F477909
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 730 | 269 | 729 | 100 |
Family's Representative Sequence
| Representative Sequence | 3300005530|Ga0070679_100260398|Ga0070679_1002603982 |
| Length | 114 |
| Sequence | MVPLSWYLILSTILFCMGVFGFLLKRNIITNFMSIELMLNAVNLSFVAFANYWHARAVQGVTPAGVEKALSGQVFVFFVMVVXXXEAAVGLAIIIAVFRTRETLNVDRVNLLKL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2884215851 | Edaphobacter sp. 12200R-103 | Isolate | Rhizosphere |
| 2 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 3 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 4 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 5 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 35 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 48 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 51 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 52 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 53 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 54 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 55 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 56 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 57 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 63 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 64 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 65 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 66 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 68 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 69 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 94 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 95 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 96 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 97 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 98 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 99 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 100 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 101 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 102 | 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 | Metagenome | Rhizosphere |
| 103 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 104 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028036 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 | Metagenome | Rhizosphere |
| 152 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 155 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 156 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 157 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 158 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 159 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 160 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 161 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 162 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 163 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 164 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 165 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 166 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 167 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 168 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 169 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 170 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 171 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 172 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 173 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 174 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 175 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 176 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 177 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 178 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 179 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 180 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 181 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 182 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 183 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 184 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 185 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 186 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 187 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 188 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 189 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 190 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 191 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 192 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 193 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 194 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 195 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 196 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 197 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 198 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 199 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 200 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 230 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 231 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 232 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 233 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 234 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 235 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 236 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 237 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 238 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 239 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 240 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 241 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 242 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 243 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 244 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 245 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 252 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 253 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 254 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 255 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 259 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 260 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 261 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 262 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 263 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 264 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 265 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 266 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 267 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 268 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.12 |
| Metatranscriptomes | 2.74 |
| Isolates | 0.14 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.14 |
| Nodule | 0 |
| Rhizoplane | 4.79 |
| Rhizosphere | 93.29 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.78 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0058863_10104695 | 3300004799 | Bacteria | 973 |
| 2 | Ga0058861_10097431 | 3300004800 | Bacteria | 656 |
| 3 | Ga0058862_10156525 | 3300004803 | Bacteria | 2374 |
| 4 | Ga0058862_12488943 | 3300004803 | Bacteria | 750 |
| 5 | Ga0058862_12769646 | 3300004803 | Bacteria | 838 |
| 6 | Ga0058862_12820602 | 3300004803 | Bacteria | 838 |
| 7 | Ga0065714_10251664 | 3300005288 | Bacteria | 774 |
| 8 | Ga0065712_10023735 | 3300005290 | Bacteria | 1687 |
| 9 | Ga0065715_10231730 | 3300005293 | Unclassified | 1231 |
| 10 | Ga0070658_10000021 | 3300005327 | Bacteria | 187218 |
| 11 | Ga0070658_10001527 | 3300005327 | Bacteria | 19609 |
| 12 | Ga0070658_10005185 | 3300005327 | Bacteria | 10604 |
| 13 | Ga0070658_10016209 | 3300005327 | Bacteria | 5962 |
| 14 | Ga0070658_10016628 | 3300005327 | Bacteria | 5887 |
| 15 | Ga0070658_10426595 | 3300005327 | Unclassified | 1141 |
| 16 | Ga0070658_10539021 | 3300005327 | Bacteria | 1010 |
| 17 | Ga0070658_11143292 | 3300005327 | Bacteria | 677 |
| 18 | Ga0070658_11313985 | 3300005327 | Unclassified | 628 |
| 19 | Ga0070658_11377893 | 3300005327 | Bacteria | 612 |
| 20 | Ga0070658_11720594 | 3300005327 | Bacteria | 543 |
| 21 | Ga0070683_100059316 | 3300005329 | Bacteria | 3555 |
| 22 | Ga0070683_100122154 | 3300005329 | Bacteria | 2461 |
| 23 | Ga0070683_100128876 | 3300005329 | Bacteria | 2393 |
| 24 | Ga0070683_101138144 | 3300005329 | Bacteria | 750 |
| 25 | Ga0070683_101626501 | 3300005329 | Bacteria | 621 |
| 26 | Ga0070670_100026689 | 3300005331 | Bacteria | 4969 |
| 27 | Ga0068869_101052533 | 3300005334 | Bacteria | 710 |
| 28 | Ga0070680_100024410 | 3300005336 | Bacteria | 4829 |
| 29 | Ga0070680_100131229 | 3300005336 | Bacteria | 2096 |
| 30 | Ga0070680_100184279 | 3300005336 | Bacteria | 1758 |
| 31 | Ga0070680_100201115 | 3300005336 | Bacteria | 1680 |
| 32 | Ga0070680_100258121 | 3300005336 | Bacteria | 1474 |
| 33 | Ga0070680_101192435 | 3300005336 | Bacteria | 658 |
| 34 | Ga0070680_101928400 | 3300005336 | Bacteria | 512 |
| 35 | Ga0070682_100437889 | 3300005337 | Bacteria | 998 |
| 36 | Ga0070682_100703318 | 3300005337 | Bacteria | 811 |
| 37 | Ga0070682_101224273 | 3300005337 | Bacteria | 635 |
| 38 | Ga0068868_100066148 | 3300005338 | Bacteria | 2873 |
| 39 | Ga0068868_100981898 | 3300005338 | Bacteria | 772 |
| 40 | Ga0070660_100021869 | 3300005339 | Bacteria | 4723 |
| 41 | Ga0070660_100052804 | 3300005339 | Bacteria | 3134 |
| 42 | Ga0070660_100053595 | 3300005339 | Bacteria | 3112 |
| 43 | Ga0070660_100067592 | 3300005339 | Bacteria | 2784 |
| 44 | Ga0070689_100284828 | 3300005340 | Bacteria | 1372 |
| 45 | Ga0070691_10283669 | 3300005341 | Bacteria | 899 |
| 46 | Ga0070691_10644028 | 3300005341 | Bacteria | 630 |
| 47 | Ga0070661_100060557 | 3300005344 | Bacteria | 2778 |
| 48 | Ga0070661_100103803 | 3300005344 | Bacteria | 2117 |
| 49 | Ga0070661_100361545 | 3300005344 | Bacteria | 1141 |
| 50 | Ga0070661_101186183 | 3300005344 | Bacteria | 638 |
| 51 | Ga0070661_101304786 | 3300005344 | Bacteria | 609 |
| 52 | Ga0070661_101782562 | 3300005344 | Bacteria | 522 |
| 53 | Ga0070692_10319022 | 3300005345 | Bacteria | 955 |
| 54 | Ga0070675_100697949 | 3300005354 | Bacteria | 924 |
| 55 | Ga0070673_100492715 | 3300005364 | Bacteria | 1107 |
| 56 | Ga0070688_100175746 | 3300005365 | Bacteria | 1481 |
| 57 | Ga0070659_100015290 | 3300005366 | Bacteria | 5746 |
| 58 | Ga0070659_100028416 | 3300005366 | Bacteria | 4319 |
| 59 | Ga0070659_100036562 | 3300005366 | Bacteria | 3828 |
| 60 | Ga0070659_102157780 | 3300005366 | Bacteria | 501 |
| 61 | Ga0070709_10034508 | 3300005434 | Bacteria | 3068 |
| 62 | Ga0070709_10059863 | 3300005434 | Bacteria | 2419 |
| 63 | Ga0070709_10182778 | 3300005434 | Bacteria | 1474 |
| 64 | Ga0070709_10266496 | 3300005434 | Bacteria | 1240 |
| 65 | Ga0070709_10935559 | 3300005434 | Bacteria | 687 |
| 66 | Ga0070709_11365834 | 3300005434 | Bacteria | 573 |
| 67 | Ga0070714_100055894 | 3300005435 | Bacteria | 3374 |
| 68 | Ga0070714_100145658 | 3300005435 | Bacteria | 2130 |
| 69 | Ga0070714_100159821 | 3300005435 | Bacteria | 2038 |
| 70 | Ga0070714_100517737 | 3300005435 | Bacteria | 1139 |
| 71 | Ga0070714_100779067 | 3300005435 | Bacteria | 925 |
| 72 | Ga0070714_100826219 | 3300005435 | Bacteria | 898 |
| 73 | Ga0070714_100999944 | 3300005435 | Bacteria | 814 |
| 74 | Ga0070713_100045457 | 3300005436 | Bacteria | 3598 |
| 75 | Ga0070713_100236696 | 3300005436 | Bacteria | 1661 |
| 76 | Ga0070713_100501452 | 3300005436 | Bacteria | 1145 |
| 77 | Ga0070713_101019634 | 3300005436 | Bacteria | 799 |
| 78 | Ga0070710_10039958 | 3300005437 | Bacteria | 2583 |
| 79 | Ga0070710_10400625 | 3300005437 | Bacteria | 920 |
| 80 | Ga0070711_100030675 | 3300005439 | Bacteria | 3562 |
| 81 | Ga0070711_100124377 | 3300005439 | Bacteria | 1913 |
| 82 | Ga0070711_100671184 | 3300005439 | Bacteria | 870 |
| 83 | Ga0070711_100988385 | 3300005439 | Bacteria | 721 |
| 84 | Ga0070711_101068061 | 3300005439 | Bacteria | 695 |
| 85 | Ga0070711_101399606 | 3300005439 | Bacteria | 609 |
| 86 | Ga0070708_100123940 | 3300005445 | Bacteria | 2386 |
| 87 | Ga0070663_100027550 | 3300005455 | Bacteria | 3860 |
| 88 | Ga0070663_100146109 | 3300005455 | Bacteria | 1809 |
| 89 | Ga0070663_100313252 | 3300005455 | Bacteria | 1260 |
| 90 | Ga0070678_100246023 | 3300005456 | Bacteria | 1497 |
| 91 | Ga0070678_101258375 | 3300005456 | Bacteria | 687 |
| 92 | Ga0070662_101207400 | 3300005457 | Bacteria | 650 |
| 93 | Ga0070681_10018593 | 3300005458 | Bacteria | 6948 |
| 94 | Ga0070681_10077780 | 3300005458 | Bacteria | 3274 |
| 95 | Ga0070681_10505586 | 3300005458 | Bacteria | 1122 |
| 96 | Ga0070681_10761946 | 3300005458 | Bacteria | 885 |
| 97 | Ga0070681_10877499 | 3300005458 | Bacteria | 815 |
| 98 | Ga0070681_10929653 | 3300005458 | Bacteria | 788 |
| 99 | Ga0068867_100091597 | 3300005459 | Bacteria | 2308 |
| 100 | Ga0070685_10222409 | 3300005466 | Bacteria | 1238 |
| 101 | Ga0070699_101132454 | 3300005518 | Bacteria | 718 |
