100023185 3300005843 Bacteria 6001
201 Ga0068860_100056157 3300005843 Bacteria 3744
202 Ga0068860_100083907 3300005843 Bacteria 3030
203 Ga0068860_100088409 3300005843 Bacteria 2949
204 Ga0068860_100108955 3300005843 Bacteria 2647
205 Ga0068862_100007718 3300005844 Bacteria 8898
206 Ga0068862_100018173 3300005844 Bacteria 5853
207 Ga0081539_10014045 3300005985 Bacteria 5961
208 Ga0070715_10009123 3300006163 Bacteria 3484
209 Ga0075366_10000907 3300006195 Bacteria 14346
210 Ga0075366_10002203 3300006195 Bacteria 9941
211 Ga0097621_100000762 3300006237 Bacteria 22583
212 Ga0097621_100001879 3300006237 Bacteria 14384
213 Ga0097621_100003001 3300006237 Bacteria 11593
214 Ga0097621_100008117 3300006237 Bacteria 7546
215 Ga0097621_100014367 3300006237 Bacteria 5924
216 Ga0097621_100016878 3300006237 Bacteria 5533
217 Ga0068871_100000594 3300006358 Bacteria 24896
218 Ga0068871_100003366 3300006358 Bacteria 10985
219 Ga0068871_100033066 3300006358 Bacteria 4091
220 Ga0075428_100000089 3300006844 Bacteria 75097
221 Ga0075428_100007373 3300006844 Bacteria 12193
222 Ga0075428_100010121 3300006844 Bacteria 10477
223 Ga0075428_100053815 3300006844 Bacteria 4411
224 Ga0075431_100011080 3300006847 Bacteria 9074
225 Ga0075429_100000293 3300006880 Bacteria 35379
226 Ga0075429_100000461 3300006880 Bacteria 30365
227 Ga0075429_100013949 3300006880 Bacteria 6965
228 Ga0075429_100029138 3300006880 Bacteria 4794
229 Ga0068865_100004473 3300006881 Bacteria 8433
230 Ga0068865_100037043 3300006881 Bacteria 3292
231 Ga0068865_100040940 3300006881 Bacteria 3151
232 Ga0068865_100046293 3300006881 Bacteria 2984
233 Ga0075436_100000095 3300006914 Bacteria 51876
234 Ga0075436_100011908 3300006914 Bacteria 5968
235 Ga0075436_100041126 3300006914 Bacteria 3189
236 Ga0097620_100009197 3300006931 Bacteria 9975
237 Ga0097620_100009661 3300006931 Bacteria 9738
238 Ga0097620_100010133 3300006931 Bacteria 9494
239 Ga0097620_100014355 3300006931 Bacteria 7946
240 Ga0097620_100021791 3300006931 Bacteria 6426
241 Ga0097620_100048125 3300006931 Bacteria 4283
242 Ga0099794_10005789 3300007265 Bacteria 4979
243 Ga0105240_10025293 3300009093 Bacteria 7805
244 Ga0105240_10111167 3300009093 Bacteria 3315
245 Ga0105240_10135381 3300009093 Bacteria 2951
246 Ga0111539_10000086 3300009094 Bacteria 95435
247 Ga0111539_10037333 3300009094 Bacteria 5867
248 Ga0111539_10057184 3300009094 Bacteria 4632
249 Ga0111539_10062750 3300009094 Bacteria 4398
250 Ga0111539_10150910 3300009094 Bacteria 2720
251 Ga0105245_10003077 3300009098 Bacteria 14936
252 Ga0105245_10007877 3300009098 Bacteria 9319
253 Ga0105245_10035403 3300009098 Bacteria 4430
254 Ga0114129_10009970 3300009147 Bacteria 13542
255 Ga0114129_10025059 3300009147 Bacteria 8454
256 Ga0105243_10001330 3300009148 Bacteria 22041
257 Ga0105243_10033422 3300009148 Bacteria 3978
258 Ga0105241_10007877 3300009174 Bacteria 7832
259 Ga0105241_10012139 3300009174 Bacteria 6323
260 Ga0105241_10012648 3300009174 Bacteria 6194
261 Ga0105241_10038696 3300009174 Bacteria 3596
262 Ga0105241_10073800 3300009174 Bacteria 2655
263 Ga0105242_10001759 3300009176 Bacteria 17096
264 Ga0105242_10001867 3300009176 Bacteria 16545
265 Ga0105242_10004748 3300009176 Bacteria 10522
266 Ga0105242_10005169 3300009176 Bacteria 10071
267 Ga0105242_10058534 3300009176 Bacteria 3159
268 Ga0105248_10000874 3300009177 Bacteria 33787
269 Ga0105248_10001115 3300009177 Bacteria 29857
270 Ga0105248_10004254 3300009177 Bacteria 15845
271 Ga0105248_10029748 3300009177 Bacteria 6096
272 Ga0105248_10030277 3300009177 Bacteria 6043
273 Ga0105248_10085045 3300009177 Bacteria 3560
274 Ga0105237_10002707 3300009545 Bacteria 21648
275 Ga0105237_10138221 3300009545 Bacteria 2431
276 Ga0105238_10000556 3300009551 Bacteria 39015
277 Ga0105238_10017261 3300009551 Bacteria 7331
278 Ga0105249_10002333 3300009553 Bacteria 16475
279 Ga0105249_10033505 3300009553 Bacteria 4650
280 Ga0105249_10059080 3300009553 Bacteria 3516
281 Ga0105239_10032408 3300010375 Bacteria 5742
282 Ga0105246_10004097 3300011119 Bacteria 8848
283 Ga0157373_10000524 3300013100 Bacteria 30046
284 Ga0157371_10000614 3300013102 Bacteria 42414
285 Ga0157370_10004576 3300013104 Bacteria 15836
286 Ga0157370_10005207 3300013104 Bacteria 14653
287 Ga0157370_10006054 3300013104 Bacteria 13428
288 Ga0157370_10008837 3300013104 Bacteria 10828
289 Ga0157370_10009782 3300013104 Bacteria 10170
290 Ga0157370_10022627 3300013104 Bacteria 6254
291 Ga0157370_10046746 3300013104 Bacteria 4150
292 Ga0157369_10001463 3300013105 Bacteria 28936
293 Ga0157369_10001573 3300013105 Bacteria 27941
294 Ga0157369_10007995 3300013105 Bacteria 12148
295 Ga0157369_10099455 3300013105 Bacteria 3101
296 Ga0157369_10147251 3300013105 Bacteria 2489
297 Ga0157374_10004187 3300013296 Bacteria 12119
298 Ga0157374_10005148 3300013296 Bacteria 10967
299 Ga0157374_10008385 3300013296 Bacteria 8826
300 Ga0157374_10016750 3300013296 Bacteria 6448
301 Ga0157378_10000637 3300013297 Bacteria 32918
302 Ga0157378_10005782 3300013297 Bacteria 10838
303 Ga0157378_10011674 3300013297 Bacteria 7688
304 Ga0157378_10026305 3300013297 Bacteria 5129
305 Ga0157378_10041784 3300013297 Bacteria 4068
306 Ga0157378_10044886 3300013297 Bacteria 3925
307 Ga0157378_10057268 3300013297 Bacteria 3473
308 Ga0163162_10027766 3300013306 Bacteria 5598
309 Ga0163162_10039972 3300013306 Bacteria 4688
310 Ga0163162_10044761 3300013306 Bacteria 4434
311 Ga0157372_10002357 3300013307 Bacteria 20425
312 Ga0157372_10023642 3300013307 Bacteria 6666
313 Ga0157372_10123879 3300013307 Bacteria 2971
314 Ga0157375_10002640 3300013308 Bacteria 15524
315 Ga0157375_10030513 3300013308 Bacteria 5084
316 Ga0157375_10033853 3300013308 Bacteria 4860
317 Ga0157375_10035251 3300013308 Bacteria 4774
318 Ga0157375_10045021 3300013308 Bacteria 4293
319 Ga0163163_10098921 3300014325 Bacteria 2938
320 Ga0163163_10141160 3300014325 Bacteria 2451
321 Ga0157380_10001950 3300014326 Bacteria 13731
322 Ga0157380_10050666 3300014326 Bacteria 3281
323 Ga0157377_10003422 3300014745 Bacteria 7181
324 Ga0157377_10031656 3300014745 Bacteria 2876
325 Ga0157377_10040958 3300014745 Bacteria 2567
326 Ga0157379_10005730 3300014968 Bacteria 10684
327 Ga0157379_10008738 3300014968 Bacteria 8830
328 Ga0157379_10009459 3300014968 Bacteria 8495
329 Ga0157379_10015696 3300014968 Bacteria 6656
330 Ga0157379_10038383 3300014968 Bacteria 4274
331 Ga0157379_10045960 3300014968 Bacteria 3897
332 Ga0157376_10004250 3300014969 Bacteria 9942
333 Ga0157376_10004622 3300014969 Bacteria 9589
334 Ga0157376_10013604 3300014969 Bacteria 6078
335 Ga0157376_10014757 3300014969 Bacteria 5876
336 Ga0157376_10039044 3300014969 Bacteria 3868
337 Ga0163161_10012976 3300017792 Bacteria 5789
338 Ga0163161_10014898 3300017792 Bacteria 5416
339 Ga0163161_10032262 3300017792 Bacteria 3738
340 Ga0163161_10037977 3300017792 Bacteria 3452
341 Ga0213872_10001917 3300021361 Bacteria 12723
342 Ga0213872_10014786 3300021361 Bacteria 3635
343 Ga0207697_10000020 3300025315 Bacteria 55999
344 Ga0207697_10001039 3300025315 Bacteria 15417
345 Ga0207656_10000665 3300025321 Bacteria 11258
346 Ga0207656_10001267 3300025321 Bacteria 8323
347 Ga0207682_10000303 3300025893 Bacteria 22258
348 Ga0207682_10000532 3300025893 Bacteria 17502
349 Ga0207682_10002866 3300025893 Bacteria 7615
350 Ga0207642_10000532 3300025899 Bacteria 11649
351 Ga0207642_10002880 3300025899 Bacteria 5379
352 Ga0207688_10000534 3300025901 Bacteria 18439
353 Ga0207688_10000877 3300025901 Bacteria 15196
354 Ga0207680_10037591 3300025903 Bacteria 2796
355 Ga0207645_10000209 3300025907 Bacteria 48175
356 Ga0207645_10000353 3300025907 Bacteria 38206
357 Ga0207645_10000516 3300025907 Bacteria 32079
358 Ga0207645_10002067 3300025907 Bacteria 16065
359 Ga0207645_10014473 3300025907 Bacteria 5279
360 Ga0207645_10023134 3300025907 Bacteria 4039
361 Ga0207645_10045381 3300025907 Bacteria 2809
362 Ga0207643_10000131 3300025908 Bacteria 50934
363 Ga0207643_10009895 3300025908 Bacteria 5124
364 Ga0207684_10054469 3300025910 Bacteria 3393
365 Ga0207684_10060008 3300025910 Bacteria 3230
366 Ga0207654_10012293 3300025911 Bacteria 4385
367 Ga0207654_10019181 3300025911 Bacteria 3605
368 Ga0207654_10020614 3300025911 Bacteria 3497
369 Ga0207707_10054059 3300025912 Bacteria 3495
370 Ga0207707_10081109 3300025912 Bacteria 2832
371 Ga0207707_10082099 3300025912 Bacteria 2814
372 Ga0207695_10014997 3300025913 Bacteria 9142
373 Ga0207695_10134541 3300025913 Bacteria 2426
374 Ga0207671_10005819 3300025914 Bacteria 11203