| 102 | Ga0070679_100019150 | 3300005530 | Bacteria | 6651 |
| 103 | Ga0070679_100048098 | 3300005530 | Bacteria | 4250 |
| 104 | Ga0070679_100060065 | 3300005530 | Bacteria | 3789 |
| 105 | Ga0070679_100260398 | 3300005530 | Bacteria | 1690 |
| 106 | Ga0070679_100336113 | 3300005530 | Bacteria | 1459 |
| 107 | Ga0070679_100364957 | 3300005530 | Bacteria | 1391 |
| 108 | Ga0070679_100447533 | 3300005530 | Bacteria | 1236 |
| 109 | Ga0070679_101041294 | 3300005530 | Bacteria | 763 |
| 110 | Ga0070684_100055613 | 3300005535 | Bacteria | 3451 |
| 111 | Ga0070684_100137182 | 3300005535 | Bacteria | 2210 |
| 112 | Ga0070684_100343930 | 3300005535 | Bacteria | 1371 |
| 113 | Ga0070684_100460762 | 3300005535 | Bacteria | 1175 |
| 114 | Ga0070684_101116119 | 3300005535 | Bacteria | 741 |
| 115 | Ga0070684_102195285 | 3300005535 | Bacteria | 521 |
| 116 | Ga0070697_100001009 | 3300005536 | Bacteria | 21253 |
| 117 | Ga0068853_100000039 | 3300005539 | Bacteria | 107039 |
| 118 | Ga0068853_100111405 | 3300005539 | Bacteria | 2431 |
| 119 | Ga0068853_100120740 | 3300005539 | Bacteria | 2337 |
| 120 | Ga0068853_100157725 | 3300005539 | Bacteria | 2045 |
| 121 | Ga0068853_100163808 | 3300005539 | Bacteria | 2008 |
| 122 | Ga0068853_101151329 | 3300005539 | Bacteria | 748 |
| 123 | Ga0070695_100035311 | 3300005545 | Bacteria | 3140 |
| 124 | Ga0070696_100046106 | 3300005546 | Bacteria | 3022 |
| 125 | Ga0070696_100232963 | 3300005546 | Bacteria | 1386 |
| 126 | Ga0070693_100038736 | 3300005547 | Bacteria | 2666 |
| 127 | Ga0070693_100064127 | 3300005547 | Bacteria | 2143 |
| 128 | Ga0070693_100179659 | 3300005547 | Bacteria | 1362 |
| 129 | Ga0070693_100199901 | 3300005547 | Bacteria | 1297 |
| 130 | Ga0070693_101319079 | 3300005547 | Bacteria | 558 |
| 131 | Ga0070704_100236821 | 3300005549 | Bacteria | 1492 |
| 132 | Ga0068855_100002031 | 3300005563 | Bacteria | 25100 |
| 133 | Ga0068855_100002974 | 3300005563 | Bacteria | 20712 |
| 134 | Ga0068855_100025783 | 3300005563 | Bacteria | 7030 |
| 135 | Ga0068855_100036159 | 3300005563 | Bacteria | 5880 |
| 136 | Ga0068855_100233982 | 3300005563 | Bacteria | 2055 |
| 137 | Ga0068855_100286687 | 3300005563 | Bacteria | 1826 |
| 138 | Ga0068855_100308385 | 3300005563 | Bacteria | 1752 |
| 139 | Ga0068855_100370291 | 3300005563 | Bacteria | 1575 |
| 140 | Ga0068855_100447150 | 3300005563 | Bacteria | 1411 |
| 141 | Ga0068855_100461662 | 3300005563 | Bacteria | 1385 |
| 142 | Ga0068855_100911847 | 3300005563 | Bacteria | 928 |
| 143 | Ga0070664_100048410 | 3300005564 | Bacteria | 3593 |
| 144 | Ga0070664_101169579 | 3300005564 | Bacteria | 725 |
| 145 | Ga0070664_101274390 | 3300005564 | Bacteria | 694 |
| 146 | Ga0070664_101553023 | 3300005564 | Bacteria | 627 |
| 147 | Ga0068857_100018918 | 3300005577 | Bacteria | 6043 |
| 148 | Ga0068857_100039759 | 3300005577 | Bacteria | 4168 |
| 149 | Ga0068857_100109110 | 3300005577 | Bacteria | 2487 |
| 150 | Ga0068857_100251604 | 3300005577 | Bacteria | 1620 |
| 151 | Ga0068854_100000258 | 3300005578 | Bacteria | 36173 |
| 152 | Ga0068854_100019073 | 3300005578 | Bacteria | 4615 |
| 153 | Ga0068854_100578405 | 3300005578 | Bacteria | 956 |
| 154 | Ga0068854_100875244 | 3300005578 | Bacteria | 788 |
| 155 | Ga0068854_101840410 | 3300005578 | Bacteria | 556 |
| 156 | Ga0068856_100048619 | 3300005614 | Bacteria | 4181 |
| 157 | Ga0068856_100076571 | 3300005614 | Bacteria | 3314 |
| 158 | Ga0068856_100453182 | 3300005614 | Bacteria | 1304 |
| 159 | Ga0068856_100458801 | 3300005614 | Bacteria | 1295 |
| 160 | Ga0068856_102250687 | 3300005614 | Bacteria | 554 |
| 161 | Ga0068852_100062115 | 3300005616 | Bacteria | 3248 |
| 162 | Ga0068852_100086378 | 3300005616 | Bacteria | 2796 |
| 163 | Ga0068852_100145658 | 3300005616 | Bacteria | 2197 |
| 164 | Ga0068852_100147364 | 3300005616 | Bacteria | 2185 |
| 165 | Ga0068852_100165953 | 3300005616 | Bacteria | 2066 |
| 166 | Ga0068852_100186916 | 3300005616 | Bacteria | 1952 |
| 167 | Ga0068852_102607847 | 3300005616 | Bacteria | 525 |
| 168 | Ga0068859_101175738 | 3300005617 | Bacteria | 845 |
| 169 | Ga0068859_101822634 | 3300005617 | Bacteria | 672 |
| 170 | Ga0068864_102357524 | 3300005618 | Bacteria | 539 |
| 171 | Ga0068866_10415730 | 3300005718 | Bacteria | 871 |
| 172 | Ga0068866_11452197 | 3300005718 | Bacteria | 503 |
| 173 | Ga0068858_102330429 | 3300005842 | Bacteria | 529 |
| 174 | Ga0068860_100782660 | 3300005843 | Bacteria | 967 |
| 175 | Ga0068862_102744309 | 3300005844 | Unclassified | 504 |
| 176 | Ga0070717_10050882 | 3300006028 | Bacteria | 3407 |
| 177 | Ga0070717_10145393 | 3300006028 | Bacteria | 2048 |
| 178 | Ga0070717_10163768 | 3300006028 | Bacteria | 1931 |
| 179 | Ga0070717_10463503 | 3300006028 | Bacteria | 1143 |
| 180 | Ga0070717_10915045 | 3300006028 | Bacteria | 798 |
| 181 | Ga0070717_11042856 | 3300006028 | Bacteria | 745 |
| 182 | Ga0070717_11366423 | 3300006028 | Bacteria | 643 |
| 183 | Ga0070717_11551897 | 3300006028 | Unclassified | 600 |
| 184 | Ga0070715_10142822 | 3300006163 | Bacteria | 1165 |
| 185 | Ga0070715_10596827 | 3300006163 | Bacteria | 647 |
| 186 | Ga0070716_101156678 | 3300006173 | Bacteria | 619 |
| 187 | Ga0070716_101648856 | 3300006173 | Bacteria | 528 |
| 188 | Ga0070712_100081304 | 3300006175 | Bacteria | 2347 |
| 189 | Ga0070712_100126921 | 3300006175 | Bacteria | 1928 |
| 190 | Ga0070712_100507658 | 3300006175 | Bacteria | 1011 |
| 191 | Ga0070712_101002961 | 3300006175 | Bacteria | 723 |
| 192 | Ga0097621_100052895 | 3300006237 | Bacteria | 3309 |
| 193 | Ga0075433_10000204 | 3300006852 | Bacteria | 33250 |
| 194 | Ga0075434_100000356 | 3300006871 | Bacteria | 33159 |
| 195 | Ga0075434_101514182 | 3300006871 | Bacteria | 680 |
| 196 | Ga0068865_100225776 | 3300006881 | Bacteria | 1466 |
| 197 | Ga0075436_100013552 | 3300006914 | Bacteria | 5584 |
| 198 | Ga0075436_100035059 | 3300006914 | Bacteria | 3461 |
| 199 | Ga0075436_100193672 | 3300006914 | Bacteria | 1439 |
| 200 | Ga0097620_101175714 | 3300006931 | Bacteria | 845 |
| 201 | Ga0097620_101822995 | 3300006931 | Bacteria | 672 |
| 202 | Ga0075435_100001266 | 3300007076 | Bacteria | 16211 |
| 203 | Ga0075435_100109271 | 3300007076 | Bacteria | 2298 |
| 204 | Ga0075435_100863114 | 3300007076 | Bacteria | 789 |
| 205 | Ga0075435_101381666 | 3300007076 | Bacteria | 617 |
| 206 | Ga0099795_10595412 | 3300007788 | Bacteria | 526 |
| 207 | Ga0105240_10002452 | 3300009093 | Bacteria | 29804 |
| 208 | Ga0105240_10006173 | 3300009093 | Bacteria | 17661 |
| 209 | Ga0105240_10038871 | 3300009093 | Bacteria | 6100 |
| 210 | Ga0105240_10139712 | 3300009093 | Bacteria | 2897 |
| 211 | Ga0105240_10189018 | 3300009093 | Bacteria | 2423 |
| 212 | Ga0105240_10274102 | 3300009093 | Bacteria | 1941 |
| 213 | Ga0105240_10354494 | 3300009093 | Bacteria | 1664 |
| 214 | Ga0105240_10482419 | 3300009093 | Bacteria | 1382 |
| 215 | Ga0105240_10516923 | 3300009093 | Bacteria | 1325 |
| 216 | Ga0105240_11282757 | 3300009093 | Bacteria | 773 |
| 217 | Ga0105240_11329094 | 3300009093 | Bacteria | 757 |
| 218 | Ga0105240_11357719 | 3300009093 | Bacteria | 748 |
| 219 | Ga0105245_10010071 | 3300009098 | Bacteria | 8237 |
| 220 | Ga0105245_10098320 | 3300009098 | Bacteria | 2704 |
| 221 | Ga0105247_10242747 | 3300009101 | Bacteria | 1228 |
| 222 | Ga0114129_10237997 | 3300009147 | Bacteria | 2448 |
| 223 | Ga0105241_10069755 | 3300009174 | Bacteria | 2726 |
| 224 | Ga0105241_10258877 | 3300009174 | Bacteria | 1478 |
| 225 | Ga0105241_10403098 | 3300009174 | Bacteria | 1200 |
| 226 | Ga0105241_10555164 | 3300009174 | Bacteria | 1032 |
| 227 | Ga0105241_11716209 | 3300009174 | Bacteria | 610 |
| 228 | Ga0105242_10080073 | 3300009176 | Bacteria | 2729 |
| 229 | Ga0105242_10379835 | 3300009176 | Bacteria | 1313 |
| 230 | Ga0105248_10164155 | 3300009177 | Bacteria | 2504 |
| 231 | Ga0105248_11353131 | 3300009177 | Bacteria | 805 |
| 232 | Ga0105237_10085926 | 3300009545 | Bacteria | 3136 |
| 233 | Ga0105237_10136511 | 3300009545 | Bacteria | 2447 |
| 234 | Ga0105237_10976396 | 3300009545 | Bacteria | 854 |
| 235 | Ga0105237_11097414 | 3300009545 | Bacteria | 802 |
| 236 | Ga0105238_10043634 | 3300009551 | Bacteria | 4537 |
| 237 | Ga0105238_10049681 | 3300009551 | Bacteria | 4223 |
| 238 | Ga0105238_10082207 | 3300009551 | Bacteria | 3211 |
| 239 | Ga0105238_10180185 | 3300009551 | Bacteria | 2090 |
| 240 | Ga0105238_10280111 | 3300009551 | Bacteria | 1649 |
| 241 | Ga0105238_10416522 | 3300009551 | Bacteria | 1338 |
| 242 | Ga0105238_10569902 | 3300009551 | Bacteria | 1138 |
| 243 | Ga0105238_10722674 | 3300009551 | Bacteria | 1009 |
| 244 | Ga0105238_11118620 | 3300009551 | Bacteria | 811 |
| 245 | Ga0105238_12155571 | 3300009551 | Bacteria | 592 |
| 246 | Ga0105249_11480188 | 3300009553 | Bacteria | 751 |
| 247 | Ga0105239_10235564 | 3300010375 | Bacteria | 2054 |
| 248 | Ga0105239_10376655 | 3300010375 | Bacteria | 1604 |
| 249 | Ga0105239_10580574 | 3300010375 | Bacteria | 1278 |
| 250 | Ga0105239_10733870 | 3300010375 | Bacteria | 1130 |
| 251 | Ga0105239_11018909 | 3300010375 | Bacteria | 952 |
| 252 | Ga0105239_11210750 | 3300010375 | Unclassified | 870 |
| 253 | Ga0157373_10035887 | 3300013100 | Bacteria | 3559 |
| 254 | Ga0157373_10242595 | 3300013100 | Bacteria | 1274 |
| 255 | Ga0157371_10506917 | 3300013102 | Bacteria | 891 |
| 256 | Ga0157371_11446277 | 3300013102 | Bacteria | 535 |
| 257 | Ga0157370_10016641 | 3300013104 | Bacteria | 7440 |
| 258 | Ga0157370_10037753 | 3300013104 | Bacteria | 4679 |
| 259 | Ga0157370_10039723 | 3300013104 | Bacteria | 4546 |
| 260 | Ga0157370_10040309 | 3300013104 | Bacteria | 4509 |
| 261 | Ga0157370_10136036 | 3300013104 | Bacteria | 2290 |
| 262 | Ga0157370_10416994 | 3300013104 | Bacteria | 1235 |
| 263 | Ga0157370_10482660 | 3300013104 | Bacteria | 1139 |
| 264 | Ga0157370_10530042 | 3300013104 | Bacteria | 1080 |
| 265 | Ga0157370_11106298 | 3300013104 | Bacteria | 716 |
| 266 | Ga0157370_11328794 | 3300013104 | Bacteria | 647 |
| 267 | Ga0157370_11579951 | 3300013104 | Bacteria | 589 |
| 268 | Ga0157369_10016136 | 3300013105 | Bacteria | 8407 |
| 269 | Ga0157369_10049348 | 3300013105 | Bacteria | 4563 |
| 270 | Ga0157369_10050583 | 3300013105 | Bacteria | 4500 |
| 271 | Ga0157369_10134997 | 3300013105 | Bacteria | 2613 |
| 272 | Ga0157369_10141538 | 3300013105 | Bacteria | 2545 |
| 273 | Ga0157369_10206775 | 3300013105 | Bacteria | 2058 |
| 274 | Ga0157369_10234269 | 3300013105 | Bacteria | 1919 |
| 275 | Ga0157369_10315653 | 3300013105 | Bacteria | 1625 |
| 276 | Ga0157369_10748137 | 3300013105 | Bacteria | 1006 |
| 277 | Ga0157369_10756414 | 3300013105 | Bacteria | 999 |
| 278 | Ga0157369_11120341 | 3300013105 | Bacteria | 804 |
| 279 | Ga0157369_11468977 | 3300013105 | Bacteria | 694 |
| 280 | Ga0157369_12607401 | 3300013105 | Bacteria | 511 |
| 281 | Ga0157374_10222173 | 3300013296 | Bacteria | 1854 |
| 282 | Ga0157374_10234187 | 3300013296 | Bacteria | 1805 |
| 283 | Ga0157374_10266885 | 3300013296 | Bacteria | 1687 |
| 284 | Ga0157374_10330445 | 3300013296 | Bacteria | 1512 |
| 285 | Ga0157374_10484919 | 3300013296 | Bacteria | 1240 |
| 286 | Ga0157374_10841260 | 3300013296 | Bacteria | 934 |
| 287 | Ga0157378_10150600 | 3300013297 | Bacteria | 2167 |
| 288 | Ga0157378_10980765 | 3300013297 | Bacteria | 879 |
| 289 | Ga0163162_10703002 | 3300013306 | Bacteria | 1132 |
| 290 | Ga0163162_11222473 | 3300013306 | Bacteria | 853 |
| 291 | Ga0157372_10016591 | 3300013307 | Bacteria | 7902 |
| 292 | Ga0157372_10059678 | 3300013307 | Bacteria | 4267 |
| 293 | Ga0157372_10068956 | 3300013307 | Bacteria | 3977 |
| 294 | Ga0157372_10084718 | 3300013307 | Bacteria | 3593 |
| 295 | Ga0157372_10103770 | 3300013307 | Bacteria | 3249 |
| 296 | Ga0157372_10166798 | 3300013307 | Bacteria | 2547 |
| 297 | Ga0157372_10647794 | 3300013307 | Bacteria | 1230 |
| 298 | Ga0157372_11496441 | 3300013307 | Bacteria | 778 |
| 299 | Ga0157372_11935923 | 3300013307 | Bacteria | 678 |
| 300 | Ga0163163_10017684 | 3300014325 | Bacteria | 6656 |
| 301 | Ga0163163_10433771 | 3300014325 | Bacteria | 1373 |
| 302 | Ga0157380_10005417 | 3300014326 | Bacteria | 8912 |
| 303 | Ga0157377_10261030 | 3300014745 | Bacteria | 1127 |
| 304 | Ga0157377_10636004 | 3300014745 | Bacteria | 766 |
| 305 | Ga0157379_10000835 | 3300014968 | Bacteria | 24925 |
| 306 | Ga0157376_11433499 | 3300014969 | Bacteria | 723 |
| 307 | Ga0157376_13045567 | 3300014969 | Bacteria | 507 |
| 308 | Ga0157376_13088103 | 3300014969 | Bacteria | 504 |
| 309 | Ga0197907_11266770 | 3300020069 | Bacteria | 679 |
| 310 | Ga0206356_11352823 | 3300020070 | Bacteria | 1090 |
| 311 | Ga0154015_1176295 | 3300020610 | Bacteria | 2832 |
| 312 | Ga0213873_10004918 | 3300021358 | Bacteria | 2525 |
| 313 | Ga0213872_10005723 | 3300021361 | Bacteria | 6330 |
| 314 | Ga0213872_10076671 | 3300021361 | Bacteria | 1503 |
| 315 | Ga0213872_10096967 | 3300021361 | Bacteria | 1316 |
| 316 | Ga0213874_10045098 | 3300021377 | Bacteria | 1334 |
| 317 | Ga0213876_10221330 | 3300021384 | Bacteria | 1006 |
| 318 | Ga0213871_10007347 | 3300021441 | Bacteria | 2378 |
| 319 | Ga0213871_10078938 | 3300021441 | Bacteria | 940 |
| 320 | Ga0224712_10065096 | 3300022467 | Bacteria | 1464 |
| 321 | Ga0224712_10277358 | 3300022467 | Bacteria | 780 |
| 322 | Ga0224569_100853 | 3300022732 | Bacteria | 2579 |
| 323 | Ga0228598_1001012 | 3300024227 | Bacteria | 6154 |
| 324 | Ga0209233_1027448 | 3300025261 | Bacteria | 1379 |
| 325 | Ga0207692_10117801 | 3300025898 | Bacteria | 1483 |
| 326 | Ga0207642_10342227 | 3300025899 | Bacteria | 880 |
| 327 | Ga0207688_10906671 | 3300025901 | Bacteria | 558 |
| 328 | Ga0207647_10001986 | 3300025904 | Bacteria | 15638 |
| 329 | Ga0207647_10052108 | 3300025904 | Bacteria | 2527 |
| 330 | Ga0207685_10176170 | 3300025905 | Bacteria | 988 |
| 331 | Ga0207699_10113868 | 3300025906 | Bacteria | 1738 |
| 332 | Ga0207699_10309416 | 3300025906 | Bacteria | 1105 |
| 333 | Ga0207699_10698099 | 3300025906 | Bacteria | 743 |
| 334 | Ga0207705_10000041 | 3300025909 | Bacteria | 183375 |
| 335 | Ga0207705_10001724 | 3300025909 | Bacteria | 17347 |
| 336 | Ga0207705_10002780 | 3300025909 | Bacteria | 13376 |
| 337 | Ga0207705_10004200 | 3300025909 | Bacteria | 10926 |
| 338 | Ga0207705_10009906 | 3300025909 | Bacteria | 6939 |
| 339 | Ga0207705_10013162 | 3300025909 | Bacteria | 5970 |
| 340 | Ga0207705_10301948 | 3300025909 | Bacteria | 1228 |
| 341 | Ga0207705_10687362 | 3300025909 | Bacteria | 795 |
| 342 | Ga0207705_10824445 | 3300025909 | Bacteria | 720 |
| 343 | Ga0207654_10352879 | 3300025911 | Bacteria | 1013 |
| 344 | Ga0207707_10015609 | 3300025912 | Bacteria | 6616 |
| 345 | Ga0207707_10156504 | 3300025912 | Bacteria | 1993 |
| 346 | Ga0207707_10201765 | 3300025912 | Bacteria | 1734 |
| 347 | Ga0207707_10211228 | 3300025912 | Bacteria | 1690 |
| 348 | Ga0207707_10224070 | 3300025912 | Bacteria | 1637 |
| 349 | Ga0207707_10708025 | 3300025912 | Bacteria | 845 |
| 350 | Ga0207707_10925611 | 3300025912 | Bacteria | 719 |
| 351 | Ga0207695_10000589 | 3300025913 | Bacteria | 73210 |
| 352 | Ga0207695_10013166 | 3300025913 | Bacteria | 9871 |
| 353 | Ga0207695_10026761 | 3300025913 | Bacteria | 6432 |
| 354 | Ga0207695_10037654 | 3300025913 | Bacteria | 5217 |
| 355 | Ga0207695_10044746 | 3300025913 | Bacteria | 4706 |
| 356 | Ga0207695_10279162 | 3300025913 | Bacteria | 1564 |
| 357 | Ga0207695_10327109 | 3300025913 | Bacteria | 1422 |
| 358 | Ga0207695_10660590 | 3300025913 | Bacteria | 926 |
| 359 | Ga0207695_10756816 | 3300025913 | Bacteria | 852 |
| 360 | Ga0207695_10902404 | 3300025913 | Bacteria | 763 |
| 361 | Ga0207671_10096424 | 3300025914 | Bacteria | 2235 |
| 362 | Ga0207671_10363413 | 3300025914 | Bacteria | 1149 |
| 363 | Ga0207693_10018113 | 3300025915 | Bacteria | 5612 |
| 364 | Ga0207693_10018216 | 3300025915 | Bacteria | 5594 |
| 365 | Ga0207693_10087302 | 3300025915 | Bacteria | 2444 |
| 366 | Ga0207693_11038205 | 3300025915 | Bacteria | 625 |
| 367 | Ga0207693_11347948 | 3300025915 | Bacteria | 532 |
| 368 | Ga0207663_10045568 | 3300025916 | Bacteria | 2698 |
| 369 | Ga0207663_10281030 | 3300025916 | Bacteria | 1236 |
| 370 | Ga0207663_10369799 | 3300025916 | Bacteria | 1090 |
| 371 | Ga0207663_10776581 | 3300025916 | Bacteria | 762 |
| 372 | Ga0207663_10782463 | 3300025916 | Bacteria | 759 |
| 373 | Ga0207663_10882056 | 3300025916 | Bacteria | 715 |
| 374 | Ga0207663_11353112 | 3300025916 | Bacteria | 573 |
| 375 | Ga0207660_10000965 | 3300025917 | Bacteria | 19025 |
| 376 | Ga0207660_10079653 | 3300025917 | Bacteria | 2403 |
| 377 | Ga0207660_10152967 | 3300025917 | Bacteria | 1774 |
| 378 | Ga0207660_10258846 | 3300025917 | Bacteria | 1375 |
| 379 | Ga0207660_10281279 | 3300025917 | Bacteria | 1320 |
| 380 | Ga0207660_10804244 | 3300025917 | Bacteria | 767 |
| 381 | Ga0207657_10022317 | 3300025919 | Bacteria | 5926 |
| 382 | Ga0207657_10027462 | 3300025919 | Bacteria | 5212 |
| 383 | Ga0207657_10040613 | 3300025919 | Bacteria | 4120 |
| 384 | Ga0207657_10791997 | 3300025919 | Bacteria | 733 |
| 385 | Ga0207657_11156524 | 3300025919 | Bacteria | 590 |
| 386 | Ga0207649_10077225 | 3300025920 | Bacteria | 2145 |
| 387 | Ga0207649_10797304 | 3300025920 | Bacteria | 737 |
| 388 | Ga0207652_10001244 | 3300025921 | Bacteria | 22728 |
| 389 | Ga0207652_10003556 | 3300025921 | Bacteria | 12862 |
| 390 | Ga0207652_10057634 | 3300025921 | Bacteria | 3346 |
| 391 | Ga0207652_10407811 | 3300025921 | Bacteria | 1226 |
| 392 | Ga0207652_10447020 | 3300025921 | Bacteria | 1165 |
| 393 | Ga0207652_10610633 | 3300025921 | Bacteria | 977 |
| 394 | Ga0207652_10714987 | 3300025921 | Bacteria | 893 |
| 395 | Ga0207694_10032945 | 3300025924 | Bacteria | 3969 |
| 396 | Ga0207694_10132933 | 3300025924 | Bacteria | 1995 |
| 397 | Ga0207694_10135872 | 3300025924 | Bacteria | 1975 |
| 398 | Ga0207694_10253981 | 3300025924 | Bacteria | 1439 |
| 399 | Ga0207694_10430026 | 3300025924 | Bacteria | 1100 |
| 400 | Ga0207694_10941615 | 3300025924 | Bacteria | 731 |
| 401 | Ga0207650_10035262 | 3300025925 | Bacteria | 3631 |
| 402 | Ga0207659_11182232 | 3300025926 | Bacteria | 658 |
| 403 | Ga0207687_10005215 | 3300025927 | Bacteria | 8616 |
| 404 | Ga0207700_10190948 | 3300025928 | Bacteria | 1721 |
| 405 | Ga0207700_10351223 | 3300025928 | Bacteria | 1284 |
| 406 | Ga0207700_10621500 | 3300025928 | Bacteria | 962 |
| 407 | Ga0207700_10772005 | 3300025928 | Bacteria | 859 |
| 408 | Ga0207700_11984593 | 3300025928 | Bacteria | 509 |
| 409 | Ga0207664_10119001 | 3300025929 | Bacteria | 2208 |
| 410 | Ga0207664_10158631 | 3300025929 | Bacteria | 1928 |
| 411 | Ga0207664_10224962 | 3300025929 | Bacteria | 1629 |
| 412 | Ga0207664_10564209 | 3300025929 | Bacteria | 1022 |
| 413 | Ga0207664_10939876 | 3300025929 | Bacteria | 776 |
| 414 | Ga0207664_11011735 | 3300025929 | Bacteria | 745 |
| 415 | Ga0207664_11460003 | 3300025929 | Bacteria | 605 |
| 416 | Ga0207690_10003497 | 3300025932 | Bacteria | 9367 |
| 417 | Ga0207690_10248307 | 3300025932 | Bacteria | 1373 |
| 418 | Ga0207706_10876269 | 3300025933 | Bacteria | 759 |
| 419 | Ga0207686_10217795 | 3300025934 | Bacteria | 1376 |
| 420 | Ga0207670_10357465 | 3300025936 | Bacteria | 1158 |
| 421 | Ga0207704_10352984 | 3300025938 | Bacteria | 1146 |
| 422 | Ga0207665_10067673 | 3300025939 | Bacteria | 2432 |
| 423 | Ga0207665_10366344 | 3300025939 | Bacteria | 1091 |
| 424 | Ga0207711_10344175 | 3300025941 | Bacteria | 1380 |
| 425 | Ga0207711_11013751 | 3300025941 | Bacteria | 770 |
| 426 | Ga0207689_10622950 | 3300025942 | Bacteria | 908 |
| 427 | Ga0207661_10050019 | 3300025944 | Bacteria | 3328 |
| 428 | Ga0207661_10129450 | 3300025944 | Bacteria | 2160 |
| 429 | Ga0207661_10324117 | 3300025944 | Bacteria | 1385 |
| 430 | Ga0207661_11512796 | 3300025944 | Bacteria | 615 |
| 431 | Ga0207679_10279713 | 3300025945 | Bacteria | 1431 |
| 432 | Ga0207679_10766613 | 3300025945 | Bacteria | 878 |
| 433 | Ga0207667_10005534 | 3300025949 | Bacteria | 15417 |
| 434 | Ga0207667_10008043 | 3300025949 | Bacteria | 12579 |
| 435 | Ga0207667_10010759 | 3300025949 | Bacteria | 10671 |
| 436 | Ga0207667_10053497 | 3300025949 | Bacteria | 4248 |
| 437 | Ga0207667_10088724 | 3300025949 | Bacteria | 3197 |
| 438 | Ga0207667_10092427 | 3300025949 | Bacteria | 3124 |
| 439 | Ga0207667_10154513 | 3300025949 | Bacteria | 2361 |
| 440 | Ga0207667_10269380 | 3300025949 | Bacteria | 1741 |
| 441 | Ga0207667_10403086 | 3300025949 | Bacteria | 1392 |
| 442 | Ga0207667_10430858 | 3300025949 | Bacteria | 1341 |
| 443 | Ga0207667_10607939 | 3300025949 | Bacteria | 1102 |
| 444 | Ga0207667_10661736 | 3300025949 | Bacteria | 1049 |
| 445 | Ga0207667_10744404 | 3300025949 | Bacteria | 980 |
| 446 | Ga0207651_11728096 | 3300025960 | Bacteria | 563 |
| 447 | Ga0207712_12102403 | 3300025961 | Bacteria | 505 |
| 448 | Ga0207640_10000001 | 3300025981 | Bacteria | 628778 |
| 449 | Ga0207640_10004201 | 3300025981 | Bacteria | 7791 |
| 450 | Ga0207640_10563998 | 3300025981 | Bacteria | 959 |
| 451 | Ga0207640_10617366 | 3300025981 | Bacteria | 920 |
| 452 | Ga0207677_10084935 | 3300026023 | Bacteria | 2283 |
| 453 | Ga0207677_11197681 | 3300026023 | Bacteria | 695 |
| 454 | Ga0207703_10787246 | 3300026035 | Bacteria | 907 |
| 455 | Ga0207703_11649394 | 3300026035 | Bacteria | 617 |
| 456 | Ga0207639_10000037 | 3300026041 | Bacteria | 147685 |
| 457 | Ga0207639_10011098 | 3300026041 | Bacteria | 6249 |
| 458 | Ga0207639_10030717 | 3300026041 | Bacteria | 3942 |
| 459 | Ga0207639_10061492 | 3300026041 | Bacteria | 2901 |
| 460 | Ga0207639_10285024 | 3300026041 | Bacteria | 1454 |
| 461 | Ga0207639_10429024 | 3300026041 | Bacteria | 1197 |
| 462 | Ga0207639_10592331 | 3300026041 | Bacteria | 1022 |
| 463 | Ga0207639_11640670 | 3300026041 | Bacteria | 603 |
| 464 | Ga0207678_10010929 | 3300026067 | Bacteria | 7976 |
| 465 | Ga0207678_10023442 | 3300026067 | Bacteria | 5398 |
| 466 | Ga0207678_10257773 | 3300026067 | Bacteria | 1494 |
| 467 | Ga0207678_10305222 | 3300026067 | Bacteria | 1368 |
| 468 | Ga0207678_10738146 | 3300026067 | Bacteria | 868 |
| 469 | Ga0207678_11532107 | 3300026067 | Bacteria | 588 |
| 470 | Ga0207702_10234117 | 3300026078 | Bacteria | 1718 |
| 471 | Ga0207702_10385027 | 3300026078 | Bacteria | 1349 |
| 472 | Ga0207702_10755123 | 3300026078 | Bacteria | 960 |
| 473 | Ga0207702_10819686 | 3300026078 | Bacteria | 920 |
| 474 | Ga0207702_10828202 | 3300026078 | Bacteria | 915 |
| 475 | Ga0207702_11059703 | 3300026078 | Bacteria | 804 |
| 476 | Ga0207702_11779850 | 3300026078 | Bacteria | 608 |
| 477 | Ga0207648_10763560 | 3300026089 | Bacteria | 898 |
| 478 | Ga0207648_10949003 | 3300026089 | Bacteria | 804 |
| 479 | Ga0207674_10027262 | 3300026116 | Bacteria | 6048 |
| 480 | Ga0207674_10036001 | 3300026116 | Bacteria | 5162 |
| 481 | Ga0207674_10046321 | 3300026116 | Bacteria | 4465 |
| 482 | Ga0207674_10163978 | 3300026116 | Bacteria | 2176 |
| 483 | Ga0207674_10420147 | 3300026116 | Bacteria | 1292 |
| 484 | Ga0207674_10678088 | 3300026116 | Bacteria | 995 |
| 485 | Ga0207698_10020962 | 3300026142 | Bacteria | 4511 |
| 486 | Ga0207698_10080306 | 3300026142 | Bacteria | 2627 |
| 487 | Ga0207698_10126407 | 3300026142 | Bacteria | 2175 |
| 488 | Ga0207698_10351268 | 3300026142 | Bacteria | 1393 |
| 489 | Ga0207698_10443043 | 3300026142 | Bacteria | 1252 |
| 490 | Ga0207698_10897807 | 3300026142 | Bacteria | 893 |
| 491 | Ga0207698_12067728 | 3300026142 | Bacteria | 583 |
| 492 | Ga0209969_1062259 | 3300027360 | Bacteria | 590 |
| 493 | Ga0265355_1002281 | 3300028036 | Bacteria | 1332 |
| 494 | Ga0268265_11684592 | 3300028380 | Unclassified | 640 |
| 495 | Ga0268264_11838371 | 3300028381 | Bacteria | 616 |
| 496 | Ga0268264_11897489 | 3300028381 | Bacteria | 605 |
| 497 | Ga0265338_10051809 | 3300028800 | Bacteria | 3691 |
| 498 | Ga0265338_10208577 | 3300028800 | Bacteria | 1468 |
| 499 | Ga0265340_10182324 | 3300031247 | Bacteria | 949 |
| 500 | Ga0265339_10203016 | 3300031249 | Bacteria | 977 |
| 501 | Ga0265331_10439788 | 3300031250 | Bacteria | 586 |
| 502 | Ga0316212_1030629 | 3300033547 | Bacteria | 756 |
| 503 | Ga0373950_0030479 | 3300034818 | Bacteria | 997 |
| 504 | Ga0373926_0020769 | 3300035083 | Bacteria | 2269 |
| 505 | Ga0373926_0336705 | 3300035083 | Bacteria | 591 |
| 506 | Ga0373949_0105218 | 3300035090 | Bacteria | 777 |
| 507 | Ga0373923_0200027 | 3300035111 | Bacteria | 923 |
| 508 | Ga0373923_0556468 | 3300035111 | Bacteria | 562 |
| 509 | Ga0373932_0210252 | 3300035112 | Bacteria | 695 |
| 510 | Ga0373936_0011212 | 3300035113 | Bacteria | 3389 |
| 511 | Ga0373936_0014935 | 3300035113 | Bacteria | 2973 |
| 512 | Ga0373936_0049089 | 3300035113 | Bacteria | 1704 |
| 513 | Ga0373945_0009361 | 3300035116 | Bacteria | 3209 |
| 514 | Ga0373956_0006894 | 3300035119 | Bacteria | 4562 |
| 515 | Ga0373957_0195161 | 3300035120 | Bacteria | 842 |
| 516 | Ga0373943_0017826 | 3300035170 | Bacteria | 3254 |
| 517 | Ga0373943_0035373 | 3300035170 | Bacteria | 2387 |
| 518 | Ga0373943_0194459 | 3300035170 | Bacteria | 1120 |
| 519 | Ga0373943_0695311 | 3300035170 | Bacteria | 602 |
| 520 | Ga0373946_0015210 | 3300035171 | Bacteria | 2914 |
| 521 | Ga0373946_0100458 | 3300035171 | Bacteria | 1296 |
| 522 | Ga0373946_0783322 | 3300035171 | Bacteria | 502 |
| 523 | Ga0373955_0031388 | 3300035172 | Bacteria | 2782 |
| 524 | Ga0373955_0174640 | 3300035172 | Bacteria | 1273 |
| 525 | Ga0373955_0233933 | 3300035172 | Bacteria | 1100 |
| 526 | Ga0373924_0000060 | 3300035410 | Bacteria | 28422 |
| 527 | Ga0373931_0079013 | 3300035691 | Bacteria | 1811 |
| 528 | Ga0373931_0210101 | 3300035691 | Bacteria | 1167 |
| 529 | Ga0373935_0041183 | 3300035692 | Bacteria | 2901 |
| 530 | Ga0373935_0055471 | 3300035692 | Bacteria | 2524 |
| 531 | Ga0373935_0298879 | 3300035692 | Bacteria | 1137 |
| 532 | Ga0373935_0488116 | 3300035692 | Bacteria | 893 |
| 533 | Ga0373927_0036557 | 3300035695 | Bacteria | 3193 |
| 534 | Ga0373927_0354037 | 3300035695 | Bacteria | 968 |
| 535 | Ga0373927_0930936 | 3300035695 | Bacteria | 573 |
| 536 | Ga0373933_0094755 | 3300035724 | Bacteria | 1846 |