375 Ga0207693_10001140 3300025915 Bacteria 23800
376 Ga0207693_10014396 3300025915 Bacteria 6361
377 Ga0207660_10029187 3300025917 Bacteria 3780
378 Ga0207660_10033376 3300025917 Bacteria 3560
379 Ga0207662_10000366 3300025918 Bacteria 20312
380 Ga0207662_10003310 3300025918 Bacteria 8266
381 Ga0207662_10026857 3300025918 Bacteria 3322
382 Ga0207662_10045095 3300025918 Bacteria 2606
383 Ga0207657_10000469 3300025919 Bacteria 42688
384 Ga0207657_10011489 3300025919 Bacteria 8792
385 Ga0207657_10013684 3300025919 Bacteria 7947
386 Ga0207657_10038941 3300025919 Bacteria 4227
387 Ga0207649_10002994 3300025920 Bacteria 9302
388 Ga0207649_10003391 3300025920 Bacteria 8712
389 Ga0207649_10016743 3300025920 Bacteria 4143
390 Ga0207652_10099601 3300025921 Bacteria 2564
391 Ga0207652_10101030 3300025921 Bacteria 2547
392 Ga0207681_10088894 3300025923 Bacteria 2201
393 Ga0207694_10020244 3300025924 Bacteria 5031
394 Ga0207650_10002173 3300025925 Bacteria 13703
395 Ga0207650_10004339 3300025925 Bacteria 9687
396 Ga0207650_10007990 3300025925 Bacteria 7211
397 Ga0207650_10008205 3300025925 Bacteria 7124
398 Ga0207650_10036045 3300025925 Bacteria 3597
399 Ga0207659_10001463 3300025926 Bacteria 14084
400 Ga0207659_10004796 3300025926 Bacteria 8201
401 Ga0207659_10008089 3300025926 Bacteria 6509
402 Ga0207659_10016044 3300025926 Bacteria 4868
403 Ga0207659_10031655 3300025926 Bacteria 3624
404 Ga0207687_10003076 3300025927 Bacteria 11319
405 Ga0207687_10003673 3300025927 Bacteria 10333
406 Ga0207687_10010221 3300025927 Bacteria 6131
407 Ga0207700_10000023 3300025928 Bacteria 152285
408 Ga0207664_10005012 3300025929 Bacteria 9005
409 Ga0207664_10007905 3300025929 Bacteria 7387
410 Ga0207644_10002353 3300025931 Bacteria 12207
411 Ga0207644_10002396 3300025931 Bacteria 12087
412 Ga0207644_10028208 3300025931 Bacteria 3884
413 Ga0207644_10034656 3300025931 Bacteria 3533
414 Ga0207690_10001675 3300025932 Bacteria 13677
415 Ga0207706_10000052 3300025933 Bacteria 115553
416 Ga0207706_10001855 3300025933 Bacteria 20691
417 Ga0207706_10002254 3300025933 Bacteria 18826
418 Ga0207706_10003781 3300025933 Bacteria 14439
419 Ga0207706_10014160 3300025933 Bacteria 7231
420 Ga0207706_10035632 3300025933 Bacteria 4423
421 Ga0207686_10000387 3300025934 Bacteria 30664
422 Ga0207686_10000894 3300025934 Bacteria 17991
423 Ga0207686_10011407 3300025934 Bacteria 4866
424 Ga0207686_10043703 3300025934 Bacteria 2747
425 Ga0207709_10001289 3300025935 Bacteria 17884
426 Ga0207669_10021866 3300025937 Bacteria 3386
427 Ga0207669_10023987 3300025937 Bacteria 3270
428 Ga0207704_10023795 3300025938 Bacteria 3308
429 Ga0207691_10000153 3300025940 Bacteria 64312
430 Ga0207691_10000663 3300025940 Bacteria 33984
431 Ga0207691_10001224 3300025940 Bacteria 25608
432 Ga0207691_10003074 3300025940 Bacteria 16284
433 Ga0207691_10003500 3300025940 Bacteria 15280
434 Ga0207691_10008959 3300025940 Bacteria 9602
435 Ga0207691_10026283 3300025940 Bacteria 5464
436 Ga0207691_10070561 3300025940 Bacteria 3154
437 Ga0207691_10127843 3300025940 Bacteria 2247
438 Ga0207711_10002569 3300025941 Bacteria 16150
439 Ga0207711_10007090 3300025941 Bacteria 9388
440 Ga0207711_10017016 3300025941 Bacteria 6039
441 Ga0207711_10048642 3300025941 Bacteria 3628
442 Ga0207689_10000091 3300025942 Bacteria 73260
443 Ga0207689_10001242 3300025942 Bacteria 24579
444 Ga0207689_10001481 3300025942 Bacteria 22457
445 Ga0207689_10002415 3300025942 Bacteria 17381
446 Ga0207689_10002543 3300025942 Bacteria 16925
447 Ga0207689_10002580 3300025942 Bacteria 16786
448 Ga0207689_10005478 3300025942 Bacteria 11358
449 Ga0207689_10022530 3300025942 Bacteria 5295
450 Ga0207689_10070944 3300025942 Bacteria 2861
451 Ga0207661_10012124 3300025944 Bacteria 6260
452 Ga0207679_10004581 3300025945 Bacteria 8609
453 Ga0207679_10008523 3300025945 Bacteria 6531
454 Ga0207679_10009411 3300025945 Bacteria 6261
455 Ga0207679_10014353 3300025945 Bacteria 5207
456 Ga0207679_10016018 3300025945 Bacteria 4969
457 Ga0207679_10016187 3300025945 Bacteria 4945
458 Ga0207667_10001296 3300025949 Bacteria 31332
459 Ga0207667_10009605 3300025949 Bacteria 11381
460 Ga0207667_10016708 3300025949 Bacteria 8280
461 Ga0207667_10045578 3300025949 Bacteria 4643
462 Ga0207667_10083787 3300025949 Bacteria 3301
463 Ga0207667_10124154 3300025949 Bacteria 2659
464 Ga0207651_10005833 3300025960 Bacteria 6366
465 Ga0207651_10008998 3300025960 Bacteria 5428
466 Ga0207651_10010046 3300025960 Bacteria 5221
467 Ga0207651_10015586 3300025960 Bacteria 4423
468 Ga0207712_10008029 3300025961 Bacteria 6675
469 Ga0207712_10014061 3300025961 Bacteria 5138
470 Ga0207712_10048522 3300025961 Bacteria 2954
471 Ga0207668_10003307 3300025972 Bacteria 9446
472 Ga0207668_10040382 3300025972 Bacteria 3148
473 Ga0207668_10084494 3300025972 Bacteria 2313
474 Ga0207640_10006016 3300025981 Bacteria 6631
475 Ga0207640_10014498 3300025981 Bacteria 4540
476 Ga0207640_10015486 3300025981 Bacteria 4415
477 Ga0207658_10039861 3300025986 Bacteria 3391
478 Ga0207658_10061724 3300025986 Bacteria 2802
479 Ga0207677_10000717 3300026023 Bacteria 19569
480 Ga0207677_10001127 3300026023 Bacteria 14559
481 Ga0207677_10017670 3300026023 Bacteria 4260
482 Ga0207677_10018204 3300026023 Bacteria 4212
483 Ga0207677_10023282 3300026023 Bacteria 3823
484 Ga0207677_10024749 3300026023 Bacteria 3734
485 Ga0207703_10001000 3300026035 Bacteria 27175
486 Ga0207703_10003742 3300026035 Bacteria 12656
487 Ga0207703_10005598 3300026035 Bacteria 10087
488 Ga0207639_10005452 3300026041 Bacteria 8593
489 Ga0207639_10007463 3300026041 Bacteria 7459
490 Ga0207639_10050170 3300026041 Bacteria 3168
491 Ga0207678_10006203 3300026067 Bacteria 10620
492 Ga0207678_10033999 3300026067 Bacteria 4441
493 Ga0207708_10001492 3300026075 Bacteria 17450
494 Ga0207708_10006999 3300026075 Bacteria 8337
495 Ga0207708_10054780 3300026075 Bacteria 3041
496 Ga0207702_10000248 3300026078 Bacteria 62667
497 Ga0207702_10015292 3300026078 Bacteria 6362
498 Ga0207702_10030720 3300026078 Bacteria 4475
499 Ga0207702_10033649 3300026078 Bacteria 4282
500 Ga0207641_10015731 3300026088 Bacteria 6199
501 Ga0207641_10042121 3300026088 Bacteria 3829
502 Ga0207641_10046825 3300026088 Bacteria 3646
503 Ga0207648_10000415 3300026089 Bacteria 47449
504 Ga0207648_10001004 3300026089 Bacteria 31794
505 Ga0207648_10004079 3300026089 Bacteria 15140
506 Ga0207648_10004860 3300026089 Bacteria 13699
507 Ga0207648_10011801 3300026089 Bacteria 8211
508 Ga0207648_10012903 3300026089 Bacteria 7803
509 Ga0207648_10013321 3300026089 Bacteria 7656
510 Ga0207676_10001564 3300026095 Bacteria 16874
511 Ga0207676_10003875 3300026095 Bacteria 10565
512 Ga0207676_10006171 3300026095 Bacteria 8461
513 Ga0207676_10009655 3300026095 Bacteria 6866
514 Ga0207674_10000180 3300026116 Bacteria 77710
515 Ga0207674_10001995 3300026116 Bacteria 25882
516 Ga0207674_10003455 3300026116 Bacteria 19327
517 Ga0207674_10022759 3300026116 Bacteria 6725
518 Ga0207674_10023835 3300026116 Bacteria 6549
519 Ga0207674_10054406 3300026116 Bacteria 4074
520 Ga0207674_10079979 3300026116 Bacteria 3272
521 Ga0207675_100000930 3300026118 Bacteria 29253
522 Ga0207675_100007047 3300026118 Bacteria 10620
523 Ga0207675_100007242 3300026118 Bacteria 10485
524 Ga0207675_100029295 3300026118 Bacteria 5130
525 Ga0207675_100066232 3300026118 Bacteria 3376
526 Ga0207675_100093635 3300026118 Bacteria 2826
527 Ga0207683_10000140 3300026121 Bacteria 59648
528 Ga0207683_10001329 3300026121 Bacteria 22302
529 Ga0207683_10001697 3300026121 Bacteria 19718
530 Ga0207683_10001790 3300026121 Bacteria 19021
531 Ga0207683_10006146 3300026121 Bacteria 10290
532 Ga0207683_10019924 3300026121 Bacteria 5732
533 Ga0207698_10000661 3300026142 Bacteria 19977
534 Ga0207698_10079729 3300026142 Bacteria 2634
535 Ga0209983_1001921 3300027665 Bacteria 4609
536 Ga0207428_10005166 3300027907 Bacteria 12220
537 Ga0207428_10017464 3300027907 Bacteria 6157
538 Ga0268266_10016322 3300028379 Bacteria 6348
539 Ga0268265_10019134 3300028380 Bacteria 4753
540 Ga0268265_10088157 3300028380 Bacteria 2471
541 Ga0268264_10000599 3300028381 Bacteria 43601
542 Ga0268264_10000903 3300028381 Bacteria 31199
543 Ga0268264_10006736 3300028381 Bacteria 9653
544 Ga0268264_10031782 3300028381 Bacteria 4329
545 Ga0268264_10062312 3300028381 Bacteria 3131
546 Ga0265336_10007064 3300028666 Bacteria 4011
547 Ga0265324_10000004 3300029957 Bacteria 356972
548 Ga0265324_10001102 3300029957 Bacteria 16245
549 Ga0265330_10006254 3300031235 Bacteria 5886