| 537 | Ga0373933_0107629 | 3300035724 | Bacteria | 1736 |
| 538 | Ga0373933_0272169 | 3300035724 | Bacteria | 1093 |
| 539 | Ga0373933_0615076 | 3300035724 | Bacteria | 714 |
| 540 | Ga0373933_1007985 | 3300035724 | Bacteria | 548 |
| 541 | Ga0373947_0044018 | 3300035725 | Bacteria | 2667 |
| 542 | Ga0373947_0046455 | 3300035725 | Bacteria | 2600 |
| 543 | Ga0373947_0176418 | 3300035725 | Bacteria | 1389 |
| 544 | Ga0373937_0000178 | 3300036401 | Bacteria | 62323 |
| 545 | Ga0373937_0015152 | 3300036401 | Bacteria | 6812 |
| 546 | Ga0373937_0260590 | 3300036401 | Bacteria | 1635 |
| 547 | Ga0373937_0389091 | 3300036401 | Bacteria | 1323 |
| 548 | Ga0373937_0429299 | 3300036401 | Bacteria | 1254 |
| 549 | Ga0373937_0567197 | 3300036401 | Bacteria | 1078 |
| 550 | Ga0373937_0622375 | 3300036401 | Bacteria | 1024 |
| 551 | Ga0373937_0694329 | 3300036401 | Bacteria | 964 |
| 552 | Ga0373937_1135505 | 3300036401 | Bacteria | 730 |
| 553 | Ga0373937_1900870 | 3300036401 | Bacteria | 541 |
| 554 | Ga0373925_0019116 | 3300037068 | Bacteria | 4982 |
| 555 | Ga0373925_0148245 | 3300037068 | Bacteria | 1840 |
| 556 | Ga0373925_0589688 | 3300037068 | Bacteria | 915 |
| 557 | Ga0395898_0021558 | 3300037466 | Bacteria | 6532 |
| 558 | Ga0395898_0512024 | 3300037466 | Bacteria | 1141 |
| 559 | Ga0395905_0162410 | 3300037471 | Bacteria | 2099 |
| 560 | Ga0395905_0308161 | 3300037471 | Bacteria | 1472 |
| 561 | Ga0395901_1212610 | 3300038443 | Bacteria | 720 |
| 562 | Ga0436365_0002921 | 3300039437 | Bacteria | 686 |
| 563 | Ga0436365_1578341 | 3300039437 | Bacteria | 1286 |
| 564 | Ga0436360_0121414 | 3300039438 | Bacteria | 1091 |
| 565 | Ga0436360_0279180 | 3300039438 | Unclassified | 659 |
| 566 | Ga0436360_0746999 | 3300039438 | Bacteria | 7727 |
| 567 | Ga0436360_0975883 | 3300039438 | Bacteria | 4254 |
| 568 | Ga0436361_0661329 | 3300039447 | Bacteria | 904 |
| 569 | Ga0436361_0719701 | 3300039447 | Bacteria | 2567 |
| 570 | Ga0436361_0788453 | 3300039447 | Bacteria | 15739 |
| 571 | Ga0436361_0962723 | 3300039447 | Bacteria | 26082 |
| 572 | Ga0436363_0716332 | 3300039450 | Bacteria | 694 |
| 573 | Ga0436363_0970116 | 3300039450 | Bacteria | 5521 |
| 574 | Ga0436363_1358826 | 3300039450 | Bacteria | 746 |
| 575 | Ga0436363_1395887 | 3300039450 | Bacteria | 620 |
| 576 | Ga0436362_1075674 | 3300039453 | Bacteria | 4239 |
| 577 | Ga0436362_1242374 | 3300039453 | Bacteria | 1864 |
| 578 | Ga0451853_4075313 | 3300041512 | Bacteria | 635 |
| 579 | Ga0451577_0003351 | 3300042876 | Bacteria | 17945 |
| 580 | Ga0451577_0504349 | 3300042876 | Bacteria | 1099 |
| 581 | Ga0451577_1891989 | 3300042876 | Bacteria | 523 |
| 582 | Ga0453683_0191709 | 3300044673 | Bacteria | 1297 |
| 583 | Ga0466966_0054281 | 3300044684 | Bacteria | 2540 |
| 584 | Ga0466966_0289898 | 3300044684 | Bacteria | 984 |
| 585 | Ga0466961_0231806 | 3300044693 | Bacteria | 1136 |
| 586 | Ga0466961_0473093 | 3300044693 | Bacteria | 758 |
| 587 | Ga0466963_0000697 | 3300044694 | Bacteria | 16365 |
| 588 | Ga0466963_0017962 | 3300044694 | Bacteria | 4413 |
| 589 | Ga0466963_0033689 | 3300044694 | Bacteria | 3328 |
| 590 | Ga0466963_0543005 | 3300044694 | Bacteria | 821 |
| 591 | Ga0453684_0000545 | 3300044712 | Bacteria | 142482 |
| 592 | Ga0453684_0349824 | 3300044712 | Bacteria | 1667 |
| 593 | Ga0453684_0422538 | 3300044712 | Bacteria | 1489 |
| 594 | Ga0466971_0146342 | 3300044719 | Bacteria | 1102 |
| 595 | Ga0466957_0000091 | 3300044842 | Bacteria | 36379 |
| 596 | Ga0466957_0169672 | 3300044842 | Bacteria | 1421 |
| 597 | Ga0466957_0308901 | 3300044842 | Bacteria | 1064 |
| 598 | Ga0466959_0087070 | 3300045049 | Bacteria | 2247 |
| 599 | Ga0466959_0129036 | 3300045049 | Bacteria | 1793 |
| 600 | Ga0466959_0340009 | 3300045049 | Bacteria | 1024 |
| 601 | Ga0466959_0457870 | 3300045049 | Bacteria | 864 |
| 602 | Ga0466959_1100964 | 3300045049 | Bacteria | 528 |
| 603 | Ga0451576_0030134 | 3300045051 | Bacteria | 5802 |
| 604 | Ga0451576_0115084 | 3300045051 | Bacteria | 2800 |
| 605 | Ga0451576_0351745 | 3300045051 | Bacteria | 1543 |
| 606 | Ga0451576_0784513 | 3300045051 | Bacteria | 1001 |
| 607 | Ga0466958_0596039 | 3300045836 | Bacteria | 719 |
| 608 | Ga0466958_0661044 | 3300045836 | Bacteria | 680 |
| 609 | Ga0466958_1091681 | 3300045836 | Bacteria | 521 |
| 610 | Ga0466958_1100712 | 3300045836 | Bacteria | 519 |
| 611 | Ga0466967_0004330 | 3300045976 | Bacteria | 9548 |
| 612 | Ga0466967_0058846 | 3300045976 | Bacteria | 3398 |
| 613 | Ga0466967_0543479 | 3300045976 | Bacteria | 1143 |
| 614 | Ga0495592_0293871 | 3300046454 | Bacteria | 1058 |
| 615 | Ga0495651_0334267 | 3300046462 | Bacteria | 1006 |
| 616 | Ga0495653_0241397 | 3300046463 | Bacteria | 1204 |
| 617 | Ga0495580_0116498 | 3300046472 | Bacteria | 1855 |
| 618 | Ga0495580_0171971 | 3300046472 | Bacteria | 1498 |
| 619 | Ga0495580_0266112 | 3300046472 | Bacteria | 1172 |
| 620 | Ga0495582_0011134 | 3300046473 | Bacteria | 4953 |
| 621 | Ga0495582_0045146 | 3300046473 | Bacteria | 2427 |
| 622 | Ga0495639_0458541 | 3300046475 | Bacteria | 648 |
| 623 | Ga0495664_0354842 | 3300046477 | Bacteria | 883 |
| 624 | Ga0495585_0591764 | 3300046492 | Unclassified | 522 |
| 625 | Ga0495594_0218701 | 3300046499 | Bacteria | 1086 |
| 626 | Ga0495594_0680927 | 3300046499 | Bacteria | 582 |
| 627 | Ga0495630_0021830 | 3300046517 | Bacteria | 4727 |
| 628 | Ga0495666_0256145 | 3300046526 | Bacteria | 797 |
| 629 | Ga0495652_0828144 | 3300046529 | Bacteria | 614 |
| 630 | Ga0495665_0128552 | 3300046531 | Bacteria | 1326 |
| 631 | Ga0495640_0256113 | 3300046533 | Bacteria | 1095 |
| 632 | Ga0495586_0080052 | 3300046535 | Bacteria | 1794 |
| 633 | Ga0495586_0129568 | 3300046535 | Bacteria | 1412 |
| 634 | Ga0495667_0180673 | 3300046559 | Bacteria | 1354 |
| 635 | Ga0495667_0829637 | 3300046559 | Bacteria | 569 |
| 636 | Ga0495635_0066288 | 3300046663 | Bacteria | 2476 |
| 637 | Ga0495635_0118526 | 3300046663 | Bacteria | 1806 |
| 638 | Ga0495599_0406105 | 3300046678 | Bacteria | 811 |
| 639 | Ga0495658_0077354 | 3300046683 | Bacteria | 1946 |
| 640 | Ga0495669_0078748 | 3300046684 | Bacteria | 1510 |
| 641 | Ga0495669_0111833 | 3300046684 | Bacteria | 1276 |
| 642 | Ga0495669_0249349 | 3300046684 | Bacteria | 853 |
| 643 | Ga0495613_0171172 | 3300046689 | Bacteria | 1541 |
| 644 | Ga0495613_0461394 | 3300046689 | Bacteria | 860 |
| 645 | Ga0495581_0022818 | 3300047315 | Bacteria | 3625 |
| 646 | Ga0495604_0033543 | 3300047317 | Bacteria | 4064 |
| 647 | Ga0495674_0122318 | 3300047319 | Bacteria | 2198 |
| 648 | Ga0495674_1125241 | 3300047319 | Bacteria | 597 |
| 649 | Ga0495674_1293952 | 3300047319 | Bacteria | 547 |
| 650 | Ga0495680_0821731 | 3300047322 | Bacteria | 606 |
| 651 | Ga0495675_0803044 | 3300047444 | Bacteria | 521 |
| 652 | Ga0495686_0003824 | 3300047472 | Bacteria | 12761 |
| 653 | Ga0495686_0005390 | 3300047472 | Bacteria | 10106 |
| 654 | Ga0495686_0026007 | 3300047472 | Bacteria | 3831 |
| 655 | Ga0495686_0093162 | 3300047472 | Bacteria | 1827 |
| 656 | Ga0495686_0292125 | 3300047472 | Bacteria | 902 |
| 657 | Ga0495602_0637664 | 3300048088 | Bacteria | 729 |
| 658 | Ga0495614_0088813 | 3300048089 | Bacteria | 1344 |
| 659 | Ga0495614_0645171 | 3300048089 | Bacteria | 510 |
| 660 | Ga0496100_0643019 | 3300048903 | Bacteria | 825 |
| 661 | Ga0496100_0694447 | 3300048903 | Bacteria | 794 |
| 662 | Ga0496102_0048790 | 3300048905 | Bacteria | 3850 |
| 663 | Ga0496102_0183869 | 3300048905 | Bacteria | 1969 |
| 664 | Ga0496103_0728173 | 3300048906 | Bacteria | 628 |
| 665 | Ga0496104_0004857 | 3300048907 | Bacteria | 11710 |
| 666 | Ga0496104_0135839 | 3300048907 | Bacteria | 2363 |
| 667 | Ga0496104_0241759 | 3300048907 | Bacteria | 1718 |
| 668 | Ga0496104_0396684 | 3300048907 | Bacteria | 1292 |
| 669 | Ga0496104_0446483 | 3300048907 | Bacteria | 1205 |
| 670 | Ga0496104_0804154 | 3300048907 | Bacteria | 846 |
| 671 | Ga0496104_1734788 | 3300048907 | Bacteria | 527 |
| 672 | Ga0496105_1187438 | 3300048908 | Bacteria | 562 |
| 673 | Ga0496107_1086388 | 3300048910 | Bacteria | 578 |
| 674 | Ga0496108_0233264 | 3300048911 | Bacteria | 1600 |
| 675 | Ga0496109_0024187 | 3300048912 | Bacteria | 5398 |
| 676 | Ga0496109_0965813 | 3300048912 | Bacteria | 790 |
| 677 | Ga0496110_0263839 | 3300048913 | Bacteria | 1568 |
| 678 | Ga0496110_0865230 | 3300048913 | Bacteria | 809 |
| 679 | Ga0496110_1596047 | 3300048913 | Bacteria | 562 |
| 680 | Ga0496110_1774734 | 3300048913 | Bacteria | 527 |
| 681 | Ga0496111_0010060 | 3300048914 | Bacteria | 6329 |
| 682 | Ga0496111_0192568 | 3300048914 | Bacteria | 1516 |
| 683 | Ga0496111_0230728 | 3300048914 | Bacteria | 1375 |
| 684 | Ga0496112_0008453 | 3300048915 | Bacteria | 9223 |
| 685 | Ga0496112_0053293 | 3300048915 | Bacteria | 3972 |
| 686 | Ga0496112_0091714 | 3300048915 | Bacteria | 3007 |
| 687 | Ga0496112_0119936 | 3300048915 | Bacteria | 2600 |
| 688 | Ga0496112_0187053 | 3300048915 | Bacteria | 2034 |
| 689 | Ga0496113_0007159 | 3300048916 | Bacteria | 7146 |
| 690 | Ga0496113_0026834 | 3300048916 | Bacteria | 4123 |
| 691 | Ga0496113_0144525 | 3300048916 | Bacteria | 1873 |
| 692 | Ga0496113_0632610 | 3300048916 | Bacteria | 856 |
| 693 | Ga0496115_0098253 | 3300048918 | Bacteria | 2397 |
| 694 | Ga0496115_0632316 | 3300048918 | Bacteria | 848 |
| 695 | Ga0496117_0216312 | 3300048920 | Bacteria | 1070 |
| 696 | Ga0496126_0000005 | 3300048929 | Bacteria | 891906 |
| 697 | Ga0496126_0018827 | 3300048929 | Bacteria | 6826 |
| 698 | Ga0501296_059394 | 3300049519 | Bacteria | 575 |
| 699 | Ga0501034_0029221 | 3300049571 | Bacteria | 5603 |
| 700 | Ga0501034_0040380 | 3300049571 | Bacteria | 4723 |
| 701 | Ga0501037_0165424 | 3300049573 | Bacteria | 1575 |
| 702 | Ga0501047_0043109 | 3300049581 | Bacteria | 4359 |
| 703 | Ga0501073_0047586 | 3300049589 | Bacteria | 3014 |
| 704 | Ga0501080_0537198 | 3300049742 | Bacteria | 1042 |
| 705 | Ga0501035_0765432 | 3300049822 | Bacteria | 774 |
| 706 | nmdc:mga05p37_220967_c1 | 3300050507 | Bacteria | 2286 |
| 707 | nmdc:mga0n895_6814_c1 | 3300050512 | Bacteria | 9755 |
| 708 | nmdc:mga0n895_79118_c1 | 3300050512 | Bacteria | 3273 |
| 709 | nmdc:mga0rr50_106_c1 | 3300050513 | Bacteria | 46345 |
| 710 | nmdc:mga0rr50_146531_c1 | 3300050513 | Bacteria | 1904 |
| 711 | nmdc:mga0rr50_73046_c1 | 3300050513 | Bacteria | 2621 |
| 712 | nmdc:mga0rr50_978270_c1 | 3300050513 | Bacteria | 721 |
| 713 | nmdc:mga08x19_26710_c1 | 3300050514 | Bacteria | 3604 |
| 714 | nmdc:mga08x19_8213_c1 | 3300050514 | Bacteria | 6203 |
| 715 | nmdc:mga0a205_131827_c1 | 3300050515 | Bacteria | 2400 |
| 716 | Ga0495601_0068298 | 3300053077 | Bacteria | 2265 |
| 717 | Ga0495619_0580610 | 3300053085 | Bacteria | 768 |
| 718 | Ga0590077_098864 | 3300059426 | Bacteria | 681 |
| 719 | Ga0587066_124454 | 3300059490 | Bacteria | 613 |
| 720 | Ga0587080_101076 | 3300059503 | Bacteria | 617 |
| 721 | Ga0587090_081336 | 3300059510 | Bacteria | 649 |
| 722 | Ga0587094_079710 | 3300059513 | Bacteria | 603 |
| 723 | Ga0587115_086288 | 3300059626 | Bacteria | 563 |
| 724 | Ga0587117_067172 | 3300059627 | Bacteria | 628 |
| 725 | Ga0587075_026980 | 3300059644 | Bacteria | 892 |
| 726 | Ga0587076_096282 | 3300059645 | Bacteria | 655 |
| 727 | Ga0587071_095094 | 3300060344 | Bacteria | 682 |
| 728 | Ga0501082_0101773 | 3300060353 | Bacteria | 2485 |
| 729 | Ga0466962_0331977 | 3300061719 | Bacteria | 755 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035724 | Ga0373933_1007985 | Ga0373933_1007985_252_533 | 76 |
| 2 | 3300041512 | Ga0451853_4075313 | Ga0451853_4075313_295_594 | 79 |
| 3 | 3300049519 | Ga0501296_059394 | Ga0501296_059394_238_540 | 79 |
| 4 | 3300005288 | Ga0065714_10251664 | Ga0065714_102516642 | 80 |
| 5 | 3300005290 | Ga0065712_10023735 | Ga0065712_100237352 | 80 |
| 6 | 3300005293 | Ga0065715_10231730 | Ga0065715_102317303 | 80 |
| 7 | 3300005331 | Ga0070670_100026689 | Ga0070670_1000266895 | 80 |
| 8 | 3300005334 | Ga0068869_101052533 | Ga0068869_1010525332 | 80 |
| 9 | 3300005340 | Ga0070689_100284828 | Ga0070689_1002848282 | 80 |
| 10 | 3300005341 | Ga0070691_10283669 | Ga0070691_102836692 | 80 |
| 11 | 3300005354 | Ga0070675_100697949 | Ga0070675_1006979492 | 80 |
| 12 | 3300005365 | Ga0070688_100175746 | Ga0070688_1001757463 | 80 |
| 13 | 3300005459 | Ga0068867_100091597 | Ga0068867_1000915971 | 80 |
| 14 | 3300005466 | Ga0070685_10222409 | Ga0070685_102224092 | 80 |
| 15 | 3300005549 | Ga0070704_100236821 | Ga0070704_1002368212 | 80 |
| 16 | 3300005577 | Ga0068857_100039759 | Ga0068857_1000397592 | 80 |
| 17 | 3300005578 | Ga0068854_100578405 | Ga0068854_1005784052 | 80 |
| 18 | 3300005617 | Ga0068859_101175738 | Ga0068859_1011757382 | 80 |
| 19 | 3300005718 | Ga0068866_11452197 | Ga0068866_114521971 | 80 |
| 20 | 3300005844 | Ga0068862_102744309 | Ga0068862_1027443091 | 80 |
| 21 | 3300006871 | Ga0075434_101514182 | Ga0075434_1015141822 | 80 |
| 22 | 3300006881 | Ga0068865_100225776 | Ga0068865_1002257762 | 80 |
| 23 | 3300006914 | Ga0075436_100193672 | Ga0075436_1001936723 | 80 |
| 24 | 3300006931 | Ga0097620_101175714 | Ga0097620_1011757142 | 80 |
| 25 | 3300007076 | Ga0075435_101381666 | Ga0075435_1013816662 | 80 |
| 26 | 3300009176 | Ga0105242_10080073 | Ga0105242_100800733 | 80 |
| 27 | 3300014326 | Ga0157380_10005417 | Ga0157380_100054174 | 80 |
| 28 | 3300014745 | Ga0157377_10261030 | Ga0157377_102610301 | 80 |
| 29 | 3300025925 | Ga0207650_10035262 | Ga0207650_100352622 | 80 |
| 30 | 3300025926 | Ga0207659_11182232 | Ga0207659_111822321 | 80 |
| 31 | 3300025936 | Ga0207670_10357465 | Ga0207670_103574652 | 80 |
| 32 | 3300025938 | Ga0207704_10352984 | Ga0207704_103529842 | 80 |
| 33 | 3300025942 | Ga0207689_10622950 | Ga0207689_106229501 | 80 |
| 34 | 3300025981 | Ga0207640_10563998 | Ga0207640_105639981 | 80 |
| 35 | 3300026089 | Ga0207648_10949003 | Ga0207648_109490032 | 80 |
| 36 | 3300026116 | Ga0207674_10046321 | Ga0207674_100463212 | 80 |
| 37 | 3300028380 | Ga0268265_11684592 | Ga0268265_116845921 | 80 |
| 38 | 3300035090 | Ga0373949_0105218 | Ga0373949_0105218_389_697 | 80 |
| 39 | 3300035112 | Ga0373932_0210252 | Ga0373932_0210252_36_344 | 80 |
| 40 | 3300035691 | Ga0373931_0079013 | Ga0373931_0079013_680_988 | 80 |
| 41 | 3300044712 | Ga0453684_0349824 | Ga0453684_0349824_1250_1558 | 80 |
| 42 | 3300045051 | Ga0451576_0115084 | Ga0451576_0115084_881_1189 | 80 |
| 43 | 3300046473 | Ga0495582_0011134 | Ga0495582_0011134_2038_2346 | 80 |
| 44 | 3300046499 | Ga0495594_0218701 | Ga0495594_0218701_611_919 | 80 |
| 45 | 3300046535 | Ga0495586_0129568 | Ga0495586_0129568_1064_1372 | 80 |
| 46 | 3300046689 | Ga0495613_0171172 | Ga0495613_0171172_1119_1427 | 80 |
| 47 | 3300048089 | Ga0495614_0645171 | Ga0495614_0645171_104_412 | 80 |
| 48 | 3300050513 | nmdc:mga0rr50_73046_c1 | nmdc:mga0rr50_73046_c1_272_580 | 80 |
| 49 | 3300050513 | nmdc:mga0rr50_978270_c1 | nmdc:mga0rr50_978270_c1_155_463 | 80 |
| 50 | 3300033547 | Ga0316212_1030629 | Ga0316212_10306292 | 82 |
| 51 | 3300035171 | Ga0373946_0783322 | Ga0373946_0783322_169_447 | 82 |
| 52 | 3300035724 | Ga0373933_0615076 | Ga0373933_0615076_11_289 | 82 |
| 53 | 3300036401 | Ga0373937_0429299 | Ga0373937_0429299_302_580 | 82 |
| 54 | 3300047319 | Ga0495674_1125241 | Ga0495674_1125241_303_581 | 82 |
| 55 | 3300047444 | Ga0495675_0803044 | Ga0495675_0803044_135_413 | 82 |
| 56 | 3300048908 | Ga0496105_1187438 | Ga0496105_1187438_14_292 | 82 |
| 57 | 3300025913 | Ga0207695_10026761 | Ga0207695_100267615 | 83 |
| 58 | 3300046475 | Ga0495639_0458541 | Ga0495639_0458541_10_291 | 83 |
| 59 | 3300046533 | Ga0495640_0256113 | Ga0495640_0256113_32_334 | 83 |
| 60 | 3300005338 | Ga0068868_100981898 | Ga0068868_1009818982 | 86 |
| 61 | 3300005564 | Ga0070664_101274390 | Ga0070664_1012743902 | 86 |
| 62 | 3300014745 | Ga0157377_10636004 | Ga0157377_106360042 | 86 |
| 63 | 3300026023 | Ga0207677_11197681 | Ga0207677_111976812 | 86 |
| 64 | 3300026035 | Ga0207703_11649394 | Ga0207703_116493942 | 86 |
| 65 | 3300014969 | Ga0157376_13045567 | Ga0157376_130455671 | 87 |
| 66 | 3300014969 | Ga0157376_13088103 | Ga0157376_130881031 | 87 |
| 67 | 3300026089 | Ga0207648_10763560 | Ga0207648_107635602 | 87 |
| 68 | 3300047472 | Ga0495686_0093162 | Ga0495686_0093162_578_880 | 87 |
| 69 | 3300049571 | Ga0501034_0029221 | Ga0501034_0029221_1087_1386 | 87 |
| 70 | 3300049571 | Ga0501034_0040380 | Ga0501034_0040380_527_826 | 87 |
| 71 | 3300060353 | Ga0501082_0101773 | Ga0501082_0101773_1732_2031 | 87 |
| 72 | iso_pu_bacteria | 2884215851 | 2884217364 | 87 |
| 73 | 3300009101 | Ga0105247_10242747 | Ga0105247_102427473 | 88 |
| 74 | 3300039438 | Ga0436360_0279180 | Ga0436360_0279180_228_530 | 88 |
| 75 | 3300005327 | Ga0070658_10001527 | Ga0070658_100015279 | 89 |
| 76 | 3300005344 | Ga0070661_100361545 | Ga0070661_1003615451 | 89 |
| 77 | 3300005344 | Ga0070661_101782562 | Ga0070661_1017825621 | 89 |
| 78 | 3300005435 | Ga0070714_100159821 | Ga0070714_1001598211 | 89 |
| 79 | 3300005563 | Ga0068855_100002031 | Ga0068855_10000203116 | 89 |
| 80 | 3300005616 | Ga0068852_100145658 | Ga0068852_1001456582 | 89 |
| 81 | 3300009093 | Ga0105240_10006173 | Ga0105240_100061732 | 89 |
| 82 | 3300009093 | Ga0105240_10516923 | Ga0105240_105169232 | 89 |
| 83 | 3300009174 | Ga0105241_10403098 | Ga0105241_104030982 | 89 |
| 84 | 3300009551 | Ga0105238_10280111 | Ga0105238_102801111 | 89 |
| 85 | 3300009551 | Ga0105238_10569902 | Ga0105238_105699022 | 89 |
| 86 | 3300013102 | Ga0157371_11446277 | Ga0157371_114462772 | 89 |
| 87 | 3300013104 | Ga0157370_10039723 | Ga0157370_100397234 | 89 |
| 88 | 3300013105 | Ga0157369_10134997 | Ga0157369_101349971 | 89 |
| 89 | 3300013105 | Ga0157369_10234269 | Ga0157369_102342692 | 89 |
| 90 | 3300013296 | Ga0157374_10222173 | Ga0157374_102221732 | 89 |
| 91 | 3300013296 | Ga0157374_10234187 | Ga0157374_102341873 | 89 |
| 92 | 3300013307 | Ga0157372_10084718 | Ga0157372_100847184 | 89 |
| 93 | 3300013307 | Ga0157372_10647794 | Ga0157372_106477943 | 89 |
| 94 | 3300021361 | Ga0213872_10005723 | Ga0213872_100057234 | 89 |
| 95 | 3300021361 | Ga0213872_10076671 | Ga0213872_100766712 | 89 |
| 96 | 3300021441 | Ga0213871_10078938 | Ga0213871_100789382 | 89 |
| 97 | 3300025904 | Ga0207647_10052108 | Ga0207647_100521082 | 89 |
| 98 | 3300025909 | Ga0207705_10004200 | Ga0207705_100042003 | 89 |
| 99 | 3300025913 | Ga0207695_10013166 | Ga0207695_100131669 | 89 |
| 100 | 3300025913 | Ga0207695_10279162 | Ga0207695_102791622 | 89 |
| 101 | 3300025929 | Ga0207664_10119001 | Ga0207664_101190012 | 89 |
| 102 | 3300025929 | Ga0207664_10224962 | Ga0207664_102249622 | 89 |
| 103 | 3300025949 | Ga0207667_10005534 | Ga0207667_100055342 | 89 |
| 104 | 3300026067 | Ga0207678_10257773 | Ga0207678_102577732 | 89 |
| 105 | 3300026078 | Ga0207702_10755123 | Ga0207702_107551232 | 89 |
| 106 | 3300026116 | Ga0207674_10678088 | Ga0207674_106780882 | 89 |
| 107 | 3300026142 | Ga0207698_10443043 | Ga0207698_104430432 | 89 |
| 108 | 3300037471 | Ga0395905_0162410 | Ga0395905_0162410_544_846 | 89 |
| 109 | 3300039438 | Ga0436360_0975883 | Ga0436360_0975883_812_1114 | 89 |
| 110 | 3300039447 | Ga0436361_0661329 | Ga0436361_0661329_51_353 | 89 |
| 111 | 3300039447 | Ga0436361_0788453 | Ga0436361_0788453_1959_2261 | 89 |
| 112 | 3300039447 | Ga0436361_0962723 | Ga0436361_0962723_12371_12673 | 89 |
| 113 | 3300039450 | Ga0436363_0716332 | Ga0436363_0716332_14_316 | 89 |
| 114 | 3300039453 | Ga0436362_1242374 | Ga0436362_1242374_695_997 | 89 |
| 115 | 3300048088 | Ga0495602_0637664 | Ga0495602_0637664_257_559 | 89 |
| 116 | 3300048912 | Ga0496109_0965813 | Ga0496109_0965813_364_666 | 89 |
| 117 | 3300048918 | Ga0496115_0098253 | Ga0496115_0098253_901_1203 | 89 |
| 118 | 3300005327 | Ga0070658_10000021 | Ga0070658_1000002133 | 90 |
| 119 | 3300005327 | Ga0070658_10005185 | Ga0070658_100051859 | 90 |
| 120 | 3300005327 | Ga0070658_10016209 | Ga0070658_100162092 | 90 |
| 121 | 3300005327 | Ga0070658_10016628 | Ga0070658_100166283 | 90 |
| 122 | 3300005327 | Ga0070658_10426595 | Ga0070658_104265952 | 90 |
| 123 | 3300005327 | Ga0070658_10539021 | Ga0070658_105390212 | 90 |
| 124 | 3300005327 | Ga0070658_11143292 | Ga0070658_111432922 | 90 |
| 125 | 3300005327 | Ga0070658_11313985 | Ga0070658_113139851 | 90 |
| 126 | 3300005327 | Ga0070658_11377893 | Ga0070658_113778932 | 90 |
| 127 | 3300005327 | Ga0070658_11720594 | Ga0070658_117205941 | 90 |
| 128 | 3300005329 | Ga0070683_100059316 | Ga0070683_1000593164 | 90 |
| 129 | 3300005329 | Ga0070683_100122154 | Ga0070683_1001221543 | 90 |
| 130 | 3300005329 | Ga0070683_101626501 | Ga0070683_1016265012 | 90 |
| 131 | 3300005336 | Ga0070680_100024410 | Ga0070680_1000244104 | 90 |
| 132 | 3300005336 | Ga0070680_100258121 | Ga0070680_1002581211 | 90 |
| 133 | 3300005336 | Ga0070680_101192435 | Ga0070680_1011924352 | 90 |
| 134 | 3300005336 | Ga0070680_101928400 | Ga0070680_1019284001 | 90 |
| 135 | 3300005337 | Ga0070682_100437889 | Ga0070682_1004378893 | 90 |
| 136 | 3300005339 | Ga0070660_100021869 | Ga0070660_1000218694 | 90 |
| 137 | 3300005339 | Ga0070660_100052804 | Ga0070660_1000528042 | 90 |
| 138 | 3300005339 | Ga0070660_100053595 | Ga0070660_1000535953 | 90 |
| 139 | 3300005339 | Ga0070660_100067592 | Ga0070660_1000675923 | 90 |
| 140 | 3300005341 | Ga0070691_10644028 | Ga0070691_106440282 | 90 |
| 141 | 3300005344 | Ga0070661_100060557 | Ga0070661_1000605573 | 90 |
| 142 | 3300005344 | Ga0070661_100103803 | Ga0070661_1001038032 | 90 |
| 143 | 3300005364 | Ga0070673_100492715 | Ga0070673_1004927152 | 90 |
| 144 | 3300005366 | Ga0070659_100015290 | Ga0070659_1000152903 | 90 |
| 145 | 3300005366 | Ga0070659_100028416 | Ga0070659_1000284164 | 90 |
| 146 | 3300005366 | Ga0070659_100036562 | Ga0070659_1000365622 | 90 |
| 147 | 3300005434 | Ga0070709_10034508 | Ga0070709_100345083 | 90 |
| 148 | 3300005434 | Ga0070709_10182778 | Ga0070709_101827781 | 90 |
| 149 | 3300005434 | Ga0070709_10935559 | Ga0070709_109355591 | 90 |
| 150 | 3300005434 | Ga0070709_11365834 | Ga0070709_113658342 | 90 |
| 151 | 3300005435 | Ga0070714_100145658 | Ga0070714_1001456584 | 90 |
| 152 | 3300005435 | Ga0070714_100517737 | Ga0070714_1005177372 | 90 |
| 153 | 3300005435 | Ga0070714_100779067 | Ga0070714_1007790672 | 90 |
| 154 | 3300005435 | Ga0070714_100826219 | Ga0070714_1008262192 | 90 |
| 155 | 3300005435 | Ga0070714_100999944 | Ga0070714_1009999442 | 90 |
| 156 | 3300005436 | Ga0070713_100045457 | Ga0070713_1000454574 | 90 |
| 157 | 3300005439 | Ga0070711_100124377 | Ga0070711_1001243772 | 90 |
| 158 | 3300005445 | Ga0070708_100123940 | Ga0070708_1001239402 | 90 |
| 159 | 3300005455 | Ga0070663_100027550 | Ga0070663_1000275502 | 90 |
| 160 | 3300005455 | Ga0070663_100146109 | Ga0070663_1001461092 | 90 |
| 161 | 3300005455 | Ga0070663_100313252 | Ga0070663_1003132522 | 90 |
| 162 | 3300005456 | Ga0070678_100246023 | Ga0070678_1002460233 | 90 |
| 163 | 3300005456 | Ga0070678_101258375 | Ga0070678_1012583751 | 90 |
| 164 | 3300005457 | Ga0070662_101207400 | Ga0070662_1012074002 | 90 |
| 165 | 3300005458 | Ga0070681_10077780 | Ga0070681_100777802 | 90 |
| 166 | 3300005458 | Ga0070681_10877499 | Ga0070681_108774992 | 90 |
| 167 | 3300005530 | Ga0070679_100019150 | Ga0070679_1000191505 | 90 |
| 168 | 3300005530 | Ga0070679_100048098 | Ga0070679_1000480982 | 90 |
| 169 | 3300005530 | Ga0070679_100060065 | Ga0070679_1000600654 | 90 |
| 170 | 3300005530 | Ga0070679_101041294 | Ga0070679_1010412941 | 90 |
| 171 | 3300005535 | Ga0070684_100055613 | Ga0070684_1000556134 | 90 |
| 172 | 3300005535 | Ga0070684_100460762 | Ga0070684_1004607622 | 90 |
| 173 | 3300005535 | Ga0070684_101116119 | Ga0070684_1011161191 | 90 |
| 174 | 3300005536 | Ga0070697_100001009 | Ga0070697_1000010099 | 90 |
| 175 | 3300005539 | Ga0068853_100000039 | Ga0068853_10000003974 | 90 |
| 176 | 3300005539 | Ga0068853_100111405 | Ga0068853_1001114052 | 90 |
| 177 | 3300005539 | Ga0068853_100157725 | Ga0068853_1001577252 | 90 |
| 178 | 3300005545 | Ga0070695_100035311 | Ga0070695_1000353114 | 90 |
| 179 | 3300005546 | Ga0070696_100046106 | Ga0070696_1000461064 | 90 |
| 180 | 3300005546 | Ga0070696_100232963 | Ga0070696_1002329632 | 90 |
| 181 | 3300005547 | Ga0070693_101319079 | Ga0070693_1013190791 | 90 |
| 182 | 3300005563 | Ga0068855_100002974 | Ga0068855_1000029744 | 90 |
| 183 | 3300005563 | Ga0068855_100025783 | Ga0068855_1000257836 | 90 |
| 184 | 3300005563 | Ga0068855_100036159 | Ga0068855_1000361592 | 90 |
| 185 | 3300005563 | Ga0068855_100233982 | Ga0068855_1002339823 | 90 |
| 186 | 3300005563 | Ga0068855_100370291 | Ga0068855_1003702912 | 90 |
| 187 | 3300005563 | Ga0068855_100461662 | Ga0068855_1004616622 | 90 |
| 188 | 3300005564 | Ga0070664_100048410 | Ga0070664_1000484104 | 90 |
| 189 | 3300005564 | Ga0070664_101169579 | Ga0070664_1011695792 | 90 |
| 190 | 3300005577 | Ga0068857_100018918 | Ga0068857_1000189184 | 90 |
| 191 | 3300005577 | Ga0068857_100109110 | Ga0068857_1001091102 | 90 |
| 192 | 3300005578 | Ga0068854_100000258 | Ga0068854_1000002584 | 90 |
| 193 | 3300005578 | Ga0068854_100019073 | Ga0068854_1000190732 | 90 |
| 194 | 3300005578 | Ga0068854_100875244 | Ga0068854_1008752442 | 90 |
| 195 | 3300005614 | Ga0068856_100453182 | Ga0068856_1004531823 | 90 |
| 196 | 3300005614 | Ga0068856_100458801 | Ga0068856_1004588012 | 90 |
| 197 | 3300005616 | Ga0068852_100086378 | Ga0068852_1000863784 | 90 |
| 198 | 3300005616 | Ga0068852_100147364 | Ga0068852_1001473641 | 90 |
| 199 | 3300005616 | Ga0068852_100165953 | Ga0068852_1001659533 | 90 |
| 200 | 3300005616 | Ga0068852_102607847 | Ga0068852_1026078472 | 90 |
| 201 | 3300005618 | Ga0068864_102357524 | Ga0068864_1023575242 | 90 |
| 202 | 3300005842 | Ga0068858_102330429 | Ga0068858_1023304292 | 90 |
| 203 | 3300005843 | Ga0068860_100782660 | Ga0068860_1007826602 | 90 |
| 204 | 3300006028 | Ga0070717_10050882 | Ga0070717_100508824 | 90 |
| 205 | 3300006028 | Ga0070717_10463503 | Ga0070717_104635032 | 90 |
| 206 | 3300006028 | Ga0070717_11551897 | Ga0070717_115518971 | 90 |
| 207 | 3300006173 | Ga0070716_101648856 | Ga0070716_1016488561 | 90 |
| 208 | 3300006175 | Ga0070712_100126921 | Ga0070712_1001269212 | 90 |