550 Ga0265332_10001350 3300031238 Bacteria 13902
551 Ga0265332_10005682 3300031238 Bacteria 5732
552 Ga0265325_10000146 3300031241 Bacteria 49815
553 Ga0265329_10001643 3300031242 Bacteria 10683
554 Ga0265339_10029021 3300031249 Bacteria 3142
555 Ga0265331_10002588 3300031250 Bacteria 12163
556 Ga0265331_10007731 3300031250 Bacteria 6181
557 Ga0265331_10011916 3300031250 Bacteria 4738
558 Ga0265331_10043358 3300031250 Bacteria 2179
559 Ga0265327_10000116 3300031251 Bacteria 173745
560 Ga0265327_10001001 3300031251 Bacteria 40152
561 Ga0265327_10023172 3300031251 Bacteria 3684
562 Ga0265316_10024673 3300031344 Bacteria 5030
563 Ga0307408_100019736 3300031548 Bacteria 4541
564 Ga0316575_10000088 3300031665 Bacteria 21957
565 Ga0316575_10001975 3300031665 Bacteria 6800
566 Ga0265314_10000805 3300031711 Bacteria 37292
567 Ga0265314_10004095 3300031711 Bacteria 13734
568 Ga0265314_10017301 3300031711 Bacteria 5662
569 Ga0265314_10019191 3300031711 Bacteria 5302
570 Ga0265342_10021049 3300031712 Bacteria 4172
571 Ga0307413_10069257 3300031824 Bacteria 2213
572 Ga0307410_10000539 3300031852 Bacteria 15527
573 Ga0307410_10007189 3300031852 Bacteria 6074
574 Ga0307410_10034141 3300031852 Bacteria 3291
575 Ga0307406_10001458 3300031901 Bacteria 13084
576 Ga0307406_10033432 3300031901 Bacteria 3148
577 Ga0307406_10049673 3300031901 Bacteria 2655
578 Ga0307407_10000212 3300031903 Bacteria 17550
579 Ga0307407_10059371 3300031903 Bacteria 2227
580 Ga0307412_10016813 3300031911 Bacteria 4368
581 Ga0307412_10024072 3300031911 Bacteria 3755
582 Ga0307409_100009515 3300031995 Bacteria 5976
583 Ga0307409_100015897 3300031995 Bacteria 4958
584 Ga0307409_100075040 3300031995 Bacteria 2705
585 Ga0307416_100005850 3300032002 Bacteria 7625
586 Ga0307416_100081807 3300032002 Bacteria 2732
587 Ga0307411_10053451 3300032005 Bacteria 2646
588 Ga0307415_100012415 3300032126 Bacteria 4925
589 Ga0373940_0000154 3300035088 Bacteria 8966
590 Ga0373949_0005416 3300035090 Bacteria 2849
591 Ga0373952_0000495 3300035092 Bacteria 6851
592 Ga0373945_0000908 3300035116 Bacteria 8764
593 Ga0373954_0001074 3300035118 Bacteria 10913
594 Ga0373946_0003481 3300035171 Bacteria 5583
595 Ga0316574_0002518 3300035398 Bacteria 9209
596 Ga0373924_0007745 3300035410 Bacteria 3882
597 Ga0373931_0001495 3300035691 Bacteria 10057
598 Ga0373935_0044374 3300035692 Bacteria 2801
599 Ga0373927_0003205 3300035695 Bacteria 11785
600 Ga0373947_0014038 3300035725 Bacteria 4592
601 Ga0373937_0005419 3300036401 Bacteria 10918
602 Ga0373937_0105332 3300036401 Bacteria 2621
603 Ga0373937_0145140 3300036401 Bacteria 2221
604 Ga0373925_0020604 3300037068 Bacteria 4803
605 Ga0373925_0033488 3300037068 Bacteria 3786
606 Ga0395900_0000981 3300037418 Bacteria 37107
607 Ga0395898_0000872 3300037466 Bacteria 49248
608 Ga0395898_0042031 3300037466 Bacteria 4512
609 Ga0395901_0081543 3300038443 Bacteria 3379
610 Ga0436365_1120368 3300039437 Bacteria 5020
611 Ga0436361_0017830 3300039447 Bacteria 17066
612 Ga0436361_0085764 3300039447 Bacteria 21430
613 Ga0436361_1093254 3300039447 Bacteria 6544
614 Ga0451577_0000002 3300042876 Bacteria 1731375
615 Ga0451577_0000603 3300042876 Bacteria 57862
616 Ga0451577_0008439 3300042876 Bacteria 10026
617 Ga0451577_0019979 3300042876 Bacteria 6153
618 Ga0451577_0023919 3300042876 Bacteria 5565
619 Ga0451577_0038891 3300042876 Bacteria 4277
620 Ga0451577_0045100 3300042876 Bacteria 3946
621 Ga0451577_0088843 3300042876 Bacteria 2757
622 Ga0466969_0003427 3300044656 Bacteria 8433
623 Ga0453683_0000011 3300044673 Bacteria 412765
624 Ga0466965_0024023 3300044683 Bacteria 2947
625 Ga0466966_0026854 3300044684 Bacteria 3756
626 Ga0466961_0000231 3300044693 Bacteria 37788
627 Ga0466964_0007763 3300044706 Bacteria 4016
628 Ga0453684_0000002 3300044712 Bacteria 1731375
629 Ga0453684_0000014 3300044712 Bacteria 993311
630 Ga0453684_0000040 3300044712 Bacteria 690210
631 Ga0453684_0000114 3300044712 Bacteria 356610
632 Ga0453684_0000369 3300044712 Bacteria 184784
633 Ga0453684_0001602 3300044712 Bacteria 62203
634 Ga0453684_0005149 3300044712 Bacteria 26304
635 Ga0453684_0027107 3300044712 Bacteria 8234
636 Ga0453684_0080484 3300044712 Bacteria 4067
637 Ga0453684_0095278 3300044712 Bacteria 3659
638 Ga0466959_0008790 3300045049 Bacteria 7155
639 Ga0451576_0000004 3300045051 Bacteria 1312238
640 Ga0451576_0000060 3300045051 Bacteria 290345
641 Ga0451576_0000168 3300045051 Bacteria 165624
642 Ga0451576_0000313 3300045051 Bacteria 117520
643 Ga0451576_0004696 3300045051 Bacteria 17570
644 Ga0451576_0005200 3300045051 Bacteria 16437
645 Ga0451576_0005859 3300045051 Bacteria 15264
646 Ga0451576_0006582 3300045051 Bacteria 14211
647 Ga0451576_0048192 3300045051 Bacteria 4477
648 Ga0451576_0068412 3300045051 Bacteria 3695
649 Ga0451576_0123887 3300045051 Bacteria 2692
650 Ga0451576_0142644 3300045051 Bacteria 2498
651 Ga0495603_0013925 3300046455 Bacteria 4864
652 Ga0495580_0006840 3300046472 Bacteria 9235
653 Ga0495580_0030164 3300046472 Bacteria 3928
654 Ga0495639_0004676 3300046475 Bacteria 5879
655 Ga0495664_0009419 3300046477 Bacteria 5465
656 Ga0495594_0040835 3300046499 Bacteria 2540
657 Ga0495586_0007760 3300046535 Bacteria 5721
658 Ga0495587_0016278 3300046536 Bacteria 4628
659 Ga0495621_0012611 3300046539 Bacteria 2638
660 Ga0495645_0002022 3300046543 Bacteria 13815
661 Ga0495645_0056327 3300046543 Bacteria 2854
662 Ga0495658_0016036 3300046683 Bacteria 3854
663 Ga0495613_0016801 3300046689 Bacteria 5449
664 Ga0495676_0043684 3300047321 Bacteria 3664
665 Ga0495680_0037036 3300047322 Bacteria 3910
666 Ga0495602_0057613 3300048088 Bacteria 3407
667 Ga0496100_0025109 3300048903 Bacteria 3641
668 Ga0496100_0063092 3300048903 Bacteria 2447
669 Ga0496102_0001476 3300048905 Bacteria 20754
670 Ga0496102_0019848 3300048905 Bacteria 5926
671 Ga0496104_0005678 3300048907 Bacteria 10925
672 Ga0496104_0071700 3300048907 Bacteria 3294
673 Ga0496105_0001094 3300048908 Bacteria 18813
674 Ga0496106_0000071 3300048909 Bacteria 82296
675 Ga0496107_0055393 3300048910 Bacteria 2864
676 Ga0496108_0005943 3300048911 Bacteria 9886
677 Ga0496108_0084474 3300048911 Bacteria 2694
678 Ga0496109_0003575 3300048912 Bacteria 12981
679 Ga0496111_0029893 3300048914 Bacteria 3872
680 Ga0496112_0000965 3300048915 Bacteria 20914
681 Ga0496112_0011743 3300048915 Bacteria 8019
682 Ga0496112_0052895 3300048915 Bacteria 3987
683 Ga0496113_0033825 3300048916 Bacteria 3725
684 Ga0496115_0057466 3300048918 Bacteria 3130
685 Ga0496126_0069861 3300048929 Bacteria 3131
686 Ga0501032_0001858 3300049569 Bacteria 16696
687 Ga0501034_0014335 3300049571 Bacteria 8170
688 Ga0501038_0052633 3300049574 Bacteria 3509
689 Ga0501043_0000024 3300049579 Bacteria 154045
690 Ga0501046_0000173 3300049580 Bacteria 65571
691 Ga0501047_0000051 3300049581 Bacteria 154281
692 Ga0501047_0042588 3300049581 Bacteria 4387
693 Ga0501048_0000650 3300049582 Bacteria 25020
694 Ga0501070_0111300 3300049586 Bacteria 2263
695 Ga0501074_0025894 3300049590 Bacteria 4256
696 Ga0501209_000060 3300049656 Bacteria 10768
697 Ga0501080_0003344 3300049742 Bacteria 14161
698 Ga0501080_0073539 3300049742 Bacteria 3180
699 Ga0501083_0007626 3300049744 Bacteria 7667
700 Ga0501083_0051526 3300049744 Bacteria 2767
701 Ga0501280_000270 3300049776 Bacteria 13172
702 Ga0501045_0003244 3300049824 Bacteria 11107
703 nmdc:mga0k408_743_c1 3300050493 Bacteria 17886
704 nmdc:mga05p37_12551_c1 3300050507 Bacteria 10115
705 nmdc:mga05p37_2739_c1 3300050507 Bacteria 20490
706 nmdc:mga09592_166_c1 3300050508 Bacteria 46469
707 nmdc:mga09592_2082_c1 3300050508 Bacteria 16134
708 nmdc:mga09592_2899_c1 3300050508 Bacteria 13899
709 nmdc:mga06r32_58749_c1 3300050510 Bacteria 3697
710 nmdc:mga08y16_18073_c1 3300050511 Bacteria 7426
711 nmdc:mga08y16_23820_c1 3300050511 Bacteria 6465
712 nmdc:mga08y16_25033_c1 3300050511 Bacteria 6296
713 nmdc:mga08y16_8834_c1 3300050511 Bacteria 10575
714 nmdc:mga0n895_35092_c1 3300050512 Bacteria 4834
715 nmdc:mga0n895_6694_c1 3300050512 Bacteria 9821
716 nmdc:mga0rr50_11221_c1 3300050513 Bacteria 5721
717 nmdc:mga0rr50_1122_c1 3300050513 Bacteria 14549
718 nmdc:mga0rr50_14310_c1 3300050513 Bacteria 5199
719 nmdc:mga08x19_1037_c1 3300050514 Bacteria 17365
720 nmdc:mga08x19_1250_c1 3300050514 Bacteria 15761
721 nmdc:mga08x19_5213_c1 3300050514 Bacteria 7688
722 nmdc:mga0a205_17234_c1 3300050515 Bacteria 6766
723 nmdc:mga0a205_33507_c2 3300050515 Bacteria 4535
724 nmdc:mga0a205_6672_c2 3300050515 Bacteria 9654

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014745 Ga0157377_10040958 Ga0157377_100409582 529
2 3300050512 nmdc:mga0n895_35092_c1 nmdc:mga0n895_35092_c1_1355_3322 560
3 3300032002 Ga0307416_100081807 Ga0307416_1000818072 561
4 3300031548 Ga0307408_100019736 Ga0307408_1000197363 565
5 3300009177 Ga0105248_10030277 Ga0105248_100302773 570
6 3300025917 Ga0207660_10029187 Ga0207660_100291872 570
7 3300049579 Ga0501043_0000024 Ga0501043_0000024_34297_36366 570
8 3300049580 Ga0501046_0000173 Ga0501046_0000173_34297_36366 570
9 3300049581 Ga0501047_0000051 Ga0501047_0000051_117916_119985 570
10 3300049582 Ga0501048_0000650 Ga0501048_0000650_17145_19214 570
11 3300049824 Ga0501045_0003244 Ga0501045_0003244_5844_7913 570
12 3300046536 Ga0495587_0016278 Ga0495587_0016278_997_2958 571
13 3300046543 Ga0495645_0002022 Ga0495645_0002022_11267_13228 571
14 3300048088 Ga0495602_0057613 Ga0495602_0057613_57_2018 571
15 3300006880 Ga0075429_100029138 Ga0075429_1000291383 573
16 3300006844 Ga0075428_100010121 Ga0075428_1000101215 574
17 3300006847 Ga0075431_100011080 Ga0075431_1000110804 574
18 3300050510 nmdc:mga06r32_58749_c1 nmdc:mga06r32_58749_c1_1074_3053 575
19 3300035090 Ga0373949_0005416 Ga0373949_0005416_511_2484 578
20 3300005340 Ga0070689_100065481 Ga0070689_1000654812 579
21 3300005330 Ga0070690_100006548 Ga0070690_1000065487 582
22 3300005334 Ga0068869_100001670 Ga0068869_1000016705 582
23 3300005338 Ga0068868_100009123 Ga0068868_1000091233 582
24 3300005340 Ga0070689_100001098 Ga0070689_10000109817 582
25 3300005341 Ga0070691_10004112 Ga0070691_100041125 582
26 3300005343 Ga0070687_100000491 Ga0070687_10000049115 582
27 3300005345 Ga0070692_10001668 Ga0070692_100016683 582
28 3300005353 Ga0070669_100048427 Ga0070669_1000484272 582
29 3300005440 Ga0070705_100000455 Ga0070705_10000045515 582
30 3300005444 Ga0070694_100000773 Ga0070694_1000007736 582
31 3300005459 Ga0068867_100002290 Ga0068867_1000022905 582
32 3300005530 Ga0070679_100023626 Ga0070679_1000236267 582
33 3300005544 Ga0070686_100004246 Ga0070686_1000042465 582
34 3300005545 Ga0070695_100001745 Ga0070695_1000017457 582
35 3300005547 Ga0070693_100000237 Ga0070693_1000002377 582
36 3300005549 Ga0070704_100000008 Ga0070704_10000000868 582
37 3300005563 Ga0068855_100005852 Ga0068855_1000058525 582
38 3300005578 Ga0068854_100030295 Ga0068854_1000302952 582
39 3300005614 Ga0068856_100088512 Ga0068856_1000885122 582
40 3300005615 Ga0070702_100000012 Ga0070702_10000001212 582
41 3300005617 Ga0068859_100009197 Ga0068859_1000091978 582
42 3300005718 Ga0068866_10001702 Ga0068866_100017027 582
43 3300005719 Ga0068861_100001987 Ga0068861_10000198711 582
44 3300005842 Ga0068858_100005913 Ga0068858_1000059137 582
45 3300005843 Ga0068860_100010866 Ga0068860_1000108666 582
46 3300006237 Ga0097621_100003001 Ga0097621_1000030019 582
47 3300006358 Ga0068871_100000594 Ga0068871_1000005942 582
48 3300006881 Ga0068865_100004473 Ga0068865_1000044733 582
49 3300006931 Ga0097620_100009197 Ga0097620_1000091978 582
50 3300009098 Ga0105245_10003077 Ga0105245_100030778 582
51 3300009148 Ga0105243_10001330 Ga0105243_1000133022 582
52 3300009176 Ga0105242_10001867 Ga0105242_1000186711 582
53 3300009553 Ga0105249_10002333 Ga0105249_100023337 582
54 3300013297 Ga0157378_10000637 Ga0157378_1000063726 582
55 3300014326 Ga0157380_10050666 Ga0157380_100506663 582
56 3300014969 Ga0157376_10004622 Ga0157376_100046227 582
57 3300025918 Ga0207662_10000366 Ga0207662_1000036619 582
58 3300025921 Ga0207652_10099601 Ga0207652_100996011 582
59 3300025923 Ga0207681_10088894 Ga0207681_100888941 582
60 3300025927 Ga0207687_10003076 Ga0207687_1000307611 582
61 3300025934 Ga0207686_10000894 Ga0207686_1000089412 582
62 3300025935 Ga0207709_10001289 Ga0207709_1000128911 582
63 3300025942 Ga0207689_10002415 Ga0207689_100024157 582
64 3300025961 Ga0207712_10008029 Ga0207712_100080293 582
65 3300025981 Ga0207640_10006016 Ga0207640_100060166 582
66 3300026035 Ga0207703_10005598 Ga0207703_100055988 582
67 3300026089 Ga0207648_10004860 Ga0207648_100048608 582
68 3300026118 Ga0207675_100007242 Ga0207675_1000072425 582
69 3300028381 Ga0268264_10000903 Ga0268264_100009033 582
70 3300035088 Ga0373940_0000154 Ga0373940_0000154_2758_4731 583
71 3300035691 Ga0373931_0001495 Ga0373931_0001495_7204_9177 583
72 3300005616 Ga0068852_100000254 Ga0068852_10000025441 584
73 3300005834 Ga0068851_10007141 Ga0068851_100071412 584
74 3300006237 Ga0097621_100016878 Ga0097621_1000168783 584
75 3300009093 Ga0105240_10135381 Ga0105240_101353812 584
76 3300010375 Ga0105239_10032408 Ga0105239_100324085 584
77 3300025321 Ga0207656_10001267 Ga0207656_100012672 584
78 3300025913 Ga0207695_10134541 Ga0207695_101345412 584
79 3300048907 Ga0496104_0071700 Ga0496104_0071700_1243_3213 584
80 3300005459 Ga0068867_100023285 Ga0068867_1000232852 586
81 3300006914 Ga0075436_100000095 Ga0075436_10000009522 593
82 3300050514 nmdc:mga08x19_1037_c1 nmdc:mga08x19_1037_c1_10966_12936 593
83 3300005458 Ga0070681_10006206 Ga0070681_1000620612 596
84 3300005614 Ga0068856_100022733 Ga0068856_1000227335 596
85 3300025912 Ga0207707_10054059 Ga0207707_100540592 596
86 3300025920 Ga0207649_10016743 Ga0207649_100167433 596
87 3300025931 Ga0207644_10028208 Ga0207644_100282083 596
88 3300026078 Ga0207702_10033649 Ga0207702_100336492 596
89 3300026116 Ga0207674_10079979 Ga0207674_100799792 596
90 3300009551 Ga0105238_10017261 Ga0105238_100172612 597
91 3300025949 Ga0207667_10083787 Ga0207667_100837872 597
92 3300036401 Ga0373937_0145140 Ga0373937_0145140_31_2016 597
93 3300037418 Ga0395900_0000981 Ga0395900_0000981_27116_29110 597
94 3300037466 Ga0395898_0000872 Ga0395898_0000872_3907_5901 597
95 3300005563 Ga0068855_100092941 Ga0068855_1000929413 598
96 3300009174 Ga0105241_10012648 Ga0105241_100126485 598
97 3300025911 Ga0207654_10019181 Ga0207654_100191812 598
98 3300006163 Ga0070715_10009123 Ga0070715_100091233 601
99 3300027665 Ga0209983_1001921 Ga0209983_10019212 602
100 3300045051 Ga0451576_0005859 Ga0451576_0005859_10557_12584 603
101 3300005834 Ga0068851_10006845 Ga0068851_100068455 604
102 3300013296 Ga0157374_10016750 Ga0157374_100167502 604
103 3300049656 Ga0501209_000060 Ga0501209_000060_2718_4691 604
104 3300005530 Ga0070679_100026619 Ga0070679_1000266194 605
105 3300005458 Ga0070681_10021120 Ga0070681_100211206 606
106 3300025945 Ga0207679_10009411 Ga0207679_100094115 607
107 3300031235 Ga0265330_10006254 Ga0265330_100062544 607
108 3300031238 Ga0265332_10001350 Ga0265332_100013504 607
109 3300031242 Ga0265329_10001643 Ga0265329_100016439 607
110 3300031251 Ga0265327_10001001 Ga0265327_1000100112 607
111 3300031344 Ga0265316_10024673 Ga0265316_100246732 607
112 3300031711 Ga0265314_10019191 Ga0265314_100191916 607
113 3300005548 Ga0070665_100073184 Ga0070665_1000731842 608
114 3300009094 Ga0111539_10037333 Ga0111539_100373334 609
115 3300050512 nmdc:mga0n895_6694_c1 nmdc:mga0n895_6694_c1_678_2651 609
116 3300050513 nmdc:mga0rr50_1122_c1 nmdc:mga0rr50_1122_c1_11858_13831 609
117 3300050514 nmdc:mga08x19_5213_c1 nmdc:mga08x19_5213_c1_1629_3602 609
118 3300050515 nmdc:mga0a205_6672_c2 nmdc:mga0a205_6672_c2_7013_8986 609
119 3300005617 Ga0068859_100048127 Ga0068859_1000481273 610
120 3300005842 Ga0068858_100009188 Ga0068858_1000091883 610
121 3300006237 Ga0097621_100008117 Ga0097621_1000081177 610
122 3300006237 Ga0097621_100014367 Ga0097621_1000143673 610
123 3300006358 Ga0068871_100003366 Ga0068871_1000033665 610
124 3300006358 Ga0068871_100033066 Ga0068871_1000330664 610
125 3300006881 Ga0068865_100037043 Ga0068865_1000370432 610
126 3300006931 Ga0097620_100048125 Ga0097620_1000481253 610
127 3300009098 Ga0105245_10007877 Ga0105245_100078777 610
128 3300009176 Ga0105242_10005169 Ga0105242_100051697 610
129 3300009177 Ga0105248_10029748 Ga0105248_100297486 610
130 3300014968 Ga0157379_10005730 Ga0157379_100057303 610
131 3300025942 Ga0207689_10070944 Ga0207689_100709442 610
132 3300038443 Ga0395901_0081543 Ga0395901_0081543_1355_3319 610
133 3300042876 Ga0451577_0019979 Ga0451577_0019979_1182_3155 611
134 3300045051 Ga0451576_0004696 Ga0451576_0004696_2673_4646 611
135 3300049574 Ga0501038_0052633 Ga0501038_0052633_1181_3217 612
136 3300005563 Ga0068855_100014386 Ga0068855_1000143862 614
137 3300013104 Ga0157370_10008837 Ga0157370_100088374 614
138 3300025933 Ga0207706_10014160 Ga0207706_100141607 614
139 3300025949 Ga0207667_10045578 Ga0207667_100455783 614
140 3300042876 Ga0451577_0000002 Ga0451577_0000002_1346545_1348521 614
141 3300044673 Ga0453683_0000011 Ga0453683_0000011_401064_403040 614
142 3300044712 Ga0453684_0000002 Ga0453684_0000002_382855_384831 614
143 3300045051 Ga0451576_0000004 Ga0451576_0000004_9495_11471 614
144 3300005563 Ga0068855_100046323 Ga0068855_1000463235 615
145 3300035116 Ga0373945_0000908 Ga0373945_0000908_78_2051 615
146 3300046455 Ga0495603_0013925 Ga0495603_0013925_63_2036 615
147 3300046472 Ga0495580_0006840 Ga0495580_0006840_63_2036 615
148 3300046475 Ga0495639_0004676 Ga0495639_0004676_492_2465 615
149 3300046535 Ga0495586_0007760 Ga0495586_0007760_831_2804 615
150 3300046683 Ga0495658_0016036 Ga0495658_0016036_955_2928 615
151 3300047321 Ga0495676_0043684 Ga0495676_0043684_858_2831 615
152 3300005366 Ga0070659_100076911 Ga0070659_1000769112 616
153 3300005614 Ga0068856_100039603 Ga0068856_1000396032 616
154 3300026078 Ga0207702_10030720 Ga0207702_100307204 616
155 3300029957 Ga0265324_10001102 Ga0265324_1000110212 616
156 3300031711 Ga0265314_10017301 Ga0265314_100173014 616
157 3300037466 Ga0395898_0042031 Ga0395898_0042031_1997_3997 616
158 3300039437 Ga0436365_1120368 Ga0436365_1120368_2853_4817 616
159 3300048915 Ga0496112_0011743 Ga0496112_0011743_432_2456 617
160 3300048916 Ga0496113_0033825 Ga0496113_0033825_748_2772 617
161 3300005843 Ga0068860_100056157 Ga0068860_1000561571 618
162 3300048905 Ga0496102_0019848 Ga0496102_0019848_1870_3819 618
163 3300005329 Ga0070683_100001455 Ga0070683_1000014556 619
164 3300005334 Ga0068869_100001214 Ga0068869_1000012145 619
165 3300005340 Ga0070689_100009989 Ga0070689_1000099896 619
166 3300005466 Ga0070685_10000779 Ga0070685_100007796 619
167 3300005535 Ga0070684_100061128 Ga0070684_1000611282 619
168 3300005577 Ga0068857_100029178 Ga0068857_1000291784 619
169 3300005618 Ga0068864_100001197 Ga0068864_10000119711 619
170 3300005834 Ga0068851_10020462 Ga0068851_100204622 619
171 3300005842 Ga0068858_100005717 Ga0068858_1000057172 619
172 3300005843 Ga0068860_100088409 Ga0068860_1000884092 619
173 3300009553 Ga0105249_10059080 Ga0105249_100590802 619
174 3300013296 Ga0157374_10004187 Ga0157374_100041872 619
175 3300013297 Ga0157378_10011674 Ga0157378_100116742 619
176 3300025315 Ga0207697_10000020 Ga0207697_1000002021 619
177 3300025893 Ga0207682_10000532 Ga0207682_1000053218 619
178 3300025901 Ga0207688_10000534 Ga0207688_1000053411 619
179 3300025907 Ga0207645_10000516 Ga0207645_1000051612 619
180 3300025908 Ga0207643_10000131 Ga0207643_1000013138 619
181 3300025918 Ga0207662_10026857 Ga0207662_100268571 619
182 3300025925 Ga0207650_10004339 Ga0207650_100043392 619
183 3300025926 Ga0207659_10001463 Ga0207659_100014638 619
184 3300025933 Ga0207706_10002254 Ga0207706_1000225411 619
185 3300025940 Ga0207691_10003500 Ga0207691_1000350013 619
186 3300025942 Ga0207689_10000091 Ga0207689_100000918 619
187 3300025945 Ga0207679_10008523 Ga0207679_100085232 619
188 3300026075 Ga0207708_10001492 Ga0207708_1000149217 619
189 3300026089 Ga0207648_10000415 Ga0207648_1000041542 619
190 3300026095 Ga0207676_10009655 Ga0207676_100096555 619
191 3300026116 Ga0207674_10001995 Ga0207674_1000199526 619
192 3300026118 Ga0207675_100000930 Ga0207675_10000093022 619
193 3300026121 Ga0207683_10001697 Ga0207683_1000169712 619
194 3300048903 Ga0496100_0025109 Ga0496100_0025109_160_2124 619
195 3300048911 Ga0496108_0005943 Ga0496108_0005943_3651_5615 619
196 3300048912 Ga0496109_0003575 Ga0496109_0003575_2949_4913 619
197 3300005367 Ga0070667_100047683 Ga0070667_1000476832 620
198 3300005471 Ga0070698_100009607 Ga0070698_1000096074 620
199 3300005530 Ga0070679_100025515 Ga0070679_1000255154 620
200 3300005842 Ga0068858_100081854 Ga0068858_1000818541 620
201 3300006914 Ga0075436_100011908 Ga0075436_1000119082 620
202 3300009174 Ga0105241_10012139 Ga0105241_100121393 620
203 3300014968 Ga0157379_10038383 Ga0157379_100383832 620
204 3300025925 Ga0207650_10036045 Ga0207650_100360452 620
205 3300050514 nmdc:mga08x19_1250_c1 nmdc:mga08x19_1250_c1_11741_13708 620
206 3300005434 Ga0070709_10003074 Ga0070709_100030745 621
207 3300005437 Ga0070710_10003607 Ga0070710_100036076 621
208 3300005546 Ga0070696_100012564 Ga0070696_1000125645 621
209 3300005617 Ga0068859_100009660 Ga0068859_1000096607 621
210 3300005843 Ga0068860_100108955 Ga0068860_1001089552 621
211 3300006844 Ga0075428_100007373 Ga0075428_10000737312 621
212 3300006880 Ga0075429_100000461 Ga0075429_10000046119 621
213 3300006931 Ga0097620_100009661 Ga0097620_1000096614 621
214 3300009094 Ga0111539_10062750 Ga0111539_100627502 621
215 3300009147 Ga0114129_10025059 Ga0114129_100250597 621
216 3300025929 Ga0207664_10005012 Ga0207664_100050126 621
217 3300027907 Ga0207428_10005166 Ga0207428_100051664 621
218 3300028381 Ga0268264_10062312 Ga0268264_100623122 621
219 3300050507 nmdc:mga05p37_12551_c1 nmdc:mga05p37_12551_c1_930_2903 621
220 3300050508 nmdc:mga09592_166_c1 nmdc:mga09592_166_c1_7600_9573 621
221 3300050511 nmdc:mga08y16_8834_c1 nmdc:mga08y16_8834_c1_6422_8395 621
222 3300005331 Ga0070670_100013210 Ga0070670_1000132102 622
223 3300005334 Ga0068869_100000356 Ga0068869_10000035618 622
224 3300005335 Ga0070666_10050557 Ga0070666_100505572 622
225 3300005338 Ga0068868_100027032 Ga0068868_1000270323 622
226 3300005347 Ga0070668_100066284 Ga0070668_1000662842 622
227 3300005364 Ga0070673_100025598 Ga0070673_1000255983 622
228 3300005367 Ga0070667_100001403 Ga0070667_10000140314 622
229 3300005459 Ga0068867_100036656 Ga0068867_1000366561 622
230 3300005577 Ga0068857_100020112 Ga0068857_1000201121 622
231 3300005617 Ga0068859_100014353 Ga0068859_1000143539 622
232 3300005618 Ga0068864_100000981 Ga0068864_10000098115 622
233 3300005719 Ga0068861_100013391 Ga0068861_1000133911 622
234 3300005841 Ga0068863_100004419 Ga0068863_1000044198 622
235 3300005842 Ga0068858_100001946 Ga0068858_10000194618 622
236 3300005843 Ga0068860_100023185 Ga0068860_1000231851 622
237 3300005844 Ga0068862_100007718 Ga0068862_10000771811 622
238 3300006931 Ga0097620_100014355 Ga0097620_1000143559 622
239 3300009177 Ga0105248_10001115 Ga0105248_1000111520 622
240 3300013297 Ga0157378_10044886 Ga0157378_100448863 622
241 3300013308 Ga0157375_10035251 Ga0157375_100352512 622
242 3300014325 Ga0163163_10141160 Ga0163163_101411602 622
243 3300014968 Ga0157379_10009459 Ga0157379_1000945910 622
244 3300025903 Ga0207680_10037591 Ga0207680_100375912 622
245 3300025907 Ga0207645_10002067 Ga0207645_1000206718 622
246 3300025925 Ga0207650_10008205 Ga0207650_100082057 622
247 3300025940 Ga0207691_10127843 Ga0207691_101278432 622
248 3300025942 Ga0207689_10001242 Ga0207689_1000124218 622
249 3300025960 Ga0207651_10010046 Ga0207651_100100465 622
250 3300025972 Ga0207668_10084494 Ga0207668_100844942 622
251 3300026023 Ga0207677_10023282 Ga0207677_100232823 622
252 3300026035 Ga0207703_10003742 Ga0207703_100037422 622
253 3300026088 Ga0207641_10042121 Ga0207641_100421211 622
254 3300026095 Ga0207676_10006171 Ga0207676_100061716 622
255 3300026116 Ga0207674_10022759 Ga0207674_100227594 622
256 3300026118 Ga0207675_100007047 Ga0207675_10000704712 622
257 3300028381 Ga0268264_10000599 Ga0268264_1000059946 622
258 3300005329 Ga0070683_100018710 Ga0070683_1000187104 623
259 3300005339 Ga0070660_100002638 Ga0070660_10000263816 623
260 3300005535 Ga0070684_100010095 Ga0070684_1000100952 623
261 3300005577 Ga0068857_100000165 Ga0068857_10000016545 623
262 3300005578 Ga0068854_100064765 Ga0068854_1000647652 623
263 3300005614 Ga0068856_100000375 Ga0068856_10000037512 623
264 3300005616 Ga0068852_100000371 Ga0068852_10000037130 623
265 3300009551 Ga0105238_10000556 Ga0105238_1000055612 623
266 3300013104 Ga0157370_10005207 Ga0157370_100052079 623
267 3300013105 Ga0157369_10001573 Ga0157369_1000157324 623
268 3300025919 Ga0207657_10011489 Ga0207657_100114893 623
269 3300025925 Ga0207650_10007990 Ga0207650_100079903 623
270 3300025945 Ga0207679_10014353 Ga0207679_100143533 623
271 3300025981 Ga0207640_10014498 Ga0207640_100144985 623
272 3300026116 Ga0207674_10000180 Ga0207674_1000018053 623
273 3300044684 Ga0466966_0026854 Ga0466966_0026854_1848_3728 624
274 3300031665 Ga0316575_10001975 Ga0316575_100019752 625
275 3300037068 Ga0373925_0033488 Ga0373925_0033488_1201_3165 625
276 3300044712 Ga0453684_0000040 Ga0453684_0000040_320777_322756 626
277 3300050515 nmdc:mga0a205_17234_c1 nmdc:mga0a205_17234_c1_3164_5125 626
278 3300005331 Ga0070670_100005445 Ga0070670_1000054455 627
279 3300005445 Ga0070708_100000226 Ga0070708_10000022610 627
280 3300005563 Ga0068855_100004693 Ga0068855_1000046934 627
281 3300005618 Ga0068864_100000221 Ga0068864_10000022136 627
282 3300005841 Ga0068863_100004890 Ga0068863_10000489015 627
283 3300006195 Ga0075366_10002203 Ga0075366_100022036 627
284 3300009093 Ga0105240_10025293 Ga0105240_100252937 627
285 3300009094 Ga0111539_10150910 Ga0111539_101509102 627
286 3300025913 Ga0207695_10014997 Ga0207695_100149972 627
287 3300025925 Ga0207650_10002173 Ga0207650_100021736 627
288 3300025949 Ga0207667_10009605 Ga0207667_100096054 627
289 3300026088 Ga0207641_10015731 Ga0207641_100157313 627
290 3300026095 Ga0207676_10003875 Ga0207676_1000387512 627
291 3300048915 Ga0496112_0052895 Ga0496112_0052895_446_2410 627
292 3300050511 nmdc:mga08y16_25033_c1 nmdc:mga08y16_25033_c1_312_2276 627
293 3300005366 Ga0070659_100052347 Ga0070659_1000523472 628
294 3300013104 Ga0157370_10004576 Ga0157370_100045763 628
295 3300013105 Ga0157369_10007995 Ga0157369_100079952 628
296 3300021361 Ga0213872_10001917 Ga0213872_100019172 628
297 3300039447 Ga0436361_0017830 Ga0436361_0017830_13962_15929 628
298 3300042876 Ga0451577_0088843 Ga0451577_0088843_219_2198 628
299 3300045051 Ga0451576_0068412 Ga0451576_0068412_272_2251 628
300 3300050513 nmdc:mga0rr50_14310_c1 nmdc:mga0rr50_14310_c1_1077_3056 628
301 3300005467 Ga0070706_100033267 Ga0070706_1000332674 629
302 3300025910 Ga0207684_10060008 Ga0207684_100600082 629
303 3300005458 Ga0070681_10004725 Ga0070681_100047252 630
304 3300005530 Ga0070679_100008685 Ga0070679_1000086852 630
305 3300005539 Ga0068853_100011189 Ga0068853_1000111896 630
306 3300006195 Ga0075366_10000907 Ga0075366_100009079 630
307 3300013104 Ga0157370_10009782 Ga0157370_100097823 630
308 3300013104 Ga0157370_10022627 Ga0157370_100226274 630
309 3300025912 Ga0207707_10082099 Ga0207707_100820992 630
310 3300025920 Ga0207649_10003391 Ga0207649_100033917 630
311 3300028666 Ga0265336_10007064 Ga0265336_100070644 630
312 3300029957 Ga0265324_10000004 Ga0265324_10000004330 630
313 3300031241 Ga0265325_10000146 Ga0265325_1000014647 630
314 3300031711 Ga0265314_10004095 Ga0265314_100040952 630
315 3300039447 Ga0436361_1093254 Ga0436361_1093254_2207_4174 630
316 3300049571 Ga0501034_0014335 Ga0501034_0014335_1369_3336 630
317 3300049590 Ga0501074_0025894 Ga0501074_0025894_981_2948 630
318 3300049742 Ga0501080_0003344 Ga0501080_0003344_1278_3245 630
319 3300049744 Ga0501083_0007626 Ga0501083_0007626_3648_5615 630
320 3300050493 nmdc:mga0k408_743_c1 nmdc:mga0k408_743_c1_6176_8146 630
321 3300005347 Ga0070668_100051091 Ga0070668_1000510912 631
322 3300005367 Ga0070667_100044691 Ga0070667_1000446913 631
323 3300005548 Ga0070665_100001743 Ga0070665_10000174324 631
324 3300014969 Ga0157376_10039044 Ga0157376_100390442 631
325 3300025940 Ga0207691_10008959 Ga0207691_1000895911 631
326 3300025972 Ga0207668_10040382 Ga0207668_100403822 631
327 3300005355 Ga0070671_100023981 Ga0070671_1000239813 632
328 3300005549 Ga0070704_100065040 Ga0070704_1000650401 632
329 3300009177 Ga0105248_10000874 Ga0105248_100008749 632
330 3300013297 Ga0157378_10026305 Ga0157378_100263054 632
331 3300025941 Ga0207711_10007090 Ga0207711_100070907 632
332 3300005436 Ga0070713_100000035 Ga0070713_10000003540 633
333 3300006844 Ga0075428_100053815 Ga0075428_1000538152 633
334 3300009176 Ga0105242_10058534 Ga0105242_100585343 633
335 3300025899 Ga0207642_10002880 Ga0207642_100028802 633
336 3300025918 Ga0207662_10045095 Ga0207662_100450952 633
337 3300025928 Ga0207700_10000023 Ga0207700_10000023122 633
338 3300025934 Ga0207686_10043703 Ga0207686_100437032 633
339 3300025940 Ga0207691_10026283 Ga0207691_100262836 633
340 3300025942 Ga0207689_10002580 Ga0207689_1000258021 633
341 3300026075 Ga0207708_10054780 Ga0207708_100547802 633
342 3300028380 Ga0268265_10088157 Ga0268265_100881571 633
343 3300035092 Ga0373952_0000495 Ga0373952_0000495_1185_3155 634
344 3300044712 Ga0453684_0000369 Ga0453684_0000369_116877_118850 634
345 3300048918 Ga0496115_0057466 Ga0496115_0057466_369_2327 634
346 3300049581 Ga0501047_0042588 Ga0501047_0042588_2144_4111 634
347 3300049586 Ga0501070_0111300 Ga0501070_0111300_44_2011 634
348 3300049744 Ga0501083_0051526 Ga0501083_0051526_262_2229 634
349 3300050513 nmdc:mga0rr50_11221_c1 nmdc:mga0rr50_11221_c1_3488_5452 634
350 3300050515 nmdc:mga0a205_33507_c2 nmdc:mga0a205_33507_c2_1631_3595 634
351 3300005436 Ga0070713_100048590 Ga0070713_1000485903 635
352 3300005458 Ga0070681_10005670 Ga0070681_100056709 635
353 3300005530 Ga0070679_100048503 Ga0070679_1000485033 635
354 3300005539 Ga0068853_100004460 Ga0068853_1000044607 635
355 3300013307 Ga0157372_10123879 Ga0157372_101238792 635
356 3300025919 Ga0207657_10038941 Ga0207657_100389412 635
357 3300042876 Ga0451577_0023919 Ga0451577_0023919_2763_4733 635
358 3300042876 Ga0451577_0045100 Ga0451577_0045100_1074_3053 635
359 3300044712 Ga0453684_0005149 Ga0453684_0005149_8313_10283 635
360 3300044712 Ga0453684_0027107 Ga0453684_0027107_2502_4481 635
361 3300045051 Ga0451576_0000313 Ga0451576_0000313_40895_42865 635
362 3300048909 Ga0496106_0000071 Ga0496106_0000071_68033_70021 635