| 209 | 3300006237 | Ga0097621_100052895 | Ga0097621_1000528953 | 90 |
| 210 | 3300006852 | Ga0075433_10000204 | Ga0075433_1000020432 | 90 |
| 211 | 3300006871 | Ga0075434_100000356 | Ga0075434_10000035638 | 90 |
| 212 | 3300006914 | Ga0075436_100013552 | Ga0075436_1000135524 | 90 |
| 213 | 3300006914 | Ga0075436_100035059 | Ga0075436_1000350592 | 90 |
| 214 | 3300007076 | Ga0075435_100001266 | Ga0075435_10000126613 | 90 |
| 215 | 3300007076 | Ga0075435_100863114 | Ga0075435_1008631142 | 90 |
| 216 | 3300009093 | Ga0105240_10002452 | Ga0105240_1000245218 | 90 |
| 217 | 3300009093 | Ga0105240_10038871 | Ga0105240_100388713 | 90 |
| 218 | 3300009093 | Ga0105240_10139712 | Ga0105240_101397122 | 90 |
| 219 | 3300009093 | Ga0105240_10274102 | Ga0105240_102741023 | 90 |
| 220 | 3300009093 | Ga0105240_10482419 | Ga0105240_104824192 | 90 |
| 221 | 3300009093 | Ga0105240_11282757 | Ga0105240_112827571 | 90 |
| 222 | 3300009147 | Ga0114129_10237997 | Ga0114129_102379973 | 90 |
| 223 | 3300009174 | Ga0105241_10069755 | Ga0105241_100697552 | 90 |
| 224 | 3300009174 | Ga0105241_10258877 | Ga0105241_102588772 | 90 |
| 225 | 3300009174 | Ga0105241_10555164 | Ga0105241_105551641 | 90 |
| 226 | 3300009174 | Ga0105241_11716209 | Ga0105241_117162092 | 90 |
| 227 | 3300009177 | Ga0105248_10164155 | Ga0105248_101641552 | 90 |
| 228 | 3300009177 | Ga0105248_11353131 | Ga0105248_113531312 | 90 |
| 229 | 3300009545 | Ga0105237_10136511 | Ga0105237_101365113 | 90 |
| 230 | 3300009551 | Ga0105238_10049681 | Ga0105238_100496812 | 90 |
| 231 | 3300009551 | Ga0105238_10082207 | Ga0105238_100822072 | 90 |
| 232 | 3300009551 | Ga0105238_10180185 | Ga0105238_101801852 | 90 |
| 233 | 3300009553 | Ga0105249_11480188 | Ga0105249_114801882 | 90 |
| 234 | 3300010375 | Ga0105239_11210750 | Ga0105239_112107502 | 90 |
| 235 | 3300013100 | Ga0157373_10242595 | Ga0157373_102425952 | 90 |
| 236 | 3300013102 | Ga0157371_10506917 | Ga0157371_105069172 | 90 |
| 237 | 3300013104 | Ga0157370_10037753 | Ga0157370_100377532 | 90 |
| 238 | 3300013104 | Ga0157370_10040309 | Ga0157370_100403092 | 90 |
| 239 | 3300013104 | Ga0157370_10136036 | Ga0157370_101360363 | 90 |
| 240 | 3300013104 | Ga0157370_10530042 | Ga0157370_105300422 | 90 |
| 241 | 3300013104 | Ga0157370_11328794 | Ga0157370_113287942 | 90 |
| 242 | 3300013105 | Ga0157369_10016136 | Ga0157369_100161362 | 90 |
| 243 | 3300013105 | Ga0157369_10049348 | Ga0157369_100493484 | 90 |
| 244 | 3300013105 | Ga0157369_10050583 | Ga0157369_100505833 | 90 |
| 245 | 3300013105 | Ga0157369_10315653 | Ga0157369_103156532 | 90 |
| 246 | 3300013105 | Ga0157369_10756414 | Ga0157369_107564142 | 90 |
| 247 | 3300013105 | Ga0157369_11120341 | Ga0157369_111203412 | 90 |
| 248 | 3300013105 | Ga0157369_11468977 | Ga0157369_114689772 | 90 |
| 249 | 3300013296 | Ga0157374_10266885 | Ga0157374_102668853 | 90 |
| 250 | 3300013296 | Ga0157374_10484919 | Ga0157374_104849192 | 90 |
| 251 | 3300013296 | Ga0157374_10841260 | Ga0157374_108412602 | 90 |
| 252 | 3300013297 | Ga0157378_10980765 | Ga0157378_109807652 | 90 |
| 253 | 3300013306 | Ga0163162_10703002 | Ga0163162_107030022 | 90 |
| 254 | 3300013307 | Ga0157372_10016591 | Ga0157372_100165916 | 90 |
| 255 | 3300013307 | Ga0157372_10059678 | Ga0157372_100596782 | 90 |
| 256 | 3300013307 | Ga0157372_10068956 | Ga0157372_100689564 | 90 |
| 257 | 3300013307 | Ga0157372_10103770 | Ga0157372_101037702 | 90 |
| 258 | 3300013307 | Ga0157372_10166798 | Ga0157372_101667982 | 90 |
| 259 | 3300013307 | Ga0157372_11935923 | Ga0157372_119359232 | 90 |
| 260 | 3300014325 | Ga0163163_10017684 | Ga0163163_100176843 | 90 |
| 261 | 3300014325 | Ga0163163_10433771 | Ga0163163_104337712 | 90 |
| 262 | 3300014968 | Ga0157379_10000835 | Ga0157379_1000083513 | 90 |
| 263 | 3300021358 | Ga0213873_10004918 | Ga0213873_100049183 | 90 |
| 264 | 3300021361 | Ga0213872_10096967 | Ga0213872_100969673 | 90 |
| 265 | 3300021377 | Ga0213874_10045098 | Ga0213874_100450982 | 90 |
| 266 | 3300021384 | Ga0213876_10221330 | Ga0213876_102213302 | 90 |
| 267 | 3300021441 | Ga0213871_10007347 | Ga0213871_100073472 | 90 |
| 268 | 3300022732 | Ga0224569_100853 | Ga0224569_1008533 | 90 |
| 269 | 3300024227 | Ga0228598_1001012 | Ga0228598_10010124 | 90 |
| 270 | 3300025261 | Ga0209233_1027448 | Ga0209233_10274482 | 90 |
| 271 | 3300025901 | Ga0207688_10906671 | Ga0207688_109066711 | 90 |
| 272 | 3300025904 | Ga0207647_10001986 | Ga0207647_100019862 | 90 |
| 273 | 3300025905 | Ga0207685_10176170 | Ga0207685_101761702 | 90 |
| 274 | 3300025906 | Ga0207699_10113868 | Ga0207699_101138682 | 90 |
| 275 | 3300025909 | Ga0207705_10000041 | Ga0207705_1000004156 | 90 |
| 276 | 3300025909 | Ga0207705_10001724 | Ga0207705_1000172414 | 90 |
| 277 | 3300025909 | Ga0207705_10002780 | Ga0207705_100027804 | 90 |
| 278 | 3300025909 | Ga0207705_10009906 | Ga0207705_100099063 | 90 |
| 279 | 3300025909 | Ga0207705_10013162 | Ga0207705_100131623 | 90 |
| 280 | 3300025909 | Ga0207705_10301948 | Ga0207705_103019483 | 90 |
| 281 | 3300025909 | Ga0207705_10687362 | Ga0207705_106873622 | 90 |
| 282 | 3300025909 | Ga0207705_10824445 | Ga0207705_108244452 | 90 |
| 283 | 3300025911 | Ga0207654_10352879 | Ga0207654_103528793 | 90 |
| 284 | 3300025912 | Ga0207707_10201765 | Ga0207707_102017653 | 90 |
| 285 | 3300025912 | Ga0207707_10925611 | Ga0207707_109256112 | 90 |
| 286 | 3300025913 | Ga0207695_10000589 | Ga0207695_1000058962 | 90 |
| 287 | 3300025913 | Ga0207695_10037654 | Ga0207695_100376542 | 90 |
| 288 | 3300025913 | Ga0207695_10044746 | Ga0207695_100447462 | 90 |
| 289 | 3300025913 | Ga0207695_10660590 | Ga0207695_106605902 | 90 |
| 290 | 3300025913 | Ga0207695_10902404 | Ga0207695_109024042 | 90 |
| 291 | 3300025914 | Ga0207671_10096424 | Ga0207671_100964243 | 90 |
| 292 | 3300025915 | Ga0207693_10018216 | Ga0207693_100182163 | 90 |
| 293 | 3300025915 | Ga0207693_11347948 | Ga0207693_113479482 | 90 |
| 294 | 3300025916 | Ga0207663_10281030 | Ga0207663_102810302 | 90 |
| 295 | 3300025916 | Ga0207663_10369799 | Ga0207663_103697992 | 90 |
| 296 | 3300025917 | Ga0207660_10152967 | Ga0207660_101529672 | 90 |
| 297 | 3300025919 | Ga0207657_10022317 | Ga0207657_100223174 | 90 |
| 298 | 3300025919 | Ga0207657_10027462 | Ga0207657_100274623 | 90 |
| 299 | 3300025919 | Ga0207657_10040613 | Ga0207657_100406133 | 90 |
| 300 | 3300025919 | Ga0207657_10791997 | Ga0207657_107919972 | 90 |
| 301 | 3300025919 | Ga0207657_11156524 | Ga0207657_111565242 | 90 |
| 302 | 3300025920 | Ga0207649_10077225 | Ga0207649_100772252 | 90 |
| 303 | 3300025921 | Ga0207652_10003556 | Ga0207652_100035563 | 90 |
| 304 | 3300025921 | Ga0207652_10057634 | Ga0207652_100576344 | 90 |
| 305 | 3300025924 | Ga0207694_10032945 | Ga0207694_100329452 | 90 |
| 306 | 3300025924 | Ga0207694_10135872 | Ga0207694_101358722 | 90 |
| 307 | 3300025928 | Ga0207700_10772005 | Ga0207700_107720052 | 90 |
| 308 | 3300025929 | Ga0207664_10158631 | Ga0207664_101586313 | 90 |
| 309 | 3300025929 | Ga0207664_11011735 | Ga0207664_110117351 | 90 |
| 310 | 3300025932 | Ga0207690_10003497 | Ga0207690_100034976 | 90 |
| 311 | 3300025932 | Ga0207690_10248307 | Ga0207690_102483073 | 90 |
| 312 | 3300025933 | Ga0207706_10876269 | Ga0207706_108762692 | 90 |
| 313 | 3300025939 | Ga0207665_10366344 | Ga0207665_103663443 | 90 |
| 314 | 3300025941 | Ga0207711_10344175 | Ga0207711_103441752 | 90 |
| 315 | 3300025941 | Ga0207711_11013751 | Ga0207711_110137512 | 90 |
| 316 | 3300025944 | Ga0207661_10129450 | Ga0207661_101294502 | 90 |
| 317 | 3300025944 | Ga0207661_10324117 | Ga0207661_103241172 | 90 |
| 318 | 3300025945 | Ga0207679_10279713 | Ga0207679_102797132 | 90 |
| 319 | 3300025949 | Ga0207667_10008043 | Ga0207667_100080438 | 90 |
| 320 | 3300025949 | Ga0207667_10010759 | Ga0207667_100107594 | 90 |
| 321 | 3300025949 | Ga0207667_10053497 | Ga0207667_100534974 | 90 |
| 322 | 3300025949 | Ga0207667_10092427 | Ga0207667_100924274 | 90 |
| 323 | 3300025949 | Ga0207667_10269380 | Ga0207667_102693802 | 90 |
| 324 | 3300025949 | Ga0207667_10430858 | Ga0207667_104308582 | 90 |
| 325 | 3300025949 | Ga0207667_10661736 | Ga0207667_106617362 | 90 |
| 326 | 3300025960 | Ga0207651_11728096 | Ga0207651_117280962 | 90 |
| 327 | 3300025961 | Ga0207712_12102403 | Ga0207712_121024032 | 90 |
| 328 | 3300025981 | Ga0207640_10000001 | Ga0207640_10000001196 | 90 |
| 329 | 3300025981 | Ga0207640_10004201 | Ga0207640_100042018 | 90 |
| 330 | 3300025981 | Ga0207640_10617366 | Ga0207640_106173661 | 90 |
| 331 | 3300026035 | Ga0207703_10787246 | Ga0207703_107872462 | 90 |
| 332 | 3300026041 | Ga0207639_10000037 | Ga0207639_1000003754 | 90 |
| 333 | 3300026041 | Ga0207639_10011098 | Ga0207639_100110983 | 90 |
| 334 | 3300026041 | Ga0207639_10061492 | Ga0207639_100614922 | 90 |
| 335 | 3300026041 | Ga0207639_11640670 | Ga0207639_116406702 | 90 |
| 336 | 3300026067 | Ga0207678_10010929 | Ga0207678_100109294 | 90 |
| 337 | 3300026067 | Ga0207678_10023442 | Ga0207678_100234424 | 90 |
| 338 | 3300026067 | Ga0207678_10305222 | Ga0207678_103052222 | 90 |
| 339 | 3300026067 | Ga0207678_10738146 | Ga0207678_107381462 | 90 |
| 340 | 3300026067 | Ga0207678_11532107 | Ga0207678_115321072 | 90 |
| 341 | 3300026078 | Ga0207702_10234117 | Ga0207702_102341173 | 90 |
| 342 | 3300026078 | Ga0207702_10385027 | Ga0207702_103850272 | 90 |
| 343 | 3300026078 | Ga0207702_10819686 | Ga0207702_108196862 | 90 |
| 344 | 3300026078 | Ga0207702_11059703 | Ga0207702_110597032 | 90 |
| 345 | 3300026116 | Ga0207674_10027262 | Ga0207674_100272623 | 90 |
| 346 | 3300026116 | Ga0207674_10036001 | Ga0207674_100360014 | 90 |
| 347 | 3300026116 | Ga0207674_10163978 | Ga0207674_101639783 | 90 |
| 348 | 3300026142 | Ga0207698_10020962 | Ga0207698_100209622 | 90 |
| 349 | 3300026142 | Ga0207698_10080306 | Ga0207698_100803062 | 90 |
| 350 | 3300026142 | Ga0207698_10351268 | Ga0207698_103512682 | 90 |
| 351 | 3300026142 | Ga0207698_10897807 | Ga0207698_108978072 | 90 |
| 352 | 3300026142 | Ga0207698_12067728 | Ga0207698_120677282 | 90 |
| 353 | 3300027360 | Ga0209969_1062259 | Ga0209969_10622591 | 90 |
| 354 | 3300028036 | Ga0265355_1002281 | Ga0265355_10022812 | 90 |
| 355 | 3300028381 | Ga0268264_11838371 | Ga0268264_118383712 | 90 |
| 356 | 3300028381 | Ga0268264_11897489 | Ga0268264_118974892 | 90 |
| 357 | 3300028800 | Ga0265338_10051809 | Ga0265338_100518092 | 90 |
| 358 | 3300031250 | Ga0265331_10439788 | Ga0265331_104397882 | 90 |
| 359 | 3300035113 | Ga0373936_0049089 | Ga0373936_0049089_1317_1619 | 90 |
| 360 | 3300035170 | Ga0373943_0035373 | Ga0373943_0035373_1319_1621 | 90 |
| 361 | 3300035170 | Ga0373943_0695311 | Ga0373943_0695311_289_591 | 90 |
| 362 | 3300035172 | Ga0373955_0174640 | Ga0373955_0174640_514_816 | 90 |
| 363 | 3300035691 | Ga0373931_0210101 | Ga0373931_0210101_719_1021 | 90 |
| 364 | 3300036401 | Ga0373937_0389091 | Ga0373937_0389091_471_773 | 90 |
| 365 | 3300036401 | Ga0373937_1135505 | Ga0373937_1135505_144_446 | 90 |
| 366 | 3300037068 | Ga0373925_0148245 | Ga0373925_0148245_26_328 | 90 |
| 367 | 3300037068 | Ga0373925_0589688 | Ga0373925_0589688_352_654 | 90 |
| 368 | 3300037471 | Ga0395905_0308161 | Ga0395905_0308161_1106_1408 | 90 |
| 369 | 3300038443 | Ga0395901_1212610 | Ga0395901_1212610_346_648 | 90 |
| 370 | 3300039437 | Ga0436365_0002921 | Ga0436365_0002921_37_339 | 90 |
| 371 | 3300039437 | Ga0436365_1578341 | Ga0436365_1578341_364_666 | 90 |
| 372 | 3300039438 | Ga0436360_0121414 | Ga0436360_0121414_316_618 | 90 |
| 373 | 3300039438 | Ga0436360_0746999 | Ga0436360_0746999_5740_6042 | 90 |
| 374 | 3300039447 | Ga0436361_0719701 | Ga0436361_0719701_1714_2016 | 90 |
| 375 | 3300039450 | Ga0436363_0970116 | Ga0436363_0970116_5012_5314 | 90 |
| 376 | 3300039450 | Ga0436363_1358826 | Ga0436363_1358826_174_476 | 90 |
| 377 | 3300039450 | Ga0436363_1395887 | Ga0436363_1395887_274_576 | 90 |
| 378 | 3300039453 | Ga0436362_1075674 | Ga0436362_1075674_1577_1879 | 90 |
| 379 | 3300042876 | Ga0451577_0003351 | Ga0451577_0003351_2189_2491 | 90 |
| 380 | 3300042876 | Ga0451577_0504349 | Ga0451577_0504349_146_448 | 90 |
| 381 | 3300042876 | Ga0451577_1891989 | Ga0451577_1891989_113_415 | 90 |
| 382 | 3300044673 | Ga0453683_0191709 | Ga0453683_0191709_858_1160 | 90 |
| 383 | 3300044684 | Ga0466966_0054281 | Ga0466966_0054281_1650_1952 | 90 |
| 384 | 3300044684 | Ga0466966_0289898 | Ga0466966_0289898_330_635 | 90 |
| 385 | 3300044693 | Ga0466961_0231806 | Ga0466961_0231806_686_988 | 90 |
| 386 | 3300044693 | Ga0466961_0473093 | Ga0466961_0473093_101_406 | 90 |
| 387 | 3300044694 | Ga0466963_0017962 | Ga0466963_0017962_2769_3074 | 90 |
| 388 | 3300044694 | Ga0466963_0033689 | Ga0466963_0033689_1764_2066 | 90 |
| 389 | 3300044712 | Ga0453684_0000545 | Ga0453684_0000545_99239_99541 | 90 |
| 390 | 3300044712 | Ga0453684_0422538 | Ga0453684_0422538_104_406 | 90 |
| 391 | 3300044719 | Ga0466971_0146342 | Ga0466971_0146342_639_944 | 90 |
| 392 | 3300044842 | Ga0466957_0169672 | Ga0466957_0169672_717_1022 | 90 |
| 393 | 3300044842 | Ga0466957_0308901 | Ga0466957_0308901_317_619 | 90 |
| 394 | 3300045049 | Ga0466959_0129036 | Ga0466959_0129036_175_477 | 90 |
| 395 | 3300045049 | Ga0466959_0340009 | Ga0466959_0340009_451_753 | 90 |
| 396 | 3300045049 | Ga0466959_0457870 | Ga0466959_0457870_285_590 | 90 |
| 397 | 3300045049 | Ga0466959_1100964 | Ga0466959_1100964_120_422 | 90 |
| 398 | 3300045051 | Ga0451576_0030134 | Ga0451576_0030134_4679_4981 | 90 |
| 399 | 3300045051 | Ga0451576_0351745 | Ga0451576_0351745_747_1049 | 90 |
| 400 | 3300045051 | Ga0451576_0784513 | Ga0451576_0784513_333_635 | 90 |
| 401 | 3300045836 | Ga0466958_0596039 | Ga0466958_0596039_241_543 | 90 |
| 402 | 3300045836 | Ga0466958_0661044 | Ga0466958_0661044_365_667 | 90 |
| 403 | 3300045836 | Ga0466958_1100712 | Ga0466958_1100712_65_370 | 90 |
| 404 | 3300045976 | Ga0466967_0543479 | Ga0466967_0543479_519_824 | 90 |
| 405 | 3300046472 | Ga0495580_0171971 | Ga0495580_0171971_951_1232 | 90 |
| 406 | 3300046472 | Ga0495580_0266112 | Ga0495580_0266112_720_1022 | 90 |
| 407 | 3300046492 | Ga0495585_0591764 | Ga0495585_0591764_88_390 | 90 |
| 408 | 3300046499 | Ga0495594_0680927 | Ga0495594_0680927_100_402 | 90 |
| 409 | 3300046559 | Ga0495667_0829637 | Ga0495667_0829637_67_369 | 90 |
| 410 | 3300046663 | Ga0495635_0118526 | Ga0495635_0118526_1298_1600 | 90 |
| 411 | 3300046678 | Ga0495599_0406105 | Ga0495599_0406105_371_673 | 90 |
| 412 | 3300046684 | Ga0495669_0078748 | Ga0495669_0078748_224_526 | 90 |
| 413 | 3300046684 | Ga0495669_0249349 | Ga0495669_0249349_21_323 | 90 |
| 414 | 3300047315 | Ga0495581_0022818 | Ga0495581_0022818_2007_2309 | 90 |
| 415 | 3300047319 | Ga0495674_1293952 | Ga0495674_1293952_116_418 | 90 |
| 416 | 3300047472 | Ga0495686_0003824 | Ga0495686_0003824_3130_3441 | 90 |
| 417 | 3300047472 | Ga0495686_0005390 | Ga0495686_0005390_7711_8013 | 90 |
| 418 | 3300047472 | Ga0495686_0026007 | Ga0495686_0026007_1004_1306 | 90 |
| 419 | 3300047472 | Ga0495686_0292125 | Ga0495686_0292125_152_454 | 90 |
| 420 | 3300048903 | Ga0496100_0694447 | Ga0496100_0694447_331_633 | 90 |
| 421 | 3300048907 | Ga0496104_0135839 | Ga0496104_0135839_1040_1342 | 90 |
| 422 | 3300048907 | Ga0496104_0241759 | Ga0496104_0241759_204_506 | 90 |
| 423 | 3300048907 | Ga0496104_0396684 | Ga0496104_0396684_506_808 | 90 |
| 424 | 3300048907 | Ga0496104_1734788 | Ga0496104_1734788_156_458 | 90 |
| 425 | 3300048911 | Ga0496108_0233264 | Ga0496108_0233264_715_1017 | 90 |
| 426 | 3300048912 | Ga0496109_0024187 | Ga0496109_0024187_4513_4815 | 90 |
| 427 | 3300048913 | Ga0496110_1774734 | Ga0496110_1774734_34_336 | 90 |
| 428 | 3300048914 | Ga0496111_0192568 | Ga0496111_0192568_788_1090 | 90 |
| 429 | 3300048915 | Ga0496112_0091714 | Ga0496112_0091714_164_466 | 90 |
| 430 | 3300048915 | Ga0496112_0119936 | Ga0496112_0119936_237_539 | 90 |
| 431 | 3300048916 | Ga0496113_0144525 | Ga0496113_0144525_206_508 | 90 |
| 432 | 3300048920 | Ga0496117_0216312 | Ga0496117_0216312_41_343 | 90 |
| 433 | 3300048929 | Ga0496126_0000005 | Ga0496126_0000005_188822_189124 | 90 |
| 434 | 3300048929 | Ga0496126_0018827 | Ga0496126_0018827_5935_6240 | 90 |
| 435 | 3300049573 | Ga0501037_0165424 | Ga0501037_0165424_363_674 | 90 |
| 436 | 3300049581 | Ga0501047_0043109 | Ga0501047_0043109_3685_3996 | 90 |
| 437 | 3300049589 | Ga0501073_0047586 | Ga0501073_0047586_2521_2832 | 90 |
| 438 | 3300049742 | Ga0501080_0537198 | Ga0501080_0537198_258_569 | 90 |
| 439 | 3300049822 | Ga0501035_0765432 | Ga0501035_0765432_281_592 | 90 |
| 440 | 3300050507 | nmdc:mga05p37_220967_c1 | nmdc:mga05p37_220967_c1_1747_2049 | 90 |
| 441 | 3300050512 | nmdc:mga0n895_6814_c1 | nmdc:mga0n895_6814_c1_7100_7402 | 90 |
| 442 | 3300050513 | nmdc:mga0rr50_106_c1 | nmdc:mga0rr50_106_c1_36169_36471 | 90 |
| 443 | 3300050514 | nmdc:mga08x19_26710_c1 | nmdc:mga08x19_26710_c1_1393_1695 | 90 |
| 444 | 3300050514 | nmdc:mga08x19_8213_c1 | nmdc:mga08x19_8213_c1_2846_3148 | 90 |
| 445 | 3300050515 | nmdc:mga0a205_131827_c1 | nmdc:mga0a205_131827_c1_342_644 | 90 |
| 446 | 3300053085 | Ga0495619_0580610 | Ga0495619_0580610_376_678 | 90 |
| 447 | 3300059426 | Ga0590077_098864 | Ga0590077_098864_259_561 | 90 |
| 448 | 3300007076 | Ga0075435_100109271 | Ga0075435_1001092712 | 91 |
| 449 | 3300046517 | Ga0495630_0021830 | Ga0495630_0021830_2669_2995 | 91 |
| 450 | 3300050513 | nmdc:mga0rr50_146531_c1 | nmdc:mga0rr50_146531_c1_1319_1639 | 91 |
| 451 | 3300026078 | Ga0207702_11779850 | Ga0207702_117798502 | 93 |
| 452 | 3300004803 | Ga0058862_12769646 | Ga0058862_127696462 | 94 |
| 453 | 3300004803 | Ga0058862_12820602 | Ga0058862_128206022 | 94 |
| 454 | 3300005329 | Ga0070683_100128876 | Ga0070683_1001288762 | 94 |
| 455 | 3300005329 | Ga0070683_101138144 | Ga0070683_1011381441 | 94 |
| 456 | 3300005337 | Ga0070682_100703318 | Ga0070682_1007033181 | 94 |
| 457 | 3300005337 | Ga0070682_101224273 | Ga0070682_1012242732 | 94 |
| 458 | 3300005338 | Ga0068868_100066148 | Ga0068868_1000661482 | 94 |
| 459 | 3300005344 | Ga0070661_101304786 | Ga0070661_1013047862 | 94 |
| 460 | 3300005345 | Ga0070692_10319022 | Ga0070692_103190222 | 94 |
| 461 | 3300005366 | Ga0070659_102157780 | Ga0070659_1021577802 | 94 |
| 462 | 3300005434 | Ga0070709_10059863 | Ga0070709_100598632 | 94 |
| 463 | 3300005434 | Ga0070709_10266496 | Ga0070709_102664962 | 94 |
| 464 | 3300005435 | Ga0070714_100055894 | Ga0070714_1000558942 | 94 |
| 465 | 3300005436 | Ga0070713_100236696 | Ga0070713_1002366962 | 94 |
| 466 | 3300005436 | Ga0070713_100501452 | Ga0070713_1005014523 | 94 |
| 467 | 3300005436 | Ga0070713_101019634 | Ga0070713_1010196342 | 94 |
| 468 | 3300005437 | Ga0070710_10039958 | Ga0070710_100399582 | 94 |
| 469 | 3300005437 | Ga0070710_10400625 | Ga0070710_104006252 | 94 |
| 470 | 3300005439 | Ga0070711_100030675 | Ga0070711_1000306752 | 94 |
| 471 | 3300005439 | Ga0070711_100671184 | Ga0070711_1006711842 | 94 |
| 472 | 3300005439 | Ga0070711_100988385 | Ga0070711_1009883852 | 94 |
| 473 | 3300005439 | Ga0070711_101068061 | Ga0070711_1010680612 | 94 |
| 474 | 3300005439 | Ga0070711_101399606 | Ga0070711_1013996061 | 94 |
| 475 | 3300005458 | Ga0070681_10018593 | Ga0070681_100185936 | 94 |
| 476 | 3300005458 | Ga0070681_10505586 | Ga0070681_105055862 | 94 |
| 477 | 3300005518 | Ga0070699_101132454 | Ga0070699_1011324542 | 94 |
| 478 | 3300005530 | Ga0070679_100336113 | Ga0070679_1003361132 | 94 |
| 479 | 3300005535 | Ga0070684_100137182 | Ga0070684_1001371822 | 94 |
| 480 | 3300005535 | Ga0070684_100343930 | Ga0070684_1003439302 | 94 |
| 481 | 3300005539 | Ga0068853_100120740 | Ga0068853_1001207403 | 94 |
| 482 | 3300005539 | Ga0068853_101151329 | Ga0068853_1011513291 | 94 |
| 483 | 3300005547 | Ga0070693_100038736 | Ga0070693_1000387361 | 94 |
| 484 | 3300005547 | Ga0070693_100064127 | Ga0070693_1000641273 | 94 |
| 485 | 3300005547 | Ga0070693_100179659 | Ga0070693_1001796592 | 94 |
| 486 | 3300005547 | Ga0070693_100199901 | Ga0070693_1001999012 | 94 |
| 487 | 3300005563 | Ga0068855_100286687 | Ga0068855_1002866873 | 94 |
| 488 | 3300005563 | Ga0068855_100911847 | Ga0068855_1009118472 | 94 |
| 489 | 3300005564 | Ga0070664_101553023 | Ga0070664_1015530232 | 94 |
| 490 | 3300005577 | Ga0068857_100251604 | Ga0068857_1002516042 | 94 |
| 491 | 3300005614 | Ga0068856_100048619 | Ga0068856_1000486192 | 94 |
| 492 | 3300005614 | Ga0068856_100076571 | Ga0068856_1000765713 | 94 |
| 493 | 3300005614 | Ga0068856_102250687 | Ga0068856_1022506871 | 94 |
| 494 | 3300005616 | Ga0068852_100062115 | Ga0068852_1000621152 | 94 |
| 495 | 3300005617 | Ga0068859_101822634 | Ga0068859_1018226342 | 94 |
| 496 | 3300005718 | Ga0068866_10415730 | Ga0068866_104157302 | 94 |
| 497 | 3300006028 | Ga0070717_10145393 | Ga0070717_101453932 | 94 |
| 498 | 3300006028 | Ga0070717_10163768 | Ga0070717_101637683 | 94 |
| 499 | 3300006028 | Ga0070717_10915045 | Ga0070717_109150451 | 94 |
| 500 | 3300006028 | Ga0070717_11042856 | Ga0070717_110428562 | 94 |
| 501 | 3300006028 | Ga0070717_11366423 | Ga0070717_113664231 | 94 |
| 502 | 3300006163 | Ga0070715_10142822 | Ga0070715_101428222 | 94 |
| 503 | 3300006173 | Ga0070716_101156678 | Ga0070716_1011566782 | 94 |
| 504 | 3300006175 | Ga0070712_100081304 | Ga0070712_1000813042 | 94 |
| 505 | 3300006175 | Ga0070712_100507658 | Ga0070712_1005076582 | 94 |
| 506 | 3300006175 | Ga0070712_101002961 | Ga0070712_1010029612 | 94 |
| 507 | 3300006931 | Ga0097620_101822995 | Ga0097620_1018229952 | 94 |
| 508 | 3300007788 | Ga0099795_10595412 | Ga0099795_105954121 | 94 |
| 509 | 3300009093 | Ga0105240_10189018 | Ga0105240_101890183 | 94 |
| 510 | 3300009093 | Ga0105240_11329094 | Ga0105240_113290942 | 94 |
| 511 | 3300009093 | Ga0105240_11357719 | Ga0105240_113577192 | 94 |
| 512 | 3300009098 | Ga0105245_10010071 | Ga0105245_100100712 | 94 |
| 513 | 3300009098 | Ga0105245_10098320 | Ga0105245_100983202 | 94 |
| 514 | 3300009176 | Ga0105242_10379835 | Ga0105242_103798352 | 94 |
| 515 | 3300009545 | Ga0105237_10976396 | Ga0105237_109763961 | 94 |
| 516 | 3300009545 | Ga0105237_11097414 | Ga0105237_110974142 | 94 |
| 517 | 3300009551 | Ga0105238_10043634 | Ga0105238_100436344 | 94 |
| 518 | 3300009551 | Ga0105238_10416522 | Ga0105238_104165222 | 94 |
| 519 | 3300009551 | Ga0105238_11118620 | Ga0105238_111186202 | 94 |
| 520 | 3300010375 | Ga0105239_10235564 | Ga0105239_102355643 | 94 |
| 521 | 3300010375 | Ga0105239_10376655 | Ga0105239_103766553 | 94 |
| 522 | 3300010375 | Ga0105239_10580574 | Ga0105239_105805741 | 94 |
| 523 | 3300010375 | Ga0105239_10733870 | Ga0105239_107338702 | 94 |
| 524 | 3300010375 | Ga0105239_11018909 | Ga0105239_110189092 | 94 |
| 525 | 3300013104 | Ga0157370_10416994 | Ga0157370_104169942 | 94 |
| 526 | 3300013105 | Ga0157369_10141538 | Ga0157369_101415383 | 94 |
| 527 | 3300013105 | Ga0157369_10206775 | Ga0157369_102067752 | 94 |
| 528 | 3300013105 | Ga0157369_12607401 | Ga0157369_126074012 | 94 |
| 529 | 3300013296 | Ga0157374_10330445 | Ga0157374_103304454 | 94 |
| 530 | 3300013297 | Ga0157378_10150600 | Ga0157378_101506002 | 94 |
| 531 | 3300013306 | Ga0163162_11222473 | Ga0163162_112224732 | 94 |
| 532 | 3300013307 | Ga0157372_11496441 | Ga0157372_114964412 | 94 |
| 533 | 3300022467 | Ga0224712_10277358 | Ga0224712_102773582 | 94 |
| 534 | 3300025898 | Ga0207692_10117801 | Ga0207692_101178012 | 94 |
| 535 | 3300025899 | Ga0207642_10342227 | Ga0207642_103422272 | 94 |
| 536 | 3300025906 | Ga0207699_10309416 | Ga0207699_103094163 | 94 |
| 537 | 3300025912 | Ga0207707_10211228 | Ga0207707_102112282 | 94 |
| 538 | 3300025912 | Ga0207707_10224070 | Ga0207707_102240702 | 94 |
| 539 | 3300025915 | Ga0207693_10018113 | Ga0207693_100181135 | 94 |
| 540 | 3300025915 | Ga0207693_10087302 | Ga0207693_100873022 | 94 |
| 541 | 3300025915 | Ga0207693_11038205 | Ga0207693_110382052 | 94 |
| 542 | 3300025916 | Ga0207663_10045568 | Ga0207663_100455682 | 94 |
| 543 | 3300025916 | Ga0207663_10782463 | Ga0207663_107824632 | 94 |
| 544 | 3300025916 | Ga0207663_10882056 | Ga0207663_108820562 | 94 |
| 545 | 3300025916 | Ga0207663_11353112 | Ga0207663_113531122 | 94 |
| 546 | 3300025917 | Ga0207660_10258846 | Ga0207660_102588462 | 94 |
| 547 | 3300025921 | Ga0207652_10407811 | Ga0207652_104078111 | 94 |
| 548 | 3300025924 | Ga0207694_10132933 | Ga0207694_101329333 | 94 |
| 549 | 3300025924 | Ga0207694_10253981 | Ga0207694_102539812 | 94 |
| 550 | 3300025924 | Ga0207694_10941615 | Ga0207694_109416152 | 94 |
| 551 | 3300025927 | Ga0207687_10005215 | Ga0207687_100052158 | 94 |
| 552 | 3300025928 | Ga0207700_10190948 | Ga0207700_101909482 | 94 |
| 553 | 3300025928 | Ga0207700_10351223 | Ga0207700_103512231 | 94 |
| 554 | 3300025928 | Ga0207700_10621500 | Ga0207700_106215002 | 94 |
| 555 | 3300025928 | Ga0207700_11984593 | Ga0207700_119845931 | 94 |
| 556 | 3300025929 | Ga0207664_11460003 | Ga0207664_114600032 | 94 |
| 557 | 3300025934 | Ga0207686_10217795 | Ga0207686_102177952 | 94 |
| 558 | 3300025939 | Ga0207665_10067673 | Ga0207665_100676732 | 94 |
| 559 | 3300025944 | Ga0207661_10050019 | Ga0207661_100500192 | 94 |
| 560 | 3300025944 | Ga0207661_11512796 | Ga0207661_115127962 | 94 |
| 561 | 3300025945 | Ga0207679_10766613 | Ga0207679_107666132 | 94 |
| 562 | 3300025949 | Ga0207667_10088724 | Ga0207667_100887243 | 94 |
| 563 | 3300025949 | Ga0207667_10607939 | Ga0207667_106079392 | 94 |
| 564 | 3300025949 | Ga0207667_10744404 | Ga0207667_107444042 | 94 |
| 565 | 3300026023 | Ga0207677_10084935 | Ga0207677_100849352 | 94 |
| 566 | 3300026041 | Ga0207639_10030717 | Ga0207639_100307173 | 94 |
| 567 | 3300026041 | Ga0207639_10285024 | Ga0207639_102850242 | 94 |
| 568 | 3300026041 | Ga0207639_10429024 | Ga0207639_104290242 | 94 |
| 569 | 3300026078 | Ga0207702_10828202 | Ga0207702_108282022 | 94 |
| 570 | 3300026116 | Ga0207674_10420147 | Ga0207674_104201472 | 94 |
| 571 | 3300026142 | Ga0207698_10126407 | Ga0207698_101264072 | 94 |
| 572 | 3300034818 | Ga0373950_0030479 | Ga0373950_0030479_400_735 | 94 |
| 573 | 3300035083 | Ga0373926_0020769 | Ga0373926_0020769_133_468 | 94 |
| 574 | 3300035111 | Ga0373923_0200027 | Ga0373923_0200027_510_842 | 94 |
| 575 | 3300035111 | Ga0373923_0556468 | Ga0373923_0556468_77_412 | 94 |
| 576 | 3300035113 | Ga0373936_0011212 | Ga0373936_0011212_2808_3143 | 94 |