363 3300005843 Ga0068860_100083907 Ga0068860_1000839072 636
364 3300026118 Ga0207675_100066232 Ga0207675_1000662322 636
365 3300031238 Ga0265332_10005682 Ga0265332_100056822 636
366 3300031250 Ga0265331_10002588 Ga0265331_100025889 636
367 3300031711 Ga0265314_10000805 Ga0265314_1000080516 636
368 3300031712 Ga0265342_10021049 Ga0265342_100210492 636
369 3300031824 Ga0307413_10069257 Ga0307413_100692571 636
370 3300031852 Ga0307410_10007189 Ga0307410_100071891 636
371 3300031901 Ga0307406_10049673 Ga0307406_100496731 636
372 3300031903 Ga0307407_10059371 Ga0307407_100593711 636
373 3300031911 Ga0307412_10024072 Ga0307412_100240721 636
374 3300031995 Ga0307409_100075040 Ga0307409_1000750401 636
375 3300032005 Ga0307411_10053451 Ga0307411_100534511 636
376 3300042876 Ga0451577_0038891 Ga0451577_0038891_362_2326 636
377 3300005354 Ga0070675_100014034 Ga0070675_1000140345 637
378 3300005366 Ga0070659_100002320 Ga0070659_10000232016 637
379 3300005367 Ga0070667_100049868 Ga0070667_1000498682 637
380 3300005455 Ga0070663_100006564 Ga0070663_1000065642 637
381 3300005457 Ga0070662_100000286 Ga0070662_10000028621 637
382 3300005539 Ga0068853_100006560 Ga0068853_1000065602 637
383 3300005548 Ga0070665_100022529 Ga0070665_1000225297 637
384 3300005548 Ga0070665_100040914 Ga0070665_1000409143 637
385 3300005563 Ga0068855_100000852 Ga0068855_10000085241 637
386 3300005564 Ga0070664_100008744 Ga0070664_1000087444 637
387 3300005578 Ga0068854_100030079 Ga0068854_1000300791 637
388 3300005614 Ga0068856_100000664 Ga0068856_10000066441 637
389 3300005614 Ga0068856_100114761 Ga0068856_1001147612 637
390 3300005616 Ga0068852_100080051 Ga0068852_1000800512 637
391 3300009174 Ga0105241_10038696 Ga0105241_100386963 637
392 3300013100 Ga0157373_10000524 Ga0157373_1000052430 637
393 3300013102 Ga0157371_10000614 Ga0157371_1000061416 637
394 3300013104 Ga0157370_10006054 Ga0157370_1000605411 637
395 3300013105 Ga0157369_10147251 Ga0157369_101472512 637
396 3300013307 Ga0157372_10002357 Ga0157372_100023571 637
397 3300025907 Ga0207645_10023134 Ga0207645_100231343 637
398 3300025911 Ga0207654_10020614 Ga0207654_100206142 637
399 3300025914 Ga0207671_10005819 Ga0207671_100058198 637
400 3300025919 Ga0207657_10013684 Ga0207657_100136849 637
401 3300025920 Ga0207649_10002994 Ga0207649_1000299410 637
402 3300025926 Ga0207659_10008089 Ga0207659_100080895 637
403 3300025926 Ga0207659_10016044 Ga0207659_100160446 637
404 3300025931 Ga0207644_10002353 Ga0207644_100023539 637
405 3300025932 Ga0207690_10001675 Ga0207690_1000167512 637
406 3300025933 Ga0207706_10000052 Ga0207706_1000005297 637
407 3300025933 Ga0207706_10035632 Ga0207706_100356323 637
408 3300025945 Ga0207679_10016018 Ga0207679_100160181 637
409 3300025945 Ga0207679_10016187 Ga0207679_100161873 637
410 3300025949 Ga0207667_10001296 Ga0207667_1000129634 637
411 3300025981 Ga0207640_10015486 Ga0207640_100154861 637
412 3300025986 Ga0207658_10039861 Ga0207658_100398612 637
413 3300025986 Ga0207658_10061724 Ga0207658_100617242 637
414 3300026041 Ga0207639_10005452 Ga0207639_100054524 637
415 3300026041 Ga0207639_10007463 Ga0207639_100074637 637
416 3300026067 Ga0207678_10006203 Ga0207678_100062036 637
417 3300026078 Ga0207702_10000248 Ga0207702_1000024820 637
418 3300028379 Ga0268266_10016322 Ga0268266_100163226 637
419 3300031249 Ga0265339_10029021 Ga0265339_100290212 637
420 3300036401 Ga0373937_0005419 Ga0373937_0005419_3327_5384 637
421 3300036401 Ga0373937_0105332 Ga0373937_0105332_36_2000 637
422 3300048905 Ga0496102_0001476 Ga0496102_0001476_3088_5052 637
423 3300048910 Ga0496107_0055393 Ga0496107_0055393_771_2735 637
424 3300005347 Ga0070668_100025056 Ga0070668_1000250562 638
425 3300005563 Ga0068855_100019510 Ga0068855_1000195103 638
426 3300005616 Ga0068852_100009106 Ga0068852_1000091062 638
427 3300005844 Ga0068862_100018173 Ga0068862_1000181735 638
428 3300005985 Ga0081539_10014045 Ga0081539_100140453 638
429 3300013105 Ga0157369_10001463 Ga0157369_100014632 638
430 3300013307 Ga0157372_10023642 Ga0157372_100236423 638
431 3300025924 Ga0207694_10020244 Ga0207694_100202442 638
432 3300025949 Ga0207667_10016708 Ga0207667_100167083 638
433 3300026118 Ga0207675_100093635 Ga0207675_1000936352 638
434 3300026142 Ga0207698_10079729 Ga0207698_100797291 638
435 3300046539 Ga0495621_0012611 Ga0495621_0012611_438_2402 638
436 3300005328 Ga0070676_10004210 Ga0070676_100042104 639
437 3300005330 Ga0070690_100019575 Ga0070690_1000195752 639
438 3300005367 Ga0070667_100002052 Ga0070667_1000020526 639
439 3300005617 Ga0068859_100021791 Ga0068859_1000217914 639
440 3300005843 Ga0068860_100019348 Ga0068860_1000193484 639
441 3300006931 Ga0097620_100021791 Ga0097620_1000217914 639
442 3300013296 Ga0157374_10008385 Ga0157374_100083856 639
443 3300013306 Ga0163162_10044761 Ga0163162_100447612 639
444 3300013308 Ga0157375_10045021 Ga0157375_100450214 639
445 3300014968 Ga0157379_10008738 Ga0157379_1000873810 639
446 3300014969 Ga0157376_10013604 Ga0157376_100136047 639
447 3300017792 Ga0163161_10012976 Ga0163161_100129762 639
448 3300025907 Ga0207645_10000353 Ga0207645_1000035339 639
449 3300025940 Ga0207691_10000663 Ga0207691_1000066337 639
450 3300025942 Ga0207689_10001481 Ga0207689_1000148124 639
451 3300025961 Ga0207712_10014061 Ga0207712_100140612 639
452 3300026089 Ga0207648_10004079 Ga0207648_1000407914 639
453 3300026121 Ga0207683_10001329 Ga0207683_100013299 639
454 3300028381 Ga0268264_10031782 Ga0268264_100317823 639
455 3300042876 Ga0451577_0008439 Ga0451577_0008439_945_2924 639
456 3300048929 Ga0496126_0069861 Ga0496126_0069861_1140_3113 639
457 3300005436 Ga0070713_100010958 Ga0070713_1000109583 640
458 3300007265 Ga0099794_10005789 Ga0099794_100057893 640
459 3300013296 Ga0157374_10005148 Ga0157374_100051484 640
460 3300035118 Ga0373954_0001074 Ga0373954_0001074_1089_3224 640
461 3300035410 Ga0373924_0007745 Ga0373924_0007745_198_2333 640
462 3300035695 Ga0373927_0003205 Ga0373927_0003205_5239_7206 640
463 3300044712 Ga0453684_0095278 Ga0453684_0095278_1571_3550 640
464 3300045051 Ga0451576_0000168 Ga0451576_0000168_87977_89956 640
465 3300045051 Ga0451576_0142644 Ga0451576_0142644_324_2300 640
466 3300046472 Ga0495580_0030164 Ga0495580_0030164_1206_3341 640
467 3300046499 Ga0495594_0040835 Ga0495594_0040835_102_2237 640
468 3300046689 Ga0495613_0016801 Ga0495613_0016801_1874_4009 640
469 3300047322 Ga0495680_0037036 Ga0495680_0037036_1418_3553 640
470 3300048903 Ga0496100_0063092 Ga0496100_0063092_63_2198 640
471 3300048907 Ga0496104_0005678 Ga0496104_0005678_7459_9594 640
472 3300048908 Ga0496105_0001094 Ga0496105_0001094_9080_11215 640
473 3300048915 Ga0496112_0000965 Ga0496112_0000965_1562_3697 640
474 iso_pu_bacteria 2574179768 2574430189 640
475 3300005549 Ga0070704_100008692 Ga0070704_1000086924 641
476 3300006880 Ga0075429_100000293 Ga0075429_10000029320 641
477 3300009147 Ga0114129_10009970 Ga0114129_100099709 641
478 3300031665 Ga0316575_10000088 Ga0316575_100000881 641
479 3300031852 Ga0307410_10034141 Ga0307410_100341411 641
480 3300031901 Ga0307406_10033432 Ga0307406_100334321 641
481 3300031911 Ga0307412_10016813 Ga0307412_100168132 641
482 3300031995 Ga0307409_100009515 Ga0307409_1000095155 641
483 3300032126 Ga0307415_100012415 Ga0307415_1000124152 641
484 3300045051 Ga0451576_0048192 Ga0451576_0048192_1919_3898 641
485 3300049569 Ga0501032_0001858 Ga0501032_0001858_1822_3792 641
486 3300050507 nmdc:mga05p37_2739_c1 nmdc:mga05p37_2739_c1_5732_7750 641
487 3300050508 nmdc:mga09592_2082_c1 nmdc:mga09592_2082_c1_6301_8319 641
488 iso_pu_bacteria 2846037992 2846040053 641
489 3300005339 Ga0070660_100041724 Ga0070660_1000417243 642
490 3300005345 Ga0070692_10008430 Ga0070692_100084301 642
491 3300005356 Ga0070674_100080152 Ga0070674_1000801522 642
492 3300005366 Ga0070659_100049731 Ga0070659_1000497311 642
493 3300005435 Ga0070714_100000984 Ga0070714_10000098419 642
494 3300005445 Ga0070708_100044597 Ga0070708_1000445972 642
495 3300005457 Ga0070662_100026680 Ga0070662_1000266803 642
496 3300005468 Ga0070707_100076761 Ga0070707_1000767612 642
497 3300005518 Ga0070699_100007236 Ga0070699_1000072362 642
498 3300005834 Ga0068851_10020725 Ga0068851_100207252 642
499 3300006844 Ga0075428_100000089 Ga0075428_10000008948 642
500 3300006880 Ga0075429_100013949 Ga0075429_1000139493 642
501 3300006914 Ga0075436_100041126 Ga0075436_1000411262 642
502 3300009093 Ga0105240_10111167 Ga0105240_101111672 642
503 3300009094 Ga0111539_10000086 Ga0111539_1000008620 642
504 3300009098 Ga0105245_10035403 Ga0105245_100354033 642
505 3300009174 Ga0105241_10073800 Ga0105241_100738001 642
506 3300011119 Ga0105246_10004097 Ga0105246_100040976 642
507 3300013104 Ga0157370_10046746 Ga0157370_100467463 642
508 3300013105 Ga0157369_10099455 Ga0157369_100994552 642
509 3300025910 Ga0207684_10054469 Ga0207684_100544693 642
510 3300025912 Ga0207707_10081109 Ga0207707_100811092 642
511 3300025915 Ga0207693_10014396 Ga0207693_100143964 642
512 3300025917 Ga0207660_10033376 Ga0207660_100333762 642
513 3300025919 Ga0207657_10000469 Ga0207657_1000046940 642
514 3300025929 Ga0207664_10007905 Ga0207664_100079052 642
515 3300025942 Ga0207689_10022530 Ga0207689_100225304 642
516 3300026041 Ga0207639_10050170 Ga0207639_100501702 642
517 3300026067 Ga0207678_10033999 Ga0207678_100339992 642
518 3300026078 Ga0207702_10015292 Ga0207702_100152925 642
519 3300026089 Ga0207648_10013321 Ga0207648_100133218 642
520 3300026116 Ga0207674_10003455 Ga0207674_1000345515 642
521 3300027907 Ga0207428_10017464 Ga0207428_100174643 642
522 3300035171 Ga0373946_0003481 Ga0373946_0003481_3229_5193 642
523 3300035725 Ga0373947_0014038 Ga0373947_0014038_1634_3598 642
524 3300037068 Ga0373925_0020604 Ga0373925_0020604_1215_3179 642
525 3300046477 Ga0495664_0009419 Ga0495664_0009419_2372_4336 642
526 3300050508 nmdc:mga09592_2899_c1 nmdc:mga09592_2899_c1_1803_3767 642
527 3300050511 nmdc:mga08y16_23820_c1 nmdc:mga08y16_23820_c1_2951_4915 642
528 iso_pu_bacteria 2846033681 2846035177 642
529 iso_pu_bacteria 2998344455 2998348155 642
530 3300005334 Ga0068869_100010219 Ga0068869_1000102193 643
531 3300005338 Ga0068868_100009896 Ga0068868_1000098966 643
532 3300005340 Ga0070689_100002060 Ga0070689_1000020607 643
533 3300005354 Ga0070675_100000225 Ga0070675_1000002252 643
534 3300005354 Ga0070675_100007207 Ga0070675_1000072075 643
535 3300005355 Ga0070671_100000251 Ga0070671_1000002512 643
536 3300005365 Ga0070688_100004606 Ga0070688_1000046065 643
537 3300005456 Ga0070678_100000567 Ga0070678_1000005672 643
538 3300005459 Ga0068867_100005689 Ga0068867_10000568910 643
539 3300005467 Ga0070706_100072884 Ga0070706_1000728841 643
540 3300005543 Ga0070672_100000543 Ga0070672_10000054316 643
541 3300005548 Ga0070665_100014704 Ga0070665_1000147046 643
542 3300005577 Ga0068857_100024323 Ga0068857_1000243232 643
543 3300005617 Ga0068859_100010133 Ga0068859_1000101335 643
544 3300006237 Ga0097621_100000762 Ga0097621_1000007623 643
545 3300006237 Ga0097621_100001879 Ga0097621_1000018797 643
546 3300006931 Ga0097620_100010133 Ga0097620_1000101335 643
547 3300009177 Ga0105248_10004254 Ga0105248_1000425412 643
548 3300009177 Ga0105248_10085045 Ga0105248_100850452 643
549 3300013306 Ga0163162_10027766 Ga0163162_100277661 643
550 3300013308 Ga0157375_10002640 Ga0157375_1000264012 643
551 3300014969 Ga0157376_10004250 Ga0157376_100042508 643
552 3300014969 Ga0157376_10014757 Ga0157376_100147573 643
553 3300025926 Ga0207659_10004796 Ga0207659_100047968 643
554 3300025931 Ga0207644_10002396 Ga0207644_100023962 643
555 3300025940 Ga0207691_10001224 Ga0207691_100012248 643
556 3300025940 Ga0207691_10003074 Ga0207691_100030747 643
557 3300025941 Ga0207711_10017016 Ga0207711_100170166 643
558 3300025942 Ga0207689_10002543 Ga0207689_100025433 643
559 3300025944 Ga0207661_10012124 Ga0207661_100121245 643
560 3300025945 Ga0207679_10004581 Ga0207679_100045811 643
561 3300026023 Ga0207677_10000717 Ga0207677_100007171 643
562 3300026023 Ga0207677_10024749 Ga0207677_100247493 643
563 3300026089 Ga0207648_10012903 Ga0207648_100129032 643
564 3300026116 Ga0207674_10023835 Ga0207674_100238354 643
565 3300026121 Ga0207683_10001790 Ga0207683_100017904 643
566 3300026142 Ga0207698_10000661 Ga0207698_100006612 643
567 3300031250 Ga0265331_10007731 Ga0265331_100077315 643
568 3300031251 Ga0265327_10000116 Ga0265327_1000011618 643
569 3300048911 Ga0496108_0084474 Ga0496108_0084474_444_2450 643
570 3300048914 Ga0496111_0029893 Ga0496111_0029893_722_2728 643
571 iso_pu_bacteria 2547132103 2547373118 643
572 iso_pu_bacteria 2843690924 2843691809 643
573 3300005327 Ga0070658_10013552 Ga0070658_100135521 644
574 3300005356 Ga0070674_100012063 Ga0070674_1000120635 644
575 3300005530 Ga0070679_100070965 Ga0070679_1000709651 644
576 3300005842 Ga0068858_100023474 Ga0068858_1000234747 644
577 3300009176 Ga0105242_10004748 Ga0105242_100047482 644
578 3300014326 Ga0157380_10001950 Ga0157380_1000195013 644
579 3300014968 Ga0157379_10045960 Ga0157379_100459603 644
580 3300025921 Ga0207652_10101030 Ga0207652_101010302 644
581 3300025937 Ga0207669_10021866 Ga0207669_100218662 644
582 3300049742 Ga0501080_0073539 Ga0501080_0073539_53_2029 644
583 3300005328 Ga0070676_10000676 Ga0070676_100006764 645
584 3300005330 Ga0070690_100003769 Ga0070690_1000037693 645
585 3300005331 Ga0070670_100028628 Ga0070670_1000286282 645
586 3300005335 Ga0070666_10006099 Ga0070666_100060995 645
587 3300005338 Ga0068868_100006178 Ga0068868_1000061782 645
588 3300005340 Ga0070689_100000418 Ga0070689_10000041822 645
589 3300005347 Ga0070668_100001492 Ga0070668_1000014921 645
590 3300005353 Ga0070669_100023612 Ga0070669_1000236122 645
591 3300005354 Ga0070675_100015218 Ga0070675_1000152182 645
592 3300005354 Ga0070675_100031039 Ga0070675_1000310394 645
593 3300005356 Ga0070674_100000161 Ga0070674_1000001613 645
594 3300005364 Ga0070673_100004380 Ga0070673_1000043809 645
595 3300005364 Ga0070673_100015411 Ga0070673_1000154116 645
596 3300005367 Ga0070667_100023492 Ga0070667_1000234921 645
597 3300005439 Ga0070711_100000407 Ga0070711_10000040711 645
598 3300005456 Ga0070678_100006917 Ga0070678_1000069172 645
599 3300005457 Ga0070662_100036909 Ga0070662_1000369092 645
600 3300005458 Ga0070681_10085719 Ga0070681_100857192 645
601 3300005459 Ga0068867_100004418 Ga0068867_1000044183 645
602 3300005459 Ga0068867_100009172 Ga0068867_1000091722 645
603 3300005530 Ga0070679_100085159 Ga0070679_1000851592 645
604 3300005539 Ga0068853_100026555 Ga0068853_1000265553 645
605 3300005539 Ga0068853_100034916 Ga0068853_1000349163 645
606 3300005543 Ga0070672_100002112 Ga0070672_1000021126 645
607 3300005548 Ga0070665_100003736 Ga0070665_10000373615 645
608 3300005563 Ga0068855_100089417 Ga0068855_1000894172 645
609 3300005578 Ga0068854_100001272 Ga0068854_10000127213 645
610 3300005618 Ga0068864_100001506 Ga0068864_10000150623 645
611 3300005718 Ga0068866_10002776 Ga0068866_100027764 645
612 3300005841 Ga0068863_100000366 Ga0068863_10000036615 645
613 3300005841 Ga0068863_100004197 Ga0068863_10000419716 645
614 3300005841 Ga0068863_100082438 Ga0068863_1000824382 645
615 3300005842 Ga0068858_100003588 Ga0068858_10000358812 645
616 3300006881 Ga0068865_100040940 Ga0068865_1000409402 645
617 3300009148 Ga0105243_10033422 Ga0105243_100334222 645
618 3300009174 Ga0105241_10007877 Ga0105241_100078776 645
619 3300009545 Ga0105237_10138221 Ga0105237_101382212 645
620 3300013297 Ga0157378_10005782 Ga0157378_100057826 645
621 3300013306 Ga0163162_10039972 Ga0163162_100399723 645
622 3300013308 Ga0157375_10030513 Ga0157375_100305132 645
623 3300013308 Ga0157375_10033853 Ga0157375_100338533 645
624 3300014745 Ga0157377_10003422 Ga0157377_100034226 645
625 3300017792 Ga0163161_10014898 Ga0163161_100148985 645
626 3300017792 Ga0163161_10037977 Ga0163161_100379772 645
627 3300021361 Ga0213872_10014786 Ga0213872_100147861 645
628 3300025321 Ga0207656_10000665 Ga0207656_100006655 645
629 3300025893 Ga0207682_10000303 Ga0207682_1000030319 645
630 3300025899 Ga0207642_10000532 Ga0207642_100005324 645
631 3300025907 Ga0207645_10000209 Ga0207645_1000020951 645
632 3300025907 Ga0207645_10045381 Ga0207645_100453811 645
633 3300025911 Ga0207654_10012293 Ga0207654_100122933 645
634 3300025915 Ga0207693_10001140 Ga0207693_100011404 645
635 3300025927 Ga0207687_10003673 Ga0207687_100036736 645
636 3300025927 Ga0207687_10010221 Ga0207687_100102216 645
637 3300025933 Ga0207706_10003781 Ga0207706_100037818 645
638 3300025934 Ga0207686_10000387 Ga0207686_1000038713 645
639 3300025940 Ga0207691_10000153 Ga0207691_1000015325 645
640 3300025941 Ga0207711_10002569 Ga0207711_100025699 645
641 3300025949 Ga0207667_10124154 Ga0207667_101241542 645
642 3300025960 Ga0207651_10005833 Ga0207651_100058336 645
643 3300025960 Ga0207651_10015586 Ga0207651_100155862 645
644 3300025972 Ga0207668_10003307 Ga0207668_1000330711 645
645 3300026023 Ga0207677_10001127 Ga0207677_1000112710 645
646 3300026023 Ga0207677_10018204 Ga0207677_100182043 645
647 3300026035 Ga0207703_10001000 Ga0207703_1000100021 645
648 3300026088 Ga0207641_10046825 Ga0207641_100468252 645
649 3300026089 Ga0207648_10001004 Ga0207648_100010045 645
650 3300026095 Ga0207676_10001564 Ga0207676_1000156412 645
651 3300026121 Ga0207683_10000140 Ga0207683_1000014057 645
652 3300026121 Ga0207683_10006146 Ga0207683_1000614611 645
653 3300028381 Ga0268264_10006736 Ga0268264_100067362 645
654 3300031852 Ga0307410_10000539 Ga0307410_1000053918 645
655 3300031901 Ga0307406_10001458 Ga0307406_100014587 645
656 3300031903 Ga0307407_10000212 Ga0307407_1000021213 645
657 3300031995 Ga0307409_100015897 Ga0307409_1000158974 645
658 3300032002 Ga0307416_100005850 Ga0307416_1000058502 645
659 3300035398 Ga0316574_0002518 Ga0316574_0002518_653_2632 645
660 3300035692 Ga0373935_0044374 Ga0373935_0044374_38_2002 645
661 3300039447 Ga0436361_0085764 Ga0436361_0085764_14796_16769 645
662 3300044656 Ga0466969_0003427 Ga0466969_0003427_878_2842 645
663 3300044683 Ga0466965_0024023 Ga0466965_0024023_123_2087 645
664 3300044693 Ga0466961_0000231 Ga0466961_0000231_33650_35614 645
665 3300044706 Ga0466964_0007763 Ga0466964_0007763_657_2621 645
666 3300044712 Ga0453684_0000114 Ga0453684_0000114_344080_346077 645
667 3300044712 Ga0453684_0080484 Ga0453684_0080484_216_2207 645
668 3300045049 Ga0466959_0008790 Ga0466959_0008790_2992_4956 645
669 3300045051 Ga0451576_0000060 Ga0451576_0000060_77237_79210 645
670 3300045051 Ga0451576_0005200 Ga0451576_0005200_2433_4424 645
671 3300045051 Ga0451576_0123887 Ga0451576_0123887_273_2264 645
672 3300046543 Ga0495645_0056327 Ga0495645_0056327_762_2816 645
673 3300049776 Ga0501280_000270 Ga0501280_000270_312_2282 645
674 3300005456 Ga0070678_100016254 Ga0070678_1000162543 646
675 3300005548 Ga0070665_100007569 Ga0070665_1000075693 646
676 3300009545 Ga0105237_10002707 Ga0105237_100027079 646
677 3300013297 Ga0157378_10041784 Ga0157378_100417841 646
678 3300014745 Ga0157377_10031656 Ga0157377_100316562 646
679 3300026121 Ga0207683_10019924 Ga0207683_100199243 646
680 3300031250 Ga0265331_10011916 Ga0265331_100119163 646
681 3300031250 Ga0265331_10043358 Ga0265331_100433581 646
682 3300031251 Ga0265327_10023172 Ga0265327_100231722 646
683 3300042876 Ga0451577_0000603 Ga0451577_0000603_31793_33763 646
684 3300044712 Ga0453684_0000014 Ga0453684_0000014_720957_722927 646
685 3300044712 Ga0453684_0001602 Ga0453684_0001602_41770_43740 646
686 3300045051 Ga0451576_0006582 Ga0451576_0006582_6164_8179 646
687 3300002239 JGI24034J26672_10003189 JGI24034J26672_100031891 648
688 3300005334 Ga0068869_100036161 Ga0068869_1000361612 648
689 3300005335 Ga0070666_10021435 Ga0070666_100214352 648
690 3300005340 Ga0070689_100005740 Ga0070689_1000057403 648
691 3300005356 Ga0070674_100017037 Ga0070674_1000170372 648
692 3300005441 Ga0070700_100004312 Ga0070700_1000043127 648
693 3300005466 Ga0070685_10005932 Ga0070685_100059326 648
694 3300005543 Ga0070672_100052601 Ga0070672_1000526012 648
695 3300005544 Ga0070686_100021461 Ga0070686_1000214612 648
696 3300005549 Ga0070704_100035952 Ga0070704_1000359522 648
697 3300005719 Ga0068861_100040242 Ga0068861_1000402422 648
698 3300005842 Ga0068858_100013483 Ga0068858_1000134833 648
699 3300006881 Ga0068865_100046293 Ga0068865_1000462932 648
700 3300009094 Ga0111539_10057184 Ga0111539_100571843 648
701 3300009176 Ga0105242_10001759 Ga0105242_1000175913 648
702 3300009553 Ga0105249_10033505 Ga0105249_100335054 648
703 3300013297 Ga0157378_10057268 Ga0157378_100572682 648
704 3300014325 Ga0163163_10098921 Ga0163163_100989212 648
705 3300014968 Ga0157379_10015696 Ga0157379_100156964 648
706 3300017792 Ga0163161_10032262 Ga0163161_100322622 648
707 3300025315 Ga0207697_10001039 Ga0207697_100010396 648
708 3300025893 Ga0207682_10002866 Ga0207682_100028662 648
709 3300025901 Ga0207688_10000877 Ga0207688_1000087711 648
710 3300025907 Ga0207645_10014473 Ga0207645_100144732 648
711 3300025908 Ga0207643_10009895 Ga0207643_100098954 648
712 3300025918 Ga0207662_10003310 Ga0207662_100033106 648
713 3300025926 Ga0207659_10031655 Ga0207659_100316552 648
714 3300025931 Ga0207644_10034656 Ga0207644_100346562 648
715 3300025933 Ga0207706_10001855 Ga0207706_100018559 648
716 3300025934 Ga0207686_10011407 Ga0207686_100114072 648
717 3300025937 Ga0207669_10023987 Ga0207669_100239872 648
718 3300025938 Ga0207704_10023795 Ga0207704_100237952 648
719 3300025940 Ga0207691_10070561 Ga0207691_100705612 648
720 3300025941 Ga0207711_10048642 Ga0207711_100486422 648
721 3300025942 Ga0207689_10005478 Ga0207689_100054786 648
722 3300025960 Ga0207651_10008998 Ga0207651_100089985 648
723 3300025961 Ga0207712_10048522 Ga0207712_100485222 648
724 3300026023 Ga0207677_10017670 Ga0207677_100176703 648
725 3300026075 Ga0207708_10006999 Ga0207708_100069998 648
726 3300026089 Ga0207648_10011801 Ga0207648_100118012 648
727 3300026116 Ga0207674_10054406 Ga0207674_100544062 648
728 3300026118 Ga0207675_100029295 Ga0207675_1000292953 648
729 3300028380 Ga0268265_10019134 Ga0268265_100191342 648
730 3300050511 nmdc:mga08y16_18073_c1 nmdc:mga08y16_18073_c1_761_2731 648

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02254

TrkA_N

TrkA-N domain

466

581

0.98

PF02080

TrkA_C

TrkA-C domain

640

709

0.9

PF00999

Na_H_Exchanger

Sodium/hydrogen exchanger family

69

433

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
5nmw-assembly2.cif.gz_D crystal structure of the pyrrolizidine alkaloid n-oxygenase from zonocerus variegatus in complex with fad 0.9408 398 429
5nmw-assembly1.cif.gz_A-2 crystal structure of the pyrrolizidine alkaloid n-oxygenase from zonocerus variegatus in complex with fad 0.9393 398 430
4zcc-assembly2.cif.gz_B renalase in complex with nadh 0.9352 399 431
4eiq-assembly2.cif.gz_B chromopyrrolic acid-soaked rebc-10x with bound 7-carboxy-k252c 0.9282 397 428
7al4-assembly2.cif.gz_C ancestral flavin-containing monooxygenase (fmo) 1 (mammalian) 0.9199 398 429
ID Description Score Start End Superfamily
af_A0A1D6E7M3_47_537_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.965 400 429 3.50.50.60
af_A0A1D6HY89_22_259_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9615 400 430 3.50.50.60
af_B5BM30_1_361_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9515 398 429 3.50.50.60
af_Q54F68_8_396_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9502 399 429 3.50.50.60
4hb9A01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.946 398 429 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A522VXE5-F1-model_v4 Potassium transporter 0.9636 3 480 GO:0005886
GO:0006813
GO:0008324
GO:0015297
GO:1902600
AF-A0A524PVD3-F1-model_v4 deleted 0.963 7 375
AF-A0A2W5Q847-F1-model_v4 Potassium transporter 0.9525 3 439 GO:0005886
GO:0006813
GO:0008324
GO:0015297
GO:1902600
AF-A0A3S4M0X1-F1-model_v4 Transport protein 0.9476 105 368 GO:0005886
GO:0015297
GO:1902600
AF-A0A258BHW0-F1-model_v4 Cation/H+ exchanger transmembrane domain-containing protein 0.9446 31 373 GO:0005886
GO:0015297
GO:1902600

Feature Viewer

pLDDT pTM Quality
82.85 0.59 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map