| 577 | 3300035113 | Ga0373936_0014935 | Ga0373936_0014935_695_1030 | 94 |
| 578 | 3300035116 | Ga0373945_0009361 | Ga0373945_0009361_2388_2723 | 94 |
| 579 | 3300035120 | Ga0373957_0195161 | Ga0373957_0195161_91_426 | 94 |
| 580 | 3300035170 | Ga0373943_0017826 | Ga0373943_0017826_2050_2385 | 94 |
| 581 | 3300035170 | Ga0373943_0194459 | Ga0373943_0194459_142_477 | 94 |
| 582 | 3300035171 | Ga0373946_0015210 | Ga0373946_0015210_76_411 | 94 |
| 583 | 3300035171 | Ga0373946_0100458 | Ga0373946_0100458_893_1228 | 94 |
| 584 | 3300035172 | Ga0373955_0233933 | Ga0373955_0233933_378_710 | 94 |
| 585 | 3300035410 | Ga0373924_0000060 | Ga0373924_0000060_8682_9017 | 94 |
| 586 | 3300035692 | Ga0373935_0055471 | Ga0373935_0055471_397_732 | 94 |
| 587 | 3300035692 | Ga0373935_0298879 | Ga0373935_0298879_640_975 | 94 |
| 588 | 3300035692 | Ga0373935_0488116 | Ga0373935_0488116_78_410 | 94 |
| 589 | 3300035695 | Ga0373927_0036557 | Ga0373927_0036557_714_1049 | 94 |
| 590 | 3300035695 | Ga0373927_0354037 | Ga0373927_0354037_502_837 | 94 |
| 591 | 3300035724 | Ga0373933_0094755 | Ga0373933_0094755_232_567 | 94 |
| 592 | 3300035724 | Ga0373933_0107629 | Ga0373933_0107629_326_658 | 94 |
| 593 | 3300035724 | Ga0373933_0272169 | Ga0373933_0272169_43_375 | 94 |
| 594 | 3300035725 | Ga0373947_0044018 | Ga0373947_0044018_721_1056 | 94 |
| 595 | 3300035725 | Ga0373947_0046455 | Ga0373947_0046455_754_1089 | 94 |
| 596 | 3300036401 | Ga0373937_0000178 | Ga0373937_0000178_26062_26394 | 94 |
| 597 | 3300036401 | Ga0373937_0260590 | Ga0373937_0260590_802_1137 | 94 |
| 598 | 3300036401 | Ga0373937_0567197 | Ga0373937_0567197_682_1014 | 94 |
| 599 | 3300036401 | Ga0373937_0622375 | Ga0373937_0622375_82_417 | 94 |
| 600 | 3300036401 | Ga0373937_1900870 | Ga0373937_1900870_32_364 | 94 |
| 601 | 3300037466 | Ga0395898_0021558 | Ga0395898_0021558_2537_2857 | 94 |
| 602 | 3300046454 | Ga0495592_0293871 | Ga0495592_0293871_227_562 | 94 |
| 603 | 3300046462 | Ga0495651_0334267 | Ga0495651_0334267_272_604 | 94 |
| 604 | 3300046463 | Ga0495653_0241397 | Ga0495653_0241397_677_1012 | 94 |
| 605 | 3300046472 | Ga0495580_0116498 | Ga0495580_0116498_919_1254 | 94 |
| 606 | 3300046473 | Ga0495582_0045146 | Ga0495582_0045146_148_483 | 94 |
| 607 | 3300046477 | Ga0495664_0354842 | Ga0495664_0354842_182_517 | 94 |
| 608 | 3300046526 | Ga0495666_0256145 | Ga0495666_0256145_153_488 | 94 |
| 609 | 3300046529 | Ga0495652_0828144 | Ga0495652_0828144_213_545 | 94 |
| 610 | 3300046531 | Ga0495665_0128552 | Ga0495665_0128552_278_613 | 94 |
| 611 | 3300046535 | Ga0495586_0080052 | Ga0495586_0080052_620_955 | 94 |
| 612 | 3300046559 | Ga0495667_0180673 | Ga0495667_0180673_421_756 | 94 |
| 613 | 3300046663 | Ga0495635_0066288 | Ga0495635_0066288_1671_2006 | 94 |
| 614 | 3300046683 | Ga0495658_0077354 | Ga0495658_0077354_253_588 | 94 |
| 615 | 3300046689 | Ga0495613_0461394 | Ga0495613_0461394_193_528 | 94 |
| 616 | 3300047319 | Ga0495674_0122318 | Ga0495674_0122318_1694_2029 | 94 |
| 617 | 3300048089 | Ga0495614_0088813 | Ga0495614_0088813_258_593 | 94 |
| 618 | 3300048903 | Ga0496100_0643019 | Ga0496100_0643019_462_794 | 94 |
| 619 | 3300048905 | Ga0496102_0183869 | Ga0496102_0183869_120_452 | 94 |
| 620 | 3300048906 | Ga0496103_0728173 | Ga0496103_0728173_121_453 | 94 |
| 621 | 3300048907 | Ga0496104_0004857 | Ga0496104_0004857_10887_11222 | 94 |
| 622 | 3300048907 | Ga0496104_0446483 | Ga0496104_0446483_76_408 | 94 |
| 623 | 3300048907 | Ga0496104_0804154 | Ga0496104_0804154_104_436 | 94 |
| 624 | 3300048910 | Ga0496107_1086388 | Ga0496107_1086388_78_410 | 94 |
| 625 | 3300048913 | Ga0496110_0263839 | Ga0496110_0263839_544_876 | 94 |
| 626 | 3300048913 | Ga0496110_0865230 | Ga0496110_0865230_114_449 | 94 |
| 627 | 3300048913 | Ga0496110_1596047 | Ga0496110_1596047_40_372 | 94 |
| 628 | 3300048914 | Ga0496111_0010060 | Ga0496111_0010060_5477_5812 | 94 |
| 629 | 3300048914 | Ga0496111_0230728 | Ga0496111_0230728_664_996 | 94 |
| 630 | 3300048915 | Ga0496112_0053293 | Ga0496112_0053293_259_594 | 94 |
| 631 | 3300048915 | Ga0496112_0187053 | Ga0496112_0187053_765_1097 | 94 |
| 632 | 3300048916 | Ga0496113_0007159 | Ga0496113_0007159_3240_3575 | 94 |
| 633 | 3300048916 | Ga0496113_0026834 | Ga0496113_0026834_3387_3719 | 94 |
| 634 | 3300048918 | Ga0496115_0632316 | Ga0496115_0632316_371_703 | 94 |
| 635 | 3300059510 | Ga0587090_081336 | Ga0587090_081336_198_518 | 94 |
| 636 | 3300059627 | Ga0587117_067172 | Ga0587117_067172_122_454 | 94 |
| 637 | 3300060344 | Ga0587071_095094 | Ga0587071_095094_73_405 | 94 |
| 638 | 3300031247 | Ga0265340_10182324 | Ga0265340_101823242 | 95 |
| 639 | 3300031249 | Ga0265339_10203016 | Ga0265339_102030161 | 95 |
| 640 | 3300044694 | Ga0466963_0543005 | Ga0466963_0543005_106_438 | 95 |
| 641 | 3300045049 | Ga0466959_0087070 | Ga0466959_0087070_1448_1780 | 95 |
| 642 | 3300048905 | Ga0496102_0048790 | Ga0496102_0048790_3225_3557 | 95 |
| 643 | 3300050512 | nmdc:mga0n895_79118_c1 | nmdc:mga0n895_79118_c1_2845_3177 | 95 |
| 644 | 3300004799 | Ga0058863_10104695 | Ga0058863_101046952 | 96 |
| 645 | 3300004800 | Ga0058861_10097431 | Ga0058861_100974312 | 96 |
| 646 | 3300004803 | Ga0058862_10156525 | Ga0058862_101565252 | 96 |
| 647 | 3300004803 | Ga0058862_12488943 | Ga0058862_124889432 | 96 |
| 648 | 3300005336 | Ga0070680_100131229 | Ga0070680_1001312292 | 96 |
| 649 | 3300005336 | Ga0070680_100184279 | Ga0070680_1001842792 | 96 |
| 650 | 3300005336 | Ga0070680_100201115 | Ga0070680_1002011152 | 96 |
| 651 | 3300005344 | Ga0070661_101186183 | Ga0070661_1011861831 | 96 |
| 652 | 3300005458 | Ga0070681_10761946 | Ga0070681_107619462 | 96 |
| 653 | 3300005458 | Ga0070681_10929653 | Ga0070681_109296531 | 96 |
| 654 | 3300005530 | Ga0070679_100260398 | Ga0070679_1002603982 | 96 |
| 655 | 3300005530 | Ga0070679_100364957 | Ga0070679_1003649572 | 96 |
| 656 | 3300005530 | Ga0070679_100447533 | Ga0070679_1004475332 | 96 |
| 657 | 3300005535 | Ga0070684_102195285 | Ga0070684_1021952852 | 96 |
| 658 | 3300005539 | Ga0068853_100163808 | Ga0068853_1001638083 | 96 |
| 659 | 3300005563 | Ga0068855_100308385 | Ga0068855_1003083852 | 96 |
| 660 | 3300005563 | Ga0068855_100447150 | Ga0068855_1004471502 | 96 |
| 661 | 3300005578 | Ga0068854_101840410 | Ga0068854_1018404102 | 96 |
| 662 | 3300005616 | Ga0068852_100186916 | Ga0068852_1001869162 | 96 |
| 663 | 3300006163 | Ga0070715_10596827 | Ga0070715_105968271 | 96 |
| 664 | 3300009093 | Ga0105240_10354494 | Ga0105240_103544943 | 96 |
| 665 | 3300009545 | Ga0105237_10085926 | Ga0105237_100859263 | 96 |
| 666 | 3300009551 | Ga0105238_10722674 | Ga0105238_107226743 | 96 |
| 667 | 3300009551 | Ga0105238_12155571 | Ga0105238_121555711 | 96 |
| 668 | 3300013100 | Ga0157373_10035887 | Ga0157373_100358874 | 96 |
| 669 | 3300013104 | Ga0157370_10016641 | Ga0157370_100166416 | 96 |
| 670 | 3300013104 | Ga0157370_10482660 | Ga0157370_104826602 | 96 |
| 671 | 3300013104 | Ga0157370_11106298 | Ga0157370_111062982 | 96 |
| 672 | 3300013104 | Ga0157370_11579951 | Ga0157370_115799512 | 96 |
| 673 | 3300013105 | Ga0157369_10748137 | Ga0157369_107481371 | 96 |
| 674 | 3300014969 | Ga0157376_11433499 | Ga0157376_114334992 | 96 |
| 675 | 3300020069 | Ga0197907_11266770 | Ga0197907_112667702 | 96 |
| 676 | 3300020070 | Ga0206356_11352823 | Ga0206356_113528232 | 96 |
| 677 | 3300020610 | Ga0154015_1176295 | Ga0154015_11762954 | 96 |
| 678 | 3300022467 | Ga0224712_10065096 | Ga0224712_100650962 | 96 |
| 679 | 3300025906 | Ga0207699_10698099 | Ga0207699_106980991 | 96 |
| 680 | 3300025912 | Ga0207707_10015609 | Ga0207707_100156092 | 96 |
| 681 | 3300025912 | Ga0207707_10156504 | Ga0207707_101565042 | 96 |
| 682 | 3300025912 | Ga0207707_10708025 | Ga0207707_107080252 | 96 |
| 683 | 3300025913 | Ga0207695_10327109 | Ga0207695_103271092 | 96 |
| 684 | 3300025913 | Ga0207695_10756816 | Ga0207695_107568162 | 96 |
| 685 | 3300025914 | Ga0207671_10363413 | Ga0207671_103634132 | 96 |
| 686 | 3300025916 | Ga0207663_10776581 | Ga0207663_107765811 | 96 |
| 687 | 3300025917 | Ga0207660_10000965 | Ga0207660_100009657 | 96 |
| 688 | 3300025917 | Ga0207660_10079653 | Ga0207660_100796533 | 96 |
| 689 | 3300025917 | Ga0207660_10281279 | Ga0207660_102812792 | 96 |
| 690 | 3300025917 | Ga0207660_10804244 | Ga0207660_108042441 | 96 |
| 691 | 3300025920 | Ga0207649_10797304 | Ga0207649_107973042 | 96 |
| 692 | 3300025921 | Ga0207652_10001244 | Ga0207652_100012442 | 96 |
| 693 | 3300025921 | Ga0207652_10447020 | Ga0207652_104470202 | 96 |
| 694 | 3300025921 | Ga0207652_10610633 | Ga0207652_106106331 | 96 |
| 695 | 3300025921 | Ga0207652_10714987 | Ga0207652_107149872 | 96 |
| 696 | 3300025924 | Ga0207694_10430026 | Ga0207694_104300263 | 96 |
| 697 | 3300025929 | Ga0207664_10564209 | Ga0207664_105642092 | 96 |
| 698 | 3300025929 | Ga0207664_10939876 | Ga0207664_109398762 | 96 |
| 699 | 3300025949 | Ga0207667_10154513 | Ga0207667_101545132 | 96 |
| 700 | 3300025949 | Ga0207667_10403086 | Ga0207667_104030862 | 96 |
| 701 | 3300026041 | Ga0207639_10592331 | Ga0207639_105923312 | 96 |
| 702 | 3300028800 | Ga0265338_10208577 | Ga0265338_102085772 | 96 |
| 703 | 3300035083 | Ga0373926_0336705 | Ga0373926_0336705_201_542 | 96 |
| 704 | 3300035119 | Ga0373956_0006894 | Ga0373956_0006894_3689_4030 | 96 |
| 705 | 3300035172 | Ga0373955_0031388 | Ga0373955_0031388_478_819 | 96 |
| 706 | 3300035692 | Ga0373935_0041183 | Ga0373935_0041183_2153_2494 | 96 |
| 707 | 3300035695 | Ga0373927_0930936 | Ga0373927_0930936_88_429 | 96 |
| 708 | 3300035725 | Ga0373947_0176418 | Ga0373947_0176418_990_1331 | 96 |
| 709 | 3300036401 | Ga0373937_0015152 | Ga0373937_0015152_3716_4057 | 96 |
| 710 | 3300036401 | Ga0373937_0694329 | Ga0373937_0694329_427_768 | 96 |
| 711 | 3300037068 | Ga0373925_0019116 | Ga0373925_0019116_2354_2695 | 96 |
| 712 | 3300037466 | Ga0395898_0512024 | Ga0395898_0512024_336_671 | 96 |
| 713 | 3300044694 | Ga0466963_0000697 | Ga0466963_0000697_8563_8898 | 96 |
| 714 | 3300044842 | Ga0466957_0000091 | Ga0466957_0000091_9970_10332 | 96 |
| 715 | 3300045836 | Ga0466958_1091681 | Ga0466958_1091681_18_353 | 96 |
| 716 | 3300045976 | Ga0466967_0004330 | Ga0466967_0004330_4601_4936 | 96 |
| 717 | 3300045976 | Ga0466967_0058846 | Ga0466967_0058846_740_1075 | 96 |
| 718 | 3300046684 | Ga0495669_0111833 | Ga0495669_0111833_180_521 | 96 |
| 719 | 3300047317 | Ga0495604_0033543 | Ga0495604_0033543_744_1085 | 96 |
| 720 | 3300047322 | Ga0495680_0821731 | Ga0495680_0821731_12_353 | 96 |
| 721 | 3300048915 | Ga0496112_0008453 | Ga0496112_0008453_8235_8579 | 96 |
| 722 | 3300048916 | Ga0496113_0632610 | Ga0496113_0632610_282_626 | 96 |
| 723 | 3300053077 | Ga0495601_0068298 | Ga0495601_0068298_1879_2220 | 96 |
| 724 | 3300059490 | Ga0587066_124454 | Ga0587066_124454_145_480 | 96 |
| 725 | 3300059503 | Ga0587080_101076 | Ga0587080_101076_20_355 | 96 |
| 726 | 3300059513 | Ga0587094_079710 | Ga0587094_079710_20_355 | 96 |
| 727 | 3300059626 | Ga0587115_086288 | Ga0587115_086288_35_370 | 96 |
| 728 | 3300059644 | Ga0587075_026980 | Ga0587075_026980_354_689 | 96 |
| 729 | 3300059645 | Ga0587076_096282 | Ga0587076_096282_235_570 | 96 |
| 730 | 3300061719 | Ga0466962_0331977 | Ga0466962_0331977_251_586 | 96 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7qhm-assembly1.cif.gz_L | cytochrome bcc-aa3 supercomplex (respiratory supercomplex iii2/iv2) from corynebacterium glutamicum (stigmatellin and azide bound) | 0.8379 | 1 | 61 |
| 7qhm-assembly1.cif.gz_L | cytochrome bcc-aa3 supercomplex (respiratory supercomplex iii2/iv2) from corynebacterium glutamicum (stigmatellin and azide bound) | 0.8019 | 1 | 61 |
| 7q21-assembly1.cif.gz_k | iii2-iv2 respiratory supercomplex from corynebacterium glutamicum | 0.7734 | 1 | 61 |
| 6zkp-assembly1.cif.gz_K | native complex i, open1 | 0.772 | 8 | 79 |
| 7q21-assembly1.cif.gz_k | iii2-iv2 respiratory supercomplex from corynebacterium glutamicum | 0.7432 | 1 | 61 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_D3ZWV8_556_669_6.10.140.680 | Special;Helix non-globular;Helix Hairpins; | 0.8814 | 4 | 51 | 6.10.140.680 |
| af_A0A0R0F7N4_1_104_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.8483 | 1 | 80 | 1.20.1250.20 |
| af_A0A0G2L969_41_315_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.8159 | 4 | 61 | 1.25.40.10 |
| 5x19C01 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.8039 | 1 | 55 | 1.10.287.70 |
| 6nmpP01 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.8039 | 1 | 55 | 1.10.287.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A380CJQ0-F1-model_v4 | Preprotein translocase subunit SecE | 0.8794 | 1 | 59 |
GO:0016020
|
| AF-A0A7G5ZSZ6-F1-model_v4 | MFS transporter | 0.8707 | 1 | 80 |
GO:0016020
|
| AF-A0A7Z8ABI3-F1-model_v4 | deleted | 0.8027 | 3 | 76 |
|
| AF-A0A378IH31-F1-model_v4 | Putative monovalent cation/H+ antiporter subunit G | 0.8014 | 4 | 80 |
GO:0015297
GO:0016020 GO:0098662 |
| AF-F8PY65-F1-model_v4 | DUF202 domain-containing protein | 0.7998 | 4 | 77 |
GO:0000329
GO:0012505 GO:0033254 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar