F477909

General Info

Members Datasets Scaffolds Average Seq Length
730 269 729 100

Family's Representative Sequence

Representative Sequence 3300005530|Ga0070679_100260398|Ga0070679_1002603982
Length 114
Sequence MVPLSWYLILSTILFCMGVFGFLLKRNIITNFMSIELMLNAVNLSFVAFANYWHARAVQGVTPAGVEKALSGQVFVFFVMVVXXXEAAVGLAIIIAVFRTRETLNVDRVNLLKL

Samples

Sample ID Description Type Environment
1 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
96 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
97 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
98 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
99 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
100 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
101 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
103 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
104 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
105 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
155 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
156 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
157 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
158 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
159 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
160 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
161 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
162 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
163 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
164 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
165 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
166 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
167 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
168 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
169 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
170 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
171 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
172 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
173 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
174 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
175 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
176 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
177 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
180 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
181 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
182 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
183 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
184 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
185 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
186 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
187 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
188 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
189 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
190 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
191 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
192 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
193 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
194 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
195 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
196 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
197 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
198 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
199 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
200 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
201 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
202 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
203 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
204 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
205 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
206 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
207 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
208 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
209 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
210 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
211 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
212 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
213 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
214 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
215 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
216 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
217 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
218 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
219 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
220 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
221 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
222 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
223 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
224 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
225 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
226 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
227 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
228 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
229 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
230 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
231 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
232 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
233 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
234 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
235 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
236 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
237 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
238 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
239 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
240 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
241 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
242 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
243 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
244 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
245 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
249 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
250 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
251 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
252 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
253 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
254 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
255 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
256 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
257 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
258 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
259 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
262 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
263 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
264 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
265 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
266 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
267 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
268 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
269 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.12
Metatranscriptomes 2.74
Isolates 0.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.14
Nodule 0
Rhizoplane 4.79
Rhizosphere 93.29
Stem 0
Stem Tuber 0
Unclassified 1.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058863_10104695 3300004799 Bacteria 973
2 Ga0058861_10097431 3300004800 Bacteria 656
3 Ga0058862_10156525 3300004803 Bacteria 2374
4 Ga0058862_12488943 3300004803 Bacteria 750
5 Ga0058862_12769646 3300004803 Bacteria 838
6 Ga0058862_12820602 3300004803 Bacteria 838
7 Ga0065714_10251664 3300005288 Bacteria 774
8 Ga0065712_10023735 3300005290 Bacteria 1687
9 Ga0065715_10231730 3300005293 Unclassified 1231
10 Ga0070658_10000021 3300005327 Bacteria 187218
11 Ga0070658_10001527 3300005327 Bacteria 19609
12 Ga0070658_10005185 3300005327 Bacteria 10604
13 Ga0070658_10016209 3300005327 Bacteria 5962
14 Ga0070658_10016628 3300005327 Bacteria 5887
15 Ga0070658_10426595 3300005327 Unclassified 1141
16 Ga0070658_10539021 3300005327 Bacteria 1010
17 Ga0070658_11143292 3300005327 Bacteria 677
18 Ga0070658_11313985 3300005327 Unclassified 628
19 Ga0070658_11377893 3300005327 Bacteria 612
20 Ga0070658_11720594 3300005327 Bacteria 543
21 Ga0070683_100059316 3300005329 Bacteria 3555
22 Ga0070683_100122154 3300005329 Bacteria 2461
23 Ga0070683_100128876 3300005329 Bacteria 2393
24 Ga0070683_101138144 3300005329 Bacteria 750
25 Ga0070683_101626501 3300005329 Bacteria 621
26 Ga0070670_100026689 3300005331 Bacteria 4969
27 Ga0068869_101052533 3300005334 Bacteria 710
28 Ga0070680_100024410 3300005336 Bacteria 4829
29 Ga0070680_100131229 3300005336 Bacteria 2096
30 Ga0070680_100184279 3300005336 Bacteria 1758
31 Ga0070680_100201115 3300005336 Bacteria 1680
32 Ga0070680_100258121 3300005336 Bacteria 1474
33 Ga0070680_101192435 3300005336 Bacteria 658
34 Ga0070680_101928400 3300005336 Bacteria 512
35 Ga0070682_100437889 3300005337 Bacteria 998
36 Ga0070682_100703318 3300005337 Bacteria 811
37 Ga0070682_101224273 3300005337 Bacteria 635
38 Ga0068868_100066148 3300005338 Bacteria 2873
39 Ga0068868_100981898 3300005338 Bacteria 772
40 Ga0070660_100021869 3300005339 Bacteria 4723
41 Ga0070660_100052804 3300005339 Bacteria 3134
42 Ga0070660_100053595 3300005339 Bacteria 3112
43 Ga0070660_100067592 3300005339 Bacteria 2784
44 Ga0070689_100284828 3300005340 Bacteria 1372
45 Ga0070691_10283669 3300005341 Bacteria 899
46 Ga0070691_10644028 3300005341 Bacteria 630
47 Ga0070661_100060557 3300005344 Bacteria 2778
48 Ga0070661_100103803 3300005344 Bacteria 2117
49 Ga0070661_100361545 3300005344 Bacteria 1141
50 Ga0070661_101186183 3300005344 Bacteria 638
51 Ga0070661_101304786 3300005344 Bacteria 609
52 Ga0070661_101782562 3300005344 Bacteria 522
53 Ga0070692_10319022 3300005345 Bacteria 955
54 Ga0070675_100697949 3300005354 Bacteria 924
55 Ga0070673_100492715 3300005364 Bacteria 1107
56 Ga0070688_100175746 3300005365 Bacteria 1481
57 Ga0070659_100015290 3300005366 Bacteria 5746
58 Ga0070659_100028416 3300005366 Bacteria 4319
59 Ga0070659_100036562 3300005366 Bacteria 3828
60 Ga0070659_102157780 3300005366 Bacteria 501
61 Ga0070709_10034508 3300005434 Bacteria 3068
62 Ga0070709_10059863 3300005434 Bacteria 2419
63 Ga0070709_10182778 3300005434 Bacteria 1474
64 Ga0070709_10266496 3300005434 Bacteria 1240
65 Ga0070709_10935559 3300005434 Bacteria 687
66 Ga0070709_11365834 3300005434 Bacteria 573
67 Ga0070714_100055894 3300005435 Bacteria 3374
68 Ga0070714_100145658 3300005435 Bacteria 2130
69 Ga0070714_100159821 3300005435 Bacteria 2038
70 Ga0070714_100517737 3300005435 Bacteria 1139
71 Ga0070714_100779067 3300005435 Bacteria 925
72 Ga0070714_100826219 3300005435 Bacteria 898
73 Ga0070714_100999944 3300005435 Bacteria 814
74 Ga0070713_100045457 3300005436 Bacteria 3598
75 Ga0070713_100236696 3300005436 Bacteria 1661
76 Ga0070713_100501452 3300005436 Bacteria 1145
77 Ga0070713_101019634 3300005436 Bacteria 799
78 Ga0070710_10039958 3300005437 Bacteria 2583
79 Ga0070710_10400625 3300005437 Bacteria 920
80 Ga0070711_100030675 3300005439 Bacteria 3562
81 Ga0070711_100124377 3300005439 Bacteria 1913
82 Ga0070711_100671184 3300005439 Bacteria 870
83 Ga0070711_100988385 3300005439 Bacteria 721
84 Ga0070711_101068061 3300005439 Bacteria 695
85 Ga0070711_101399606 3300005439 Bacteria 609
86 Ga0070708_100123940 3300005445 Bacteria 2386
87 Ga0070663_100027550 3300005455 Bacteria 3860
88 Ga0070663_100146109 3300005455 Bacteria 1809
89 Ga0070663_100313252 3300005455 Bacteria 1260
90 Ga0070678_100246023 3300005456 Bacteria 1497
91 Ga0070678_101258375 3300005456 Bacteria 687
92 Ga0070662_101207400 3300005457 Bacteria 650
93 Ga0070681_10018593 3300005458 Bacteria 6948
94 Ga0070681_10077780 3300005458 Bacteria 3274
95 Ga0070681_10505586 3300005458 Bacteria 1122
96 Ga0070681_10761946 3300005458 Bacteria 885
97 Ga0070681_10877499 3300005458 Bacteria 815
98 Ga0070681_10929653 3300005458 Bacteria 788
99 Ga0068867_100091597 3300005459 Bacteria 2308
100 Ga0070685_10222409 3300005466 Bacteria 1238
101 Ga0070699_101132454 3300005518 Bacteria 718
102 Ga0070679_100019150 3300005530 Bacteria 6651
103 Ga0070679_100048098 3300005530 Bacteria 4250
104 Ga0070679_100060065 3300005530 Bacteria 3789
105 Ga0070679_100260398 3300005530 Bacteria 1690
106 Ga0070679_100336113 3300005530 Bacteria 1459
107 Ga0070679_100364957 3300005530 Bacteria 1391
108 Ga0070679_100447533 3300005530 Bacteria 1236
109 Ga0070679_101041294 3300005530 Bacteria 763
110 Ga0070684_100055613 3300005535 Bacteria 3451
111 Ga0070684_100137182 3300005535 Bacteria 2210
112 Ga0070684_100343930 3300005535 Bacteria 1371
113 Ga0070684_100460762 3300005535 Bacteria 1175
114 Ga0070684_101116119 3300005535 Bacteria 741
115 Ga0070684_102195285 3300005535 Bacteria 521
116 Ga0070697_100001009 3300005536 Bacteria 21253
117 Ga0068853_100000039 3300005539 Bacteria 107039
118 Ga0068853_100111405 3300005539 Bacteria 2431
119 Ga0068853_100120740 3300005539 Bacteria 2337
120 Ga0068853_100157725 3300005539 Bacteria 2045
121 Ga0068853_100163808 3300005539 Bacteria 2008
122 Ga0068853_101151329 3300005539 Bacteria 748
123 Ga0070695_100035311 3300005545 Bacteria 3140
124 Ga0070696_100046106 3300005546 Bacteria 3022
125 Ga0070696_100232963 3300005546 Bacteria 1386
126 Ga0070693_100038736 3300005547 Bacteria 2666
127 Ga0070693_100064127 3300005547 Bacteria 2143
128 Ga0070693_100179659 3300005547 Bacteria 1362
129 Ga0070693_100199901 3300005547 Bacteria 1297
130 Ga0070693_101319079 3300005547 Bacteria 558
131 Ga0070704_100236821 3300005549 Bacteria 1492
132 Ga0068855_100002031 3300005563 Bacteria 25100
133 Ga0068855_100002974 3300005563 Bacteria 20712
134 Ga0068855_100025783 3300005563 Bacteria 7030
135 Ga0068855_100036159 3300005563 Bacteria 5880
136 Ga0068855_100233982 3300005563 Bacteria 2055
137 Ga0068855_100286687 3300005563 Bacteria 1826
138 Ga0068855_100308385 3300005563 Bacteria 1752
139 Ga0068855_100370291 3300005563 Bacteria 1575
140 Ga0068855_100447150 3300005563 Bacteria 1411
141 Ga0068855_100461662 3300005563 Bacteria 1385
142 Ga0068855_100911847 3300005563 Bacteria 928
143 Ga0070664_100048410 3300005564 Bacteria 3593
144 Ga0070664_101169579 3300005564 Bacteria 725
145 Ga0070664_101274390 3300005564 Bacteria 694
146 Ga0070664_101553023 3300005564 Bacteria 627
147 Ga0068857_100018918 3300005577 Bacteria 6043
148 Ga0068857_100039759 3300005577 Bacteria 4168
149 Ga0068857_100109110 3300005577 Bacteria 2487
150 Ga0068857_100251604 3300005577 Bacteria 1620
151 Ga0068854_100000258 3300005578 Bacteria 36173
152 Ga0068854_100019073 3300005578 Bacteria 4615
153 Ga0068854_100578405 3300005578 Bacteria 956
154 Ga0068854_100875244 3300005578 Bacteria 788
155 Ga0068854_101840410 3300005578 Bacteria 556
156 Ga0068856_100048619 3300005614 Bacteria 4181
157 Ga0068856_100076571 3300005614 Bacteria 3314
158 Ga0068856_100453182 3300005614 Bacteria 1304
159 Ga0068856_100458801 3300005614 Bacteria 1295
160 Ga0068856_102250687 3300005614 Bacteria 554
161 Ga0068852_100062115 3300005616 Bacteria 3248
162 Ga0068852_100086378 3300005616 Bacteria 2796
163 Ga0068852_100145658 3300005616 Bacteria 2197
164 Ga0068852_100147364 3300005616 Bacteria 2185
165 Ga0068852_100165953 3300005616 Bacteria 2066
166 Ga0068852_100186916 3300005616 Bacteria 1952
167 Ga0068852_102607847 3300005616 Bacteria 525
168 Ga0068859_101175738 3300005617 Bacteria 845
169 Ga0068859_101822634 3300005617 Bacteria 672
170 Ga0068864_102357524 3300005618 Bacteria 539
171 Ga0068866_10415730 3300005718 Bacteria 871
172 Ga0068866_11452197 3300005718 Bacteria 503
173 Ga0068858_102330429 3300005842 Bacteria 529
174 Ga0068860_100782660 3300005843 Bacteria 967
175 Ga0068862_102744309 3300005844 Unclassified 504
176 Ga0070717_10050882 3300006028 Bacteria 3407
177 Ga0070717_10145393 3300006028 Bacteria 2048
178 Ga0070717_10163768 3300006028 Bacteria 1931
179 Ga0070717_10463503 3300006028 Bacteria 1143
180 Ga0070717_10915045 3300006028 Bacteria 798
181 Ga0070717_11042856 3300006028 Bacteria 745
182 Ga0070717_11366423 3300006028 Bacteria 643
183 Ga0070717_11551897 3300006028 Unclassified 600
184 Ga0070715_10142822 3300006163 Bacteria 1165
185 Ga0070715_10596827 3300006163 Bacteria 647
186 Ga0070716_101156678 3300006173 Bacteria 619
187 Ga0070716_101648856 3300006173 Bacteria 528
188 Ga0070712_100081304 3300006175 Bacteria 2347
189 Ga0070712_100126921 3300006175 Bacteria 1928
190 Ga0070712_100507658 3300006175 Bacteria 1011
191 Ga0070712_101002961 3300006175 Bacteria 723
192 Ga0097621_100052895 3300006237 Bacteria 3309
193 Ga0075433_10000204 3300006852 Bacteria 33250
194 Ga0075434_100000356 3300006871 Bacteria 33159
195 Ga0075434_101514182 3300006871 Bacteria 680
196 Ga0068865_100225776 3300006881 Bacteria 1466
197 Ga0075436_100013552 3300006914 Bacteria 5584
198 Ga0075436_100035059 3300006914 Bacteria 3461
199 Ga0075436_100193672 3300006914 Bacteria 1439
200 Ga0097620_101175714 3300006931 Bacteria 845
201 Ga0097620_101822995 3300006931 Bacteria 672
202 Ga0075435_100001266 3300007076 Bacteria 16211
203 Ga0075435_100109271 3300007076 Bacteria 2298
204 Ga0075435_100863114 3300007076 Bacteria 789
205 Ga0075435_101381666 3300007076 Bacteria 617
206 Ga0099795_10595412 3300007788 Bacteria 526
207 Ga0105240_10002452 3300009093 Bacteria 29804
208 Ga0105240_10006173 3300009093 Bacteria 17661
209 Ga0105240_10038871 3300009093 Bacteria 6100
210 Ga0105240_10139712 3300009093 Bacteria 2897
211 Ga0105240_10189018 3300009093 Bacteria 2423
212 Ga0105240_10274102 3300009093 Bacteria 1941
213 Ga0105240_10354494 3300009093 Bacteria 1664
214 Ga0105240_10482419 3300009093 Bacteria 1382
215 Ga0105240_10516923 3300009093 Bacteria 1325
216 Ga0105240_11282757 3300009093 Bacteria 773
217 Ga0105240_11329094 3300009093 Bacteria 757
218 Ga0105240_11357719 3300009093 Bacteria 748
219 Ga0105245_10010071 3300009098 Bacteria 8237
220 Ga0105245_10098320 3300009098 Bacteria 2704
221 Ga0105247_10242747 3300009101 Bacteria 1228
222 Ga0114129_10237997 3300009147 Bacteria 2448
223 Ga0105241_10069755 3300009174 Bacteria 2726
224 Ga0105241_10258877 3300009174 Bacteria 1478
225 Ga0105241_10403098 3300009174 Bacteria 1200
226 Ga0105241_10555164 3300009174 Bacteria 1032
227 Ga0105241_11716209 3300009174 Bacteria 610
228 Ga0105242_10080073 3300009176 Bacteria 2729
229 Ga0105242_10379835 3300009176 Bacteria 1313
230 Ga0105248_10164155 3300009177 Bacteria 2504
231 Ga0105248_11353131 3300009177 Bacteria 805
232 Ga0105237_10085926 3300009545 Bacteria 3136
233 Ga0105237_10136511 3300009545 Bacteria 2447
234 Ga0105237_10976396 3300009545 Bacteria 854
235 Ga0105237_11097414 3300009545 Bacteria 802
236 Ga0105238_10043634 3300009551 Bacteria 4537
237 Ga0105238_10049681 3300009551 Bacteria 4223
238 Ga0105238_10082207 3300009551 Bacteria 3211
239 Ga0105238_10180185 3300009551 Bacteria 2090
240 Ga0105238_10280111 3300009551 Bacteria 1649
241 Ga0105238_10416522 3300009551 Bacteria 1338
242 Ga0105238_10569902 3300009551 Bacteria 1138
243 Ga0105238_10722674 3300009551 Bacteria 1009
244 Ga0105238_11118620 3300009551 Bacteria 811
245 Ga0105238_12155571 3300009551 Bacteria 592
246 Ga0105249_11480188 3300009553 Bacteria 751
247 Ga0105239_10235564 3300010375 Bacteria 2054
248 Ga0105239_10376655 3300010375 Bacteria 1604
249 Ga0105239_10580574 3300010375 Bacteria 1278
250 Ga0105239_10733870 3300010375 Bacteria 1130
251 Ga0105239_11018909 3300010375 Bacteria 952
252 Ga0105239_11210750 3300010375 Unclassified 870
253 Ga0157373_10035887 3300013100 Bacteria 3559
254 Ga0157373_10242595 3300013100 Bacteria 1274
255 Ga0157371_10506917 3300013102 Bacteria 891
256 Ga0157371_11446277 3300013102 Bacteria 535
257 Ga0157370_10016641 3300013104 Bacteria 7440
258 Ga0157370_10037753 3300013104 Bacteria 4679
259 Ga0157370_10039723 3300013104 Bacteria 4546
260 Ga0157370_10040309 3300013104 Bacteria 4509
261 Ga0157370_10136036 3300013104 Bacteria 2290
262 Ga0157370_10416994 3300013104 Bacteria 1235
263 Ga0157370_10482660 3300013104 Bacteria 1139
264 Ga0157370_10530042 3300013104 Bacteria 1080
265 Ga0157370_11106298 3300013104 Bacteria 716
266 Ga0157370_11328794 3300013104 Bacteria 647
267 Ga0157370_11579951 3300013104 Bacteria 589
268 Ga0157369_10016136 3300013105 Bacteria 8407
269 Ga0157369_10049348 3300013105 Bacteria 4563
270 Ga0157369_10050583 3300013105 Bacteria 4500
271 Ga0157369_10134997 3300013105 Bacteria 2613
272 Ga0157369_10141538 3300013105 Bacteria 2545
273 Ga0157369_10206775 3300013105 Bacteria 2058
274 Ga0157369_10234269 3300013105 Bacteria 1919
275 Ga0157369_10315653 3300013105 Bacteria 1625
276 Ga0157369_10748137 3300013105 Bacteria 1006
277 Ga0157369_10756414 3300013105 Bacteria 999
278 Ga0157369_11120341 3300013105 Bacteria 804
279 Ga0157369_11468977 3300013105 Bacteria 694
280 Ga0157369_12607401 3300013105 Bacteria 511
281 Ga0157374_10222173 3300013296 Bacteria 1854
282 Ga0157374_10234187 3300013296 Bacteria 1805
283 Ga0157374_10266885 3300013296 Bacteria 1687
284 Ga0157374_10330445 3300013296 Bacteria 1512
285 Ga0157374_10484919 3300013296 Bacteria 1240
286 Ga0157374_10841260 3300013296 Bacteria 934
287 Ga0157378_10150600 3300013297 Bacteria 2167
288 Ga0157378_10980765 3300013297 Bacteria 879
289 Ga0163162_10703002 3300013306 Bacteria 1132
290 Ga0163162_11222473 3300013306 Bacteria 853
291 Ga0157372_10016591 3300013307 Bacteria 7902
292 Ga0157372_10059678 3300013307 Bacteria 4267
293 Ga0157372_10068956 3300013307 Bacteria 3977
294 Ga0157372_10084718 3300013307 Bacteria 3593
295 Ga0157372_10103770 3300013307 Bacteria 3249
296 Ga0157372_10166798 3300013307 Bacteria 2547
297 Ga0157372_10647794 3300013307 Bacteria 1230
298 Ga0157372_11496441 3300013307 Bacteria 778
299 Ga0157372_11935923 3300013307 Bacteria 678
300 Ga0163163_10017684 3300014325 Bacteria 6656
301 Ga0163163_10433771 3300014325 Bacteria 1373
302 Ga0157380_10005417 3300014326 Bacteria 8912
303 Ga0157377_10261030 3300014745 Bacteria 1127
304 Ga0157377_10636004 3300014745 Bacteria 766
305 Ga0157379_10000835 3300014968 Bacteria 24925
306 Ga0157376_11433499 3300014969 Bacteria 723
307 Ga0157376_13045567 3300014969 Bacteria 507
308 Ga0157376_13088103 3300014969 Bacteria 504
309 Ga0197907_11266770 3300020069 Bacteria 679
310 Ga0206356_11352823 3300020070 Bacteria 1090
311 Ga0154015_1176295 3300020610 Bacteria 2832
312 Ga0213873_10004918 3300021358 Bacteria 2525
313 Ga0213872_10005723 3300021361 Bacteria 6330
314 Ga0213872_10076671 3300021361 Bacteria 1503
315 Ga0213872_10096967 3300021361 Bacteria 1316
316 Ga0213874_10045098 3300021377 Bacteria 1334
317 Ga0213876_10221330 3300021384 Bacteria 1006
318 Ga0213871_10007347 3300021441 Bacteria 2378
319 Ga0213871_10078938 3300021441 Bacteria 940
320 Ga0224712_10065096 3300022467 Bacteria 1464
321 Ga0224712_10277358 3300022467 Bacteria 780
322 Ga0224569_100853 3300022732 Bacteria 2579
323 Ga0228598_1001012 3300024227 Bacteria 6154
324 Ga0209233_1027448 3300025261 Bacteria 1379
325 Ga0207692_10117801 3300025898 Bacteria 1483
326 Ga0207642_10342227 3300025899 Bacteria 880
327 Ga0207688_10906671 3300025901 Bacteria 558
328 Ga0207647_10001986 3300025904 Bacteria 15638
329 Ga0207647_10052108 3300025904 Bacteria 2527
330 Ga0207685_10176170 3300025905 Bacteria 988
331 Ga0207699_10113868 3300025906 Bacteria 1738
332 Ga0207699_10309416 3300025906 Bacteria 1105
333 Ga0207699_10698099 3300025906 Bacteria 743
334 Ga0207705_10000041 3300025909 Bacteria 183375
335 Ga0207705_10001724 3300025909 Bacteria 17347
336 Ga0207705_10002780 3300025909 Bacteria 13376
337 Ga0207705_10004200 3300025909 Bacteria 10926
338 Ga0207705_10009906 3300025909 Bacteria 6939
339 Ga0207705_10013162 3300025909 Bacteria 5970
340 Ga0207705_10301948 3300025909 Bacteria 1228
341 Ga0207705_10687362 3300025909 Bacteria 795
342 Ga0207705_10824445 3300025909 Bacteria 720
343 Ga0207654_10352879 3300025911 Bacteria 1013
344 Ga0207707_10015609 3300025912 Bacteria 6616
345 Ga0207707_10156504 3300025912 Bacteria 1993
346 Ga0207707_10201765 3300025912 Bacteria 1734
347 Ga0207707_10211228 3300025912 Bacteria 1690
348 Ga0207707_10224070 3300025912 Bacteria 1637
349 Ga0207707_10708025 3300025912 Bacteria 845
350 Ga0207707_10925611 3300025912 Bacteria 719
351 Ga0207695_10000589 3300025913 Bacteria 73210
352 Ga0207695_10013166 3300025913 Bacteria 9871
353 Ga0207695_10026761 3300025913 Bacteria 6432
354 Ga0207695_10037654 3300025913 Bacteria 5217
355 Ga0207695_10044746 3300025913 Bacteria 4706
356 Ga0207695_10279162 3300025913 Bacteria 1564
357 Ga0207695_10327109 3300025913 Bacteria 1422
358 Ga0207695_10660590 3300025913 Bacteria 926
359 Ga0207695_10756816 3300025913 Bacteria 852
360 Ga0207695_10902404 3300025913 Bacteria 763
361 Ga0207671_10096424 3300025914 Bacteria 2235
362 Ga0207671_10363413 3300025914 Bacteria 1149
363 Ga0207693_10018113 3300025915 Bacteria 5612
364 Ga0207693_10018216 3300025915 Bacteria 5594
365 Ga0207693_10087302 3300025915 Bacteria 2444
366 Ga0207693_11038205 3300025915 Bacteria 625
367 Ga0207693_11347948 3300025915 Bacteria 532
368 Ga0207663_10045568 3300025916 Bacteria 2698
369 Ga0207663_10281030 3300025916 Bacteria 1236
370 Ga0207663_10369799 3300025916 Bacteria 1090
371 Ga0207663_10776581 3300025916 Bacteria 762
372 Ga0207663_10782463 3300025916 Bacteria 759
373 Ga0207663_10882056 3300025916 Bacteria 715
374 Ga0207663_11353112 3300025916 Bacteria 573
375 Ga0207660_10000965 3300025917 Bacteria 19025
376 Ga0207660_10079653 3300025917 Bacteria 2403
377 Ga0207660_10152967 3300025917 Bacteria 1774
378 Ga0207660_10258846 3300025917 Bacteria 1375
379 Ga0207660_10281279 3300025917 Bacteria 1320
380 Ga0207660_10804244 3300025917 Bacteria 767
381 Ga0207657_10022317 3300025919 Bacteria 5926
382 Ga0207657_10027462 3300025919 Bacteria 5212
383 Ga0207657_10040613 3300025919 Bacteria 4120
384 Ga0207657_10791997 3300025919 Bacteria 733
385 Ga0207657_11156524 3300025919 Bacteria 590
386 Ga0207649_10077225 3300025920 Bacteria 2145
387 Ga0207649_10797304 3300025920 Bacteria 737
388 Ga0207652_10001244 3300025921 Bacteria 22728
389 Ga0207652_10003556 3300025921 Bacteria 12862
390 Ga0207652_10057634 3300025921 Bacteria 3346
391 Ga0207652_10407811 3300025921 Bacteria 1226
392 Ga0207652_10447020 3300025921 Bacteria 1165
393 Ga0207652_10610633 3300025921 Bacteria 977
394 Ga0207652_10714987 3300025921 Bacteria 893
395 Ga0207694_10032945 3300025924 Bacteria 3969
396 Ga0207694_10132933 3300025924 Bacteria 1995
397 Ga0207694_10135872 3300025924 Bacteria 1975
398 Ga0207694_10253981 3300025924 Bacteria 1439
399 Ga0207694_10430026 3300025924 Bacteria 1100
400 Ga0207694_10941615 3300025924 Bacteria 731
401 Ga0207650_10035262 3300025925 Bacteria 3631
402 Ga0207659_11182232 3300025926 Bacteria 658
403 Ga0207687_10005215 3300025927 Bacteria 8616
404 Ga0207700_10190948 3300025928 Bacteria 1721
405 Ga0207700_10351223 3300025928 Bacteria 1284
406 Ga0207700_10621500 3300025928 Bacteria 962
407 Ga0207700_10772005 3300025928 Bacteria 859
408 Ga0207700_11984593 3300025928 Bacteria 509
409 Ga0207664_10119001 3300025929 Bacteria 2208
410 Ga0207664_10158631 3300025929 Bacteria 1928
411 Ga0207664_10224962 3300025929 Bacteria 1629
412 Ga0207664_10564209 3300025929 Bacteria 1022
413 Ga0207664_10939876 3300025929 Bacteria 776
414 Ga0207664_11011735 3300025929 Bacteria 745
415 Ga0207664_11460003 3300025929 Bacteria 605
416 Ga0207690_10003497 3300025932 Bacteria 9367
417 Ga0207690_10248307 3300025932 Bacteria 1373
418 Ga0207706_10876269 3300025933 Bacteria 759
419 Ga0207686_10217795 3300025934 Bacteria 1376
420 Ga0207670_10357465 3300025936 Bacteria 1158
421 Ga0207704_10352984 3300025938 Bacteria 1146
422 Ga0207665_10067673 3300025939 Bacteria 2432
423 Ga0207665_10366344 3300025939 Bacteria 1091
424 Ga0207711_10344175 3300025941 Bacteria 1380
425 Ga0207711_11013751 3300025941 Bacteria 770
426 Ga0207689_10622950 3300025942 Bacteria 908
427 Ga0207661_10050019 3300025944 Bacteria 3328
428 Ga0207661_10129450 3300025944 Bacteria 2160
429 Ga0207661_10324117 3300025944 Bacteria 1385
430 Ga0207661_11512796 3300025944 Bacteria 615
431 Ga0207679_10279713 3300025945 Bacteria 1431
432 Ga0207679_10766613 3300025945 Bacteria 878
433 Ga0207667_10005534 3300025949 Bacteria 15417
434 Ga0207667_10008043 3300025949 Bacteria 12579
435 Ga0207667_10010759 3300025949 Bacteria 10671
436 Ga0207667_10053497 3300025949 Bacteria 4248
437 Ga0207667_10088724 3300025949 Bacteria 3197
438 Ga0207667_10092427 3300025949 Bacteria 3124
439 Ga0207667_10154513 3300025949 Bacteria 2361
440 Ga0207667_10269380 3300025949 Bacteria 1741
441 Ga0207667_10403086 3300025949 Bacteria 1392
442 Ga0207667_10430858 3300025949 Bacteria 1341
443 Ga0207667_10607939 3300025949 Bacteria 1102
444 Ga0207667_10661736 3300025949 Bacteria 1049
445 Ga0207667_10744404 3300025949 Bacteria 980
446 Ga0207651_11728096 3300025960 Bacteria 563
447 Ga0207712_12102403 3300025961 Bacteria 505
448 Ga0207640_10000001 3300025981 Bacteria 628778
449 Ga0207640_10004201 3300025981 Bacteria 7791
450 Ga0207640_10563998 3300025981 Bacteria 959
451 Ga0207640_10617366 3300025981 Bacteria 920
452 Ga0207677_10084935 3300026023 Bacteria 2283
453 Ga0207677_11197681 3300026023 Bacteria 695
454 Ga0207703_10787246 3300026035 Bacteria 907
455 Ga0207703_11649394 3300026035 Bacteria 617
456 Ga0207639_10000037 3300026041 Bacteria 147685
457 Ga0207639_10011098 3300026041 Bacteria 6249
458 Ga0207639_10030717 3300026041 Bacteria 3942
459 Ga0207639_10061492 3300026041 Bacteria 2901
460 Ga0207639_10285024 3300026041 Bacteria 1454
461 Ga0207639_10429024 3300026041 Bacteria 1197
462 Ga0207639_10592331 3300026041 Bacteria 1022
463 Ga0207639_11640670 3300026041 Bacteria 603
464 Ga0207678_10010929 3300026067 Bacteria 7976
465 Ga0207678_10023442 3300026067 Bacteria 5398
466 Ga0207678_10257773 3300026067 Bacteria 1494
467 Ga0207678_10305222 3300026067 Bacteria 1368
468 Ga0207678_10738146 3300026067 Bacteria 868
469 Ga0207678_11532107 3300026067 Bacteria 588
470 Ga0207702_10234117 3300026078 Bacteria 1718
471 Ga0207702_10385027 3300026078 Bacteria 1349
472 Ga0207702_10755123 3300026078 Bacteria 960
473 Ga0207702_10819686 3300026078 Bacteria 920
474 Ga0207702_10828202 3300026078 Bacteria 915
475 Ga0207702_11059703 3300026078 Bacteria 804
476 Ga0207702_11779850 3300026078 Bacteria 608
477 Ga0207648_10763560 3300026089 Bacteria 898
478 Ga0207648_10949003 3300026089 Bacteria 804
479 Ga0207674_10027262 3300026116 Bacteria 6048
480 Ga0207674_10036001 3300026116 Bacteria 5162
481 Ga0207674_10046321 3300026116 Bacteria 4465
482 Ga0207674_10163978 3300026116 Bacteria 2176
483 Ga0207674_10420147 3300026116 Bacteria 1292
484 Ga0207674_10678088 3300026116 Bacteria 995
485 Ga0207698_10020962 3300026142 Bacteria 4511
486 Ga0207698_10080306 3300026142 Bacteria 2627
487 Ga0207698_10126407 3300026142 Bacteria 2175
488 Ga0207698_10351268 3300026142 Bacteria 1393
489 Ga0207698_10443043 3300026142 Bacteria 1252
490 Ga0207698_10897807 3300026142 Bacteria 893
491 Ga0207698_12067728 3300026142 Bacteria 583
492 Ga0209969_1062259 3300027360 Bacteria 590
493 Ga0265355_1002281 3300028036 Bacteria 1332
494 Ga0268265_11684592 3300028380 Unclassified 640
495 Ga0268264_11838371 3300028381 Bacteria 616
496 Ga0268264_11897489 3300028381 Bacteria 605
497 Ga0265338_10051809 3300028800 Bacteria 3691
498 Ga0265338_10208577 3300028800 Bacteria 1468
499 Ga0265340_10182324 3300031247 Bacteria 949
500 Ga0265339_10203016 3300031249 Bacteria 977
501 Ga0265331_10439788 3300031250 Bacteria 586
502 Ga0316212_1030629 3300033547 Bacteria 756
503 Ga0373950_0030479 3300034818 Bacteria 997
504 Ga0373926_0020769 3300035083 Bacteria 2269
505 Ga0373926_0336705 3300035083 Bacteria 591
506 Ga0373949_0105218 3300035090 Bacteria 777
507 Ga0373923_0200027 3300035111 Bacteria 923
508 Ga0373923_0556468 3300035111 Bacteria 562
509 Ga0373932_0210252 3300035112 Bacteria 695
510 Ga0373936_0011212 3300035113 Bacteria 3389
511 Ga0373936_0014935 3300035113 Bacteria 2973
512 Ga0373936_0049089 3300035113 Bacteria 1704
513 Ga0373945_0009361 3300035116 Bacteria 3209
514 Ga0373956_0006894 3300035119 Bacteria 4562
515 Ga0373957_0195161 3300035120 Bacteria 842
516 Ga0373943_0017826 3300035170 Bacteria 3254
517 Ga0373943_0035373 3300035170 Bacteria 2387
518 Ga0373943_0194459 3300035170 Bacteria 1120
519 Ga0373943_0695311 3300035170 Bacteria 602
520 Ga0373946_0015210 3300035171 Bacteria 2914
521 Ga0373946_0100458 3300035171 Bacteria 1296
522 Ga0373946_0783322 3300035171 Bacteria 502
523 Ga0373955_0031388 3300035172 Bacteria 2782
524 Ga0373955_0174640 3300035172 Bacteria 1273
525 Ga0373955_0233933 3300035172 Bacteria 1100
526 Ga0373924_0000060 3300035410 Bacteria 28422
527 Ga0373931_0079013 3300035691 Bacteria 1811
528 Ga0373931_0210101 3300035691 Bacteria 1167
529 Ga0373935_0041183 3300035692 Bacteria 2901
530 Ga0373935_0055471 3300035692 Bacteria 2524
531 Ga0373935_0298879 3300035692 Bacteria 1137
532 Ga0373935_0488116 3300035692 Bacteria 893
533 Ga0373927_0036557 3300035695 Bacteria 3193
534 Ga0373927_0354037 3300035695 Bacteria 968
535 Ga0373927_0930936 3300035695 Bacteria 573
536 Ga0373933_0094755 3300035724 Bacteria 1846
537 Ga0373933_0107629 3300035724 Bacteria 1736
538 Ga0373933_0272169 3300035724 Bacteria 1093
539 Ga0373933_0615076 3300035724 Bacteria 714
540 Ga0373933_1007985 3300035724 Bacteria 548
541 Ga0373947_0044018 3300035725 Bacteria 2667
542 Ga0373947_0046455 3300035725 Bacteria 2600
543 Ga0373947_0176418 3300035725 Bacteria 1389
544 Ga0373937_0000178 3300036401 Bacteria 62323
545 Ga0373937_0015152 3300036401 Bacteria 6812
546 Ga0373937_0260590 3300036401 Bacteria 1635
547 Ga0373937_0389091 3300036401 Bacteria 1323
548 Ga0373937_0429299 3300036401 Bacteria 1254
549 Ga0373937_0567197 3300036401 Bacteria 1078
550 Ga0373937_0622375 3300036401 Bacteria 1024
551 Ga0373937_0694329 3300036401 Bacteria 964
552 Ga0373937_1135505 3300036401 Bacteria 730
553 Ga0373937_1900870 3300036401 Bacteria 541
554 Ga0373925_0019116 3300037068 Bacteria 4982
555 Ga0373925_0148245 3300037068 Bacteria 1840
556 Ga0373925_0589688 3300037068 Bacteria 915
557 Ga0395898_0021558 3300037466 Bacteria 6532
558 Ga0395898_0512024 3300037466 Bacteria 1141
559 Ga0395905_0162410 3300037471 Bacteria 2099
560 Ga0395905_0308161 3300037471 Bacteria 1472
561 Ga0395901_1212610 3300038443 Bacteria 720
562 Ga0436365_0002921 3300039437 Bacteria 686
563 Ga0436365_1578341 3300039437 Bacteria 1286
564 Ga0436360_0121414 3300039438 Bacteria 1091
565 Ga0436360_0279180 3300039438 Unclassified 659
566 Ga0436360_0746999 3300039438 Bacteria 7727
567 Ga0436360_0975883 3300039438 Bacteria 4254
568 Ga0436361_0661329 3300039447 Bacteria 904
569 Ga0436361_0719701 3300039447 Bacteria 2567
570 Ga0436361_0788453 3300039447 Bacteria 15739
571 Ga0436361_0962723 3300039447 Bacteria 26082
572 Ga0436363_0716332 3300039450 Bacteria 694
573 Ga0436363_0970116 3300039450 Bacteria 5521
574 Ga0436363_1358826 3300039450 Bacteria 746
575 Ga0436363_1395887 3300039450 Bacteria 620
576 Ga0436362_1075674 3300039453 Bacteria 4239
577 Ga0436362_1242374 3300039453 Bacteria 1864
578 Ga0451853_4075313 3300041512 Bacteria 635
579 Ga0451577_0003351 3300042876 Bacteria 17945
580 Ga0451577_0504349 3300042876 Bacteria 1099
581 Ga0451577_1891989 3300042876 Bacteria 523
582 Ga0453683_0191709 3300044673 Bacteria 1297
583 Ga0466966_0054281 3300044684 Bacteria 2540
584 Ga0466966_0289898 3300044684 Bacteria 984
585 Ga0466961_0231806 3300044693 Bacteria 1136
586 Ga0466961_0473093 3300044693 Bacteria 758
587 Ga0466963_0000697 3300044694 Bacteria 16365
588 Ga0466963_0017962 3300044694 Bacteria 4413
589 Ga0466963_0033689 3300044694 Bacteria 3328
590 Ga0466963_0543005 3300044694 Bacteria 821
591 Ga0453684_0000545 3300044712 Bacteria 142482
592 Ga0453684_0349824 3300044712 Bacteria 1667
593 Ga0453684_0422538 3300044712 Bacteria 1489
594 Ga0466971_0146342 3300044719 Bacteria 1102
595 Ga0466957_0000091 3300044842 Bacteria 36379
596 Ga0466957_0169672 3300044842 Bacteria 1421
597 Ga0466957_0308901 3300044842 Bacteria 1064
598 Ga0466959_0087070 3300045049 Bacteria 2247
599 Ga0466959_0129036 3300045049 Bacteria 1793
600 Ga0466959_0340009 3300045049 Bacteria 1024
601 Ga0466959_0457870 3300045049 Bacteria 864
602 Ga0466959_1100964 3300045049 Bacteria 528
603 Ga0451576_0030134 3300045051 Bacteria 5802
604 Ga0451576_0115084 3300045051 Bacteria 2800
605 Ga0451576_0351745 3300045051 Bacteria 1543
606 Ga0451576_0784513 3300045051 Bacteria 1001
607 Ga0466958_0596039 3300045836 Bacteria 719
608 Ga0466958_0661044 3300045836 Bacteria 680
609 Ga0466958_1091681 3300045836 Bacteria 521
610 Ga0466958_1100712 3300045836 Bacteria 519
611 Ga0466967_0004330 3300045976 Bacteria 9548
612 Ga0466967_0058846 3300045976 Bacteria 3398
613 Ga0466967_0543479 3300045976 Bacteria 1143
614 Ga0495592_0293871 3300046454 Bacteria 1058
615 Ga0495651_0334267 3300046462 Bacteria 1006
616 Ga0495653_0241397 3300046463 Bacteria 1204
617 Ga0495580_0116498 3300046472 Bacteria 1855
618 Ga0495580_0171971 3300046472 Bacteria 1498
619 Ga0495580_0266112 3300046472 Bacteria 1172
620 Ga0495582_0011134 3300046473 Bacteria 4953
621 Ga0495582_0045146 3300046473 Bacteria 2427
622 Ga0495639_0458541 3300046475 Bacteria 648
623 Ga0495664_0354842 3300046477 Bacteria 883
624 Ga0495585_0591764 3300046492 Unclassified 522
625 Ga0495594_0218701 3300046499 Bacteria 1086
626 Ga0495594_0680927 3300046499 Bacteria 582
627 Ga0495630_0021830 3300046517 Bacteria 4727
628 Ga0495666_0256145 3300046526 Bacteria 797
629 Ga0495652_0828144 3300046529 Bacteria 614
630 Ga0495665_0128552 3300046531 Bacteria 1326
631 Ga0495640_0256113 3300046533 Bacteria 1095
632 Ga0495586_0080052 3300046535 Bacteria 1794
633 Ga0495586_0129568 3300046535 Bacteria 1412
634 Ga0495667_0180673 3300046559 Bacteria 1354
635 Ga0495667_0829637 3300046559 Bacteria 569
636 Ga0495635_0066288 3300046663 Bacteria 2476
637 Ga0495635_0118526 3300046663 Bacteria 1806
638 Ga0495599_0406105 3300046678 Bacteria 811
639 Ga0495658_0077354 3300046683 Bacteria 1946
640 Ga0495669_0078748 3300046684 Bacteria 1510
641 Ga0495669_0111833 3300046684 Bacteria 1276
642 Ga0495669_0249349 3300046684 Bacteria 853
643 Ga0495613_0171172 3300046689 Bacteria 1541
644 Ga0495613_0461394 3300046689 Bacteria 860
645 Ga0495581_0022818 3300047315 Bacteria 3625
646 Ga0495604_0033543 3300047317 Bacteria 4064
647 Ga0495674_0122318 3300047319 Bacteria 2198
648 Ga0495674_1125241 3300047319 Bacteria 597
649 Ga0495674_1293952 3300047319 Bacteria 547
650 Ga0495680_0821731 3300047322 Bacteria 606
651 Ga0495675_0803044 3300047444 Bacteria 521
652 Ga0495686_0003824 3300047472 Bacteria 12761
653 Ga0495686_0005390 3300047472 Bacteria 10106
654 Ga0495686_0026007 3300047472 Bacteria 3831
655 Ga0495686_0093162 3300047472 Bacteria 1827
656 Ga0495686_0292125 3300047472 Bacteria 902
657 Ga0495602_0637664 3300048088 Bacteria 729
658 Ga0495614_0088813 3300048089 Bacteria 1344
659 Ga0495614_0645171 3300048089 Bacteria 510
660 Ga0496100_0643019 3300048903 Bacteria 825
661 Ga0496100_0694447 3300048903 Bacteria 794
662 Ga0496102_0048790 3300048905 Bacteria 3850
663 Ga0496102_0183869 3300048905 Bacteria 1969
664 Ga0496103_0728173 3300048906 Bacteria 628
665 Ga0496104_0004857 3300048907 Bacteria 11710
666 Ga0496104_0135839 3300048907 Bacteria 2363
667 Ga0496104_0241759 3300048907 Bacteria 1718
668 Ga0496104_0396684 3300048907 Bacteria 1292
669 Ga0496104_0446483 3300048907 Bacteria 1205
670 Ga0496104_0804154 3300048907 Bacteria 846
671 Ga0496104_1734788 3300048907 Bacteria 527
672 Ga0496105_1187438 3300048908 Bacteria 562
673 Ga0496107_1086388 3300048910 Bacteria 578
674 Ga0496108_0233264 3300048911 Bacteria 1600
675 Ga0496109_0024187 3300048912 Bacteria 5398
676 Ga0496109_0965813 3300048912 Bacteria 790
677 Ga0496110_0263839 3300048913 Bacteria 1568
678 Ga0496110_0865230 3300048913 Bacteria 809
679 Ga0496110_1596047 3300048913 Bacteria 562
680 Ga0496110_1774734 3300048913 Bacteria 527
681 Ga0496111_0010060 3300048914 Bacteria 6329
682 Ga0496111_0192568 3300048914 Bacteria 1516
683 Ga0496111_0230728 3300048914 Bacteria 1375
684 Ga0496112_0008453 3300048915 Bacteria 9223
685 Ga0496112_0053293 3300048915 Bacteria 3972
686 Ga0496112_0091714 3300048915 Bacteria 3007
687 Ga0496112_0119936 3300048915 Bacteria 2600
688 Ga0496112_0187053 3300048915 Bacteria 2034
689 Ga0496113_0007159 3300048916 Bacteria 7146
690 Ga0496113_0026834 3300048916 Bacteria 4123
691 Ga0496113_0144525 3300048916 Bacteria 1873
692 Ga0496113_0632610 3300048916 Bacteria 856
693 Ga0496115_0098253 3300048918 Bacteria 2397
694 Ga0496115_0632316 3300048918 Bacteria 848
695 Ga0496117_0216312 3300048920 Bacteria 1070
696 Ga0496126_0000005 3300048929 Bacteria 891906
697 Ga0496126_0018827 3300048929 Bacteria 6826
698 Ga0501296_059394 3300049519 Bacteria 575
699 Ga0501034_0029221 3300049571 Bacteria 5603
700 Ga0501034_0040380 3300049571 Bacteria 4723
701 Ga0501037_0165424 3300049573 Bacteria 1575
702 Ga0501047_0043109 3300049581 Bacteria 4359
703 Ga0501073_0047586 3300049589 Bacteria 3014
704 Ga0501080_0537198 3300049742 Bacteria 1042
705 Ga0501035_0765432 3300049822 Bacteria 774
706 nmdc:mga05p37_220967_c1 3300050507 Bacteria 2286
707 nmdc:mga0n895_6814_c1 3300050512 Bacteria 9755
708 nmdc:mga0n895_79118_c1 3300050512 Bacteria 3273
709 nmdc:mga0rr50_106_c1 3300050513 Bacteria 46345
710 nmdc:mga0rr50_146531_c1 3300050513 Bacteria 1904
711 nmdc:mga0rr50_73046_c1 3300050513 Bacteria 2621
712 nmdc:mga0rr50_978270_c1 3300050513 Bacteria 721
713 nmdc:mga08x19_26710_c1 3300050514 Bacteria 3604
714 nmdc:mga08x19_8213_c1 3300050514 Bacteria 6203
715 nmdc:mga0a205_131827_c1 3300050515 Bacteria 2400
716 Ga0495601_0068298 3300053077 Bacteria 2265
717 Ga0495619_0580610 3300053085 Bacteria 768
718 Ga0590077_098864 3300059426 Bacteria 681
719 Ga0587066_124454 3300059490 Bacteria 613
720 Ga0587080_101076 3300059503 Bacteria 617
721 Ga0587090_081336 3300059510 Bacteria 649
722 Ga0587094_079710 3300059513 Bacteria 603
723 Ga0587115_086288 3300059626 Bacteria 563
724 Ga0587117_067172 3300059627 Bacteria 628
725 Ga0587075_026980 3300059644 Bacteria 892
726 Ga0587076_096282 3300059645 Bacteria 655
727 Ga0587071_095094 3300060344 Bacteria 682
728 Ga0501082_0101773 3300060353 Bacteria 2485
729 Ga0466962_0331977 3300061719 Bacteria 755

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035724 Ga0373933_1007985 Ga0373933_1007985_252_533 76
2 3300041512 Ga0451853_4075313 Ga0451853_4075313_295_594 79
3 3300049519 Ga0501296_059394 Ga0501296_059394_238_540 79
4 3300005288 Ga0065714_10251664 Ga0065714_102516642 80
5 3300005290 Ga0065712_10023735 Ga0065712_100237352 80
6 3300005293 Ga0065715_10231730 Ga0065715_102317303 80
7 3300005331 Ga0070670_100026689 Ga0070670_1000266895 80
8 3300005334 Ga0068869_101052533 Ga0068869_1010525332 80
9 3300005340 Ga0070689_100284828 Ga0070689_1002848282 80
10 3300005341 Ga0070691_10283669 Ga0070691_102836692 80
11 3300005354 Ga0070675_100697949 Ga0070675_1006979492 80
12 3300005365 Ga0070688_100175746 Ga0070688_1001757463 80
13 3300005459 Ga0068867_100091597 Ga0068867_1000915971 80
14 3300005466 Ga0070685_10222409 Ga0070685_102224092 80
15 3300005549 Ga0070704_100236821 Ga0070704_1002368212 80
16 3300005577 Ga0068857_100039759 Ga0068857_1000397592 80
17 3300005578 Ga0068854_100578405 Ga0068854_1005784052 80
18 3300005617 Ga0068859_101175738 Ga0068859_1011757382 80
19 3300005718 Ga0068866_11452197 Ga0068866_114521971 80
20 3300005844 Ga0068862_102744309 Ga0068862_1027443091 80
21 3300006871 Ga0075434_101514182 Ga0075434_1015141822 80
22 3300006881 Ga0068865_100225776 Ga0068865_1002257762 80
23 3300006914 Ga0075436_100193672 Ga0075436_1001936723 80
24 3300006931 Ga0097620_101175714 Ga0097620_1011757142 80
25 3300007076 Ga0075435_101381666 Ga0075435_1013816662 80
26 3300009176 Ga0105242_10080073 Ga0105242_100800733 80
27 3300014326 Ga0157380_10005417 Ga0157380_100054174 80
28 3300014745 Ga0157377_10261030 Ga0157377_102610301 80
29 3300025925 Ga0207650_10035262 Ga0207650_100352622 80
30 3300025926 Ga0207659_11182232 Ga0207659_111822321 80
31 3300025936 Ga0207670_10357465 Ga0207670_103574652 80
32 3300025938 Ga0207704_10352984 Ga0207704_103529842 80
33 3300025942 Ga0207689_10622950 Ga0207689_106229501 80
34 3300025981 Ga0207640_10563998 Ga0207640_105639981 80
35 3300026089 Ga0207648_10949003 Ga0207648_109490032 80
36 3300026116 Ga0207674_10046321 Ga0207674_100463212 80
37 3300028380 Ga0268265_11684592 Ga0268265_116845921 80
38 3300035090 Ga0373949_0105218 Ga0373949_0105218_389_697 80
39 3300035112 Ga0373932_0210252 Ga0373932_0210252_36_344 80
40 3300035691 Ga0373931_0079013 Ga0373931_0079013_680_988 80
41 3300044712 Ga0453684_0349824 Ga0453684_0349824_1250_1558 80
42 3300045051 Ga0451576_0115084 Ga0451576_0115084_881_1189 80
43 3300046473 Ga0495582_0011134 Ga0495582_0011134_2038_2346 80
44 3300046499 Ga0495594_0218701 Ga0495594_0218701_611_919 80
45 3300046535 Ga0495586_0129568 Ga0495586_0129568_1064_1372 80
46 3300046689 Ga0495613_0171172 Ga0495613_0171172_1119_1427 80
47 3300048089 Ga0495614_0645171 Ga0495614_0645171_104_412 80
48 3300050513 nmdc:mga0rr50_73046_c1 nmdc:mga0rr50_73046_c1_272_580 80
49 3300050513 nmdc:mga0rr50_978270_c1 nmdc:mga0rr50_978270_c1_155_463 80
50 3300033547 Ga0316212_1030629 Ga0316212_10306292 82
51 3300035171 Ga0373946_0783322 Ga0373946_0783322_169_447 82
52 3300035724 Ga0373933_0615076 Ga0373933_0615076_11_289 82
53 3300036401 Ga0373937_0429299 Ga0373937_0429299_302_580 82
54 3300047319 Ga0495674_1125241 Ga0495674_1125241_303_581 82
55 3300047444 Ga0495675_0803044 Ga0495675_0803044_135_413 82
56 3300048908 Ga0496105_1187438 Ga0496105_1187438_14_292 82
57 3300025913 Ga0207695_10026761 Ga0207695_100267615 83
58 3300046475 Ga0495639_0458541 Ga0495639_0458541_10_291 83
59 3300046533 Ga0495640_0256113 Ga0495640_0256113_32_334 83
60 3300005338 Ga0068868_100981898 Ga0068868_1009818982 86
61 3300005564 Ga0070664_101274390 Ga0070664_1012743902 86
62 3300014745 Ga0157377_10636004 Ga0157377_106360042 86
63 3300026023 Ga0207677_11197681 Ga0207677_111976812 86
64 3300026035 Ga0207703_11649394 Ga0207703_116493942 86
65 3300014969 Ga0157376_13045567 Ga0157376_130455671 87
66 3300014969 Ga0157376_13088103 Ga0157376_130881031 87
67 3300026089 Ga0207648_10763560 Ga0207648_107635602 87
68 3300047472 Ga0495686_0093162 Ga0495686_0093162_578_880 87
69 3300049571 Ga0501034_0029221 Ga0501034_0029221_1087_1386 87
70 3300049571 Ga0501034_0040380 Ga0501034_0040380_527_826 87
71 3300060353 Ga0501082_0101773 Ga0501082_0101773_1732_2031 87
72 iso_pu_bacteria 2884215851 2884217364 87
73 3300009101 Ga0105247_10242747 Ga0105247_102427473 88
74 3300039438 Ga0436360_0279180 Ga0436360_0279180_228_530 88
75 3300005327 Ga0070658_10001527 Ga0070658_100015279 89
76 3300005344 Ga0070661_100361545 Ga0070661_1003615451 89
77 3300005344 Ga0070661_101782562 Ga0070661_1017825621 89
78 3300005435 Ga0070714_100159821 Ga0070714_1001598211 89
79 3300005563 Ga0068855_100002031 Ga0068855_10000203116 89
80 3300005616 Ga0068852_100145658 Ga0068852_1001456582 89
81 3300009093 Ga0105240_10006173 Ga0105240_100061732 89
82 3300009093 Ga0105240_10516923 Ga0105240_105169232 89
83 3300009174 Ga0105241_10403098 Ga0105241_104030982 89
84 3300009551 Ga0105238_10280111 Ga0105238_102801111 89
85 3300009551 Ga0105238_10569902 Ga0105238_105699022 89
86 3300013102 Ga0157371_11446277 Ga0157371_114462772 89
87 3300013104 Ga0157370_10039723 Ga0157370_100397234 89
88 3300013105 Ga0157369_10134997 Ga0157369_101349971 89
89 3300013105 Ga0157369_10234269 Ga0157369_102342692 89
90 3300013296 Ga0157374_10222173 Ga0157374_102221732 89
91 3300013296 Ga0157374_10234187 Ga0157374_102341873 89
92 3300013307 Ga0157372_10084718 Ga0157372_100847184 89
93 3300013307 Ga0157372_10647794 Ga0157372_106477943 89
94 3300021361 Ga0213872_10005723 Ga0213872_100057234 89
95 3300021361 Ga0213872_10076671 Ga0213872_100766712 89
96 3300021441 Ga0213871_10078938 Ga0213871_100789382 89
97 3300025904 Ga0207647_10052108 Ga0207647_100521082 89
98 3300025909 Ga0207705_10004200 Ga0207705_100042003 89
99 3300025913 Ga0207695_10013166 Ga0207695_100131669 89
100 3300025913 Ga0207695_10279162 Ga0207695_102791622 89
101 3300025929 Ga0207664_10119001 Ga0207664_101190012 89
102 3300025929 Ga0207664_10224962 Ga0207664_102249622 89
103 3300025949 Ga0207667_10005534 Ga0207667_100055342 89
104 3300026067 Ga0207678_10257773 Ga0207678_102577732 89
105 3300026078 Ga0207702_10755123 Ga0207702_107551232 89
106 3300026116 Ga0207674_10678088 Ga0207674_106780882 89
107 3300026142 Ga0207698_10443043 Ga0207698_104430432 89
108 3300037471 Ga0395905_0162410 Ga0395905_0162410_544_846 89
109 3300039438 Ga0436360_0975883 Ga0436360_0975883_812_1114 89
110 3300039447 Ga0436361_0661329 Ga0436361_0661329_51_353 89
111 3300039447 Ga0436361_0788453 Ga0436361_0788453_1959_2261 89
112 3300039447 Ga0436361_0962723 Ga0436361_0962723_12371_12673 89
113 3300039450 Ga0436363_0716332 Ga0436363_0716332_14_316 89
114 3300039453 Ga0436362_1242374 Ga0436362_1242374_695_997 89
115 3300048088 Ga0495602_0637664 Ga0495602_0637664_257_559 89
116 3300048912 Ga0496109_0965813 Ga0496109_0965813_364_666 89
117 3300048918 Ga0496115_0098253 Ga0496115_0098253_901_1203 89
118 3300005327 Ga0070658_10000021 Ga0070658_1000002133 90
119 3300005327 Ga0070658_10005185 Ga0070658_100051859 90
120 3300005327 Ga0070658_10016209 Ga0070658_100162092 90
121 3300005327 Ga0070658_10016628 Ga0070658_100166283 90
122 3300005327 Ga0070658_10426595 Ga0070658_104265952 90
123 3300005327 Ga0070658_10539021 Ga0070658_105390212 90
124 3300005327 Ga0070658_11143292 Ga0070658_111432922 90
125 3300005327 Ga0070658_11313985 Ga0070658_113139851 90
126 3300005327 Ga0070658_11377893 Ga0070658_113778932 90
127 3300005327 Ga0070658_11720594 Ga0070658_117205941 90
128 3300005329 Ga0070683_100059316 Ga0070683_1000593164 90
129 3300005329 Ga0070683_100122154 Ga0070683_1001221543 90
130 3300005329 Ga0070683_101626501 Ga0070683_1016265012 90
131 3300005336 Ga0070680_100024410 Ga0070680_1000244104 90
132 3300005336 Ga0070680_100258121 Ga0070680_1002581211 90
133 3300005336 Ga0070680_101192435 Ga0070680_1011924352 90
134 3300005336 Ga0070680_101928400 Ga0070680_1019284001 90
135 3300005337 Ga0070682_100437889 Ga0070682_1004378893 90
136 3300005339 Ga0070660_100021869 Ga0070660_1000218694 90
137 3300005339 Ga0070660_100052804 Ga0070660_1000528042 90
138 3300005339 Ga0070660_100053595 Ga0070660_1000535953 90
139 3300005339 Ga0070660_100067592 Ga0070660_1000675923 90
140 3300005341 Ga0070691_10644028 Ga0070691_106440282 90
141 3300005344 Ga0070661_100060557 Ga0070661_1000605573 90
142 3300005344 Ga0070661_100103803 Ga0070661_1001038032 90
143 3300005364 Ga0070673_100492715 Ga0070673_1004927152 90
144 3300005366 Ga0070659_100015290 Ga0070659_1000152903 90
145 3300005366 Ga0070659_100028416 Ga0070659_1000284164 90
146 3300005366 Ga0070659_100036562 Ga0070659_1000365622 90
147 3300005434 Ga0070709_10034508 Ga0070709_100345083 90
148 3300005434 Ga0070709_10182778 Ga0070709_101827781 90
149 3300005434 Ga0070709_10935559 Ga0070709_109355591 90
150 3300005434 Ga0070709_11365834 Ga0070709_113658342 90
151 3300005435 Ga0070714_100145658 Ga0070714_1001456584 90
152 3300005435 Ga0070714_100517737 Ga0070714_1005177372 90
153 3300005435 Ga0070714_100779067 Ga0070714_1007790672 90
154 3300005435 Ga0070714_100826219 Ga0070714_1008262192 90
155 3300005435 Ga0070714_100999944 Ga0070714_1009999442 90
156 3300005436 Ga0070713_100045457 Ga0070713_1000454574 90
157 3300005439 Ga0070711_100124377 Ga0070711_1001243772 90
158 3300005445 Ga0070708_100123940 Ga0070708_1001239402 90
159 3300005455 Ga0070663_100027550 Ga0070663_1000275502 90
160 3300005455 Ga0070663_100146109 Ga0070663_1001461092 90
161 3300005455 Ga0070663_100313252 Ga0070663_1003132522 90
162 3300005456 Ga0070678_100246023 Ga0070678_1002460233 90
163 3300005456 Ga0070678_101258375 Ga0070678_1012583751 90
164 3300005457 Ga0070662_101207400 Ga0070662_1012074002 90
165 3300005458 Ga0070681_10077780 Ga0070681_100777802 90
166 3300005458 Ga0070681_10877499 Ga0070681_108774992 90
167 3300005530 Ga0070679_100019150 Ga0070679_1000191505 90
168 3300005530 Ga0070679_100048098 Ga0070679_1000480982 90
169 3300005530 Ga0070679_100060065 Ga0070679_1000600654 90
170 3300005530 Ga0070679_101041294 Ga0070679_1010412941 90
171 3300005535 Ga0070684_100055613 Ga0070684_1000556134 90
172 3300005535 Ga0070684_100460762 Ga0070684_1004607622 90
173 3300005535 Ga0070684_101116119 Ga0070684_1011161191 90
174 3300005536 Ga0070697_100001009 Ga0070697_1000010099 90
175 3300005539 Ga0068853_100000039 Ga0068853_10000003974 90
176 3300005539 Ga0068853_100111405 Ga0068853_1001114052 90
177 3300005539 Ga0068853_100157725 Ga0068853_1001577252 90
178 3300005545 Ga0070695_100035311 Ga0070695_1000353114 90
179 3300005546 Ga0070696_100046106 Ga0070696_1000461064 90
180 3300005546 Ga0070696_100232963 Ga0070696_1002329632 90
181 3300005547 Ga0070693_101319079 Ga0070693_1013190791 90
182 3300005563 Ga0068855_100002974 Ga0068855_1000029744 90
183 3300005563 Ga0068855_100025783 Ga0068855_1000257836 90
184 3300005563 Ga0068855_100036159 Ga0068855_1000361592 90
185 3300005563 Ga0068855_100233982 Ga0068855_1002339823 90
186 3300005563 Ga0068855_100370291 Ga0068855_1003702912 90
187 3300005563 Ga0068855_100461662 Ga0068855_1004616622 90
188 3300005564 Ga0070664_100048410 Ga0070664_1000484104 90
189 3300005564 Ga0070664_101169579 Ga0070664_1011695792 90
190 3300005577 Ga0068857_100018918 Ga0068857_1000189184 90
191 3300005577 Ga0068857_100109110 Ga0068857_1001091102 90
192 3300005578 Ga0068854_100000258 Ga0068854_1000002584 90
193 3300005578 Ga0068854_100019073 Ga0068854_1000190732 90
194 3300005578 Ga0068854_100875244 Ga0068854_1008752442 90
195 3300005614 Ga0068856_100453182 Ga0068856_1004531823 90
196 3300005614 Ga0068856_100458801 Ga0068856_1004588012 90
197 3300005616 Ga0068852_100086378 Ga0068852_1000863784 90
198 3300005616 Ga0068852_100147364 Ga0068852_1001473641 90
199 3300005616 Ga0068852_100165953 Ga0068852_1001659533 90
200 3300005616 Ga0068852_102607847 Ga0068852_1026078472 90
201 3300005618 Ga0068864_102357524 Ga0068864_1023575242 90
202 3300005842 Ga0068858_102330429 Ga0068858_1023304292 90
203 3300005843 Ga0068860_100782660 Ga0068860_1007826602 90
204 3300006028 Ga0070717_10050882 Ga0070717_100508824 90
205 3300006028 Ga0070717_10463503 Ga0070717_104635032 90
206 3300006028 Ga0070717_11551897 Ga0070717_115518971 90
207 3300006173 Ga0070716_101648856 Ga0070716_1016488561 90
208 3300006175 Ga0070712_100126921 Ga0070712_1001269212 90
209 3300006237 Ga0097621_100052895 Ga0097621_1000528953 90
210 3300006852 Ga0075433_10000204 Ga0075433_1000020432 90
211 3300006871 Ga0075434_100000356 Ga0075434_10000035638 90
212 3300006914 Ga0075436_100013552 Ga0075436_1000135524 90
213 3300006914 Ga0075436_100035059 Ga0075436_1000350592 90
214 3300007076 Ga0075435_100001266 Ga0075435_10000126613 90
215 3300007076 Ga0075435_100863114 Ga0075435_1008631142 90
216 3300009093 Ga0105240_10002452 Ga0105240_1000245218 90
217 3300009093 Ga0105240_10038871 Ga0105240_100388713 90
218 3300009093 Ga0105240_10139712 Ga0105240_101397122 90
219 3300009093 Ga0105240_10274102 Ga0105240_102741023 90
220 3300009093 Ga0105240_10482419 Ga0105240_104824192 90
221 3300009093 Ga0105240_11282757 Ga0105240_112827571 90
222 3300009147 Ga0114129_10237997 Ga0114129_102379973 90
223 3300009174 Ga0105241_10069755 Ga0105241_100697552 90
224 3300009174 Ga0105241_10258877 Ga0105241_102588772 90
225 3300009174 Ga0105241_10555164 Ga0105241_105551641 90
226 3300009174 Ga0105241_11716209 Ga0105241_117162092 90
227 3300009177 Ga0105248_10164155 Ga0105248_101641552 90
228 3300009177 Ga0105248_11353131 Ga0105248_113531312 90
229 3300009545 Ga0105237_10136511 Ga0105237_101365113 90
230 3300009551 Ga0105238_10049681 Ga0105238_100496812 90
231 3300009551 Ga0105238_10082207 Ga0105238_100822072 90
232 3300009551 Ga0105238_10180185 Ga0105238_101801852 90
233 3300009553 Ga0105249_11480188 Ga0105249_114801882 90
234 3300010375 Ga0105239_11210750 Ga0105239_112107502 90
235 3300013100 Ga0157373_10242595 Ga0157373_102425952 90
236 3300013102 Ga0157371_10506917 Ga0157371_105069172 90
237 3300013104 Ga0157370_10037753 Ga0157370_100377532 90
238 3300013104 Ga0157370_10040309 Ga0157370_100403092 90
239 3300013104 Ga0157370_10136036 Ga0157370_101360363 90
240 3300013104 Ga0157370_10530042 Ga0157370_105300422 90
241 3300013104 Ga0157370_11328794 Ga0157370_113287942 90
242 3300013105 Ga0157369_10016136 Ga0157369_100161362 90
243 3300013105 Ga0157369_10049348 Ga0157369_100493484 90
244 3300013105 Ga0157369_10050583 Ga0157369_100505833 90
245 3300013105 Ga0157369_10315653 Ga0157369_103156532 90
246 3300013105 Ga0157369_10756414 Ga0157369_107564142 90
247 3300013105 Ga0157369_11120341 Ga0157369_111203412 90
248 3300013105 Ga0157369_11468977 Ga0157369_114689772 90
249 3300013296 Ga0157374_10266885 Ga0157374_102668853 90
250 3300013296 Ga0157374_10484919 Ga0157374_104849192 90
251 3300013296 Ga0157374_10841260 Ga0157374_108412602 90
252 3300013297 Ga0157378_10980765 Ga0157378_109807652 90
253 3300013306 Ga0163162_10703002 Ga0163162_107030022 90
254 3300013307 Ga0157372_10016591 Ga0157372_100165916 90
255 3300013307 Ga0157372_10059678 Ga0157372_100596782 90
256 3300013307 Ga0157372_10068956 Ga0157372_100689564 90
257 3300013307 Ga0157372_10103770 Ga0157372_101037702 90
258 3300013307 Ga0157372_10166798 Ga0157372_101667982 90
259 3300013307 Ga0157372_11935923 Ga0157372_119359232 90
260 3300014325 Ga0163163_10017684 Ga0163163_100176843 90
261 3300014325 Ga0163163_10433771 Ga0163163_104337712 90
262 3300014968 Ga0157379_10000835 Ga0157379_1000083513 90
263 3300021358 Ga0213873_10004918 Ga0213873_100049183 90
264 3300021361 Ga0213872_10096967 Ga0213872_100969673 90
265 3300021377 Ga0213874_10045098 Ga0213874_100450982 90
266 3300021384 Ga0213876_10221330 Ga0213876_102213302 90
267 3300021441 Ga0213871_10007347 Ga0213871_100073472 90
268 3300022732 Ga0224569_100853 Ga0224569_1008533 90
269 3300024227 Ga0228598_1001012 Ga0228598_10010124 90
270 3300025261 Ga0209233_1027448 Ga0209233_10274482 90
271 3300025901 Ga0207688_10906671 Ga0207688_109066711 90
272 3300025904 Ga0207647_10001986 Ga0207647_100019862 90
273 3300025905 Ga0207685_10176170 Ga0207685_101761702 90
274 3300025906 Ga0207699_10113868 Ga0207699_101138682 90
275 3300025909 Ga0207705_10000041 Ga0207705_1000004156 90
276 3300025909 Ga0207705_10001724 Ga0207705_1000172414 90
277 3300025909 Ga0207705_10002780 Ga0207705_100027804 90
278 3300025909 Ga0207705_10009906 Ga0207705_100099063 90
279 3300025909 Ga0207705_10013162 Ga0207705_100131623 90
280 3300025909 Ga0207705_10301948 Ga0207705_103019483 90
281 3300025909 Ga0207705_10687362 Ga0207705_106873622 90
282 3300025909 Ga0207705_10824445 Ga0207705_108244452 90
283 3300025911 Ga0207654_10352879 Ga0207654_103528793 90
284 3300025912 Ga0207707_10201765 Ga0207707_102017653 90
285 3300025912 Ga0207707_10925611 Ga0207707_109256112 90
286 3300025913 Ga0207695_10000589 Ga0207695_1000058962 90
287 3300025913 Ga0207695_10037654 Ga0207695_100376542 90
288 3300025913 Ga0207695_10044746 Ga0207695_100447462 90
289 3300025913 Ga0207695_10660590 Ga0207695_106605902 90
290 3300025913 Ga0207695_10902404 Ga0207695_109024042 90
291 3300025914 Ga0207671_10096424 Ga0207671_100964243 90
292 3300025915 Ga0207693_10018216 Ga0207693_100182163 90
293 3300025915 Ga0207693_11347948 Ga0207693_113479482 90
294 3300025916 Ga0207663_10281030 Ga0207663_102810302 90
295 3300025916 Ga0207663_10369799 Ga0207663_103697992 90
296 3300025917 Ga0207660_10152967 Ga0207660_101529672 90
297 3300025919 Ga0207657_10022317 Ga0207657_100223174 90
298 3300025919 Ga0207657_10027462 Ga0207657_100274623 90
299 3300025919 Ga0207657_10040613 Ga0207657_100406133 90
300 3300025919 Ga0207657_10791997 Ga0207657_107919972 90
301 3300025919 Ga0207657_11156524 Ga0207657_111565242 90
302 3300025920 Ga0207649_10077225 Ga0207649_100772252 90
303 3300025921 Ga0207652_10003556 Ga0207652_100035563 90
304 3300025921 Ga0207652_10057634 Ga0207652_100576344 90
305 3300025924 Ga0207694_10032945 Ga0207694_100329452 90
306 3300025924 Ga0207694_10135872 Ga0207694_101358722 90
307 3300025928 Ga0207700_10772005 Ga0207700_107720052 90
308 3300025929 Ga0207664_10158631 Ga0207664_101586313 90
309 3300025929 Ga0207664_11011735 Ga0207664_110117351 90
310 3300025932 Ga0207690_10003497 Ga0207690_100034976 90
311 3300025932 Ga0207690_10248307 Ga0207690_102483073 90
312 3300025933 Ga0207706_10876269 Ga0207706_108762692 90
313 3300025939 Ga0207665_10366344 Ga0207665_103663443 90
314 3300025941 Ga0207711_10344175 Ga0207711_103441752 90
315 3300025941 Ga0207711_11013751 Ga0207711_110137512 90
316 3300025944 Ga0207661_10129450 Ga0207661_101294502 90
317 3300025944 Ga0207661_10324117 Ga0207661_103241172 90
318 3300025945 Ga0207679_10279713 Ga0207679_102797132 90
319 3300025949 Ga0207667_10008043 Ga0207667_100080438 90
320 3300025949 Ga0207667_10010759 Ga0207667_100107594 90
321 3300025949 Ga0207667_10053497 Ga0207667_100534974 90
322 3300025949 Ga0207667_10092427 Ga0207667_100924274 90
323 3300025949 Ga0207667_10269380 Ga0207667_102693802 90
324 3300025949 Ga0207667_10430858 Ga0207667_104308582 90
325 3300025949 Ga0207667_10661736 Ga0207667_106617362 90
326 3300025960 Ga0207651_11728096 Ga0207651_117280962 90
327 3300025961 Ga0207712_12102403 Ga0207712_121024032 90
328 3300025981 Ga0207640_10000001 Ga0207640_10000001196 90
329 3300025981 Ga0207640_10004201 Ga0207640_100042018 90
330 3300025981 Ga0207640_10617366 Ga0207640_106173661 90
331 3300026035 Ga0207703_10787246 Ga0207703_107872462 90
332 3300026041 Ga0207639_10000037 Ga0207639_1000003754 90
333 3300026041 Ga0207639_10011098 Ga0207639_100110983 90
334 3300026041 Ga0207639_10061492 Ga0207639_100614922 90
335 3300026041 Ga0207639_11640670 Ga0207639_116406702 90
336 3300026067 Ga0207678_10010929 Ga0207678_100109294 90
337 3300026067 Ga0207678_10023442 Ga0207678_100234424 90
338 3300026067 Ga0207678_10305222 Ga0207678_103052222 90
339 3300026067 Ga0207678_10738146 Ga0207678_107381462 90
340 3300026067 Ga0207678_11532107 Ga0207678_115321072 90
341 3300026078 Ga0207702_10234117 Ga0207702_102341173 90
342 3300026078 Ga0207702_10385027 Ga0207702_103850272 90
343 3300026078 Ga0207702_10819686 Ga0207702_108196862 90
344 3300026078 Ga0207702_11059703 Ga0207702_110597032 90
345 3300026116 Ga0207674_10027262 Ga0207674_100272623 90
346 3300026116 Ga0207674_10036001 Ga0207674_100360014 90
347 3300026116 Ga0207674_10163978 Ga0207674_101639783 90
348 3300026142 Ga0207698_10020962 Ga0207698_100209622 90
349 3300026142 Ga0207698_10080306 Ga0207698_100803062 90
350 3300026142 Ga0207698_10351268 Ga0207698_103512682 90
351 3300026142 Ga0207698_10897807 Ga0207698_108978072 90
352 3300026142 Ga0207698_12067728 Ga0207698_120677282 90
353 3300027360 Ga0209969_1062259 Ga0209969_10622591 90
354 3300028036 Ga0265355_1002281 Ga0265355_10022812 90
355 3300028381 Ga0268264_11838371 Ga0268264_118383712 90
356 3300028381 Ga0268264_11897489 Ga0268264_118974892 90
357 3300028800 Ga0265338_10051809 Ga0265338_100518092 90
358 3300031250 Ga0265331_10439788 Ga0265331_104397882 90
359 3300035113 Ga0373936_0049089 Ga0373936_0049089_1317_1619 90
360 3300035170 Ga0373943_0035373 Ga0373943_0035373_1319_1621 90
361 3300035170 Ga0373943_0695311 Ga0373943_0695311_289_591 90
362 3300035172 Ga0373955_0174640 Ga0373955_0174640_514_816 90
363 3300035691 Ga0373931_0210101 Ga0373931_0210101_719_1021 90
364 3300036401 Ga0373937_0389091 Ga0373937_0389091_471_773 90
365 3300036401 Ga0373937_1135505 Ga0373937_1135505_144_446 90
366 3300037068 Ga0373925_0148245 Ga0373925_0148245_26_328 90
367 3300037068 Ga0373925_0589688 Ga0373925_0589688_352_654 90
368 3300037471 Ga0395905_0308161 Ga0395905_0308161_1106_1408 90
369 3300038443 Ga0395901_1212610 Ga0395901_1212610_346_648 90
370 3300039437 Ga0436365_0002921 Ga0436365_0002921_37_339 90
371 3300039437 Ga0436365_1578341 Ga0436365_1578341_364_666 90
372 3300039438 Ga0436360_0121414 Ga0436360_0121414_316_618 90
373 3300039438 Ga0436360_0746999 Ga0436360_0746999_5740_6042 90
374 3300039447 Ga0436361_0719701 Ga0436361_0719701_1714_2016 90
375 3300039450 Ga0436363_0970116 Ga0436363_0970116_5012_5314 90
376 3300039450 Ga0436363_1358826 Ga0436363_1358826_174_476 90
377 3300039450 Ga0436363_1395887 Ga0436363_1395887_274_576 90
378 3300039453 Ga0436362_1075674 Ga0436362_1075674_1577_1879 90
379 3300042876 Ga0451577_0003351 Ga0451577_0003351_2189_2491 90
380 3300042876 Ga0451577_0504349 Ga0451577_0504349_146_448 90
381 3300042876 Ga0451577_1891989 Ga0451577_1891989_113_415 90
382 3300044673 Ga0453683_0191709 Ga0453683_0191709_858_1160 90
383 3300044684 Ga0466966_0054281 Ga0466966_0054281_1650_1952 90
384 3300044684 Ga0466966_0289898 Ga0466966_0289898_330_635 90
385 3300044693 Ga0466961_0231806 Ga0466961_0231806_686_988 90
386 3300044693 Ga0466961_0473093 Ga0466961_0473093_101_406 90
387 3300044694 Ga0466963_0017962 Ga0466963_0017962_2769_3074 90
388 3300044694 Ga0466963_0033689 Ga0466963_0033689_1764_2066 90
389 3300044712 Ga0453684_0000545 Ga0453684_0000545_99239_99541 90
390 3300044712 Ga0453684_0422538 Ga0453684_0422538_104_406 90
391 3300044719 Ga0466971_0146342 Ga0466971_0146342_639_944 90
392 3300044842 Ga0466957_0169672 Ga0466957_0169672_717_1022 90
393 3300044842 Ga0466957_0308901 Ga0466957_0308901_317_619 90
394 3300045049 Ga0466959_0129036 Ga0466959_0129036_175_477 90
395 3300045049 Ga0466959_0340009 Ga0466959_0340009_451_753 90
396 3300045049 Ga0466959_0457870 Ga0466959_0457870_285_590 90
397 3300045049 Ga0466959_1100964 Ga0466959_1100964_120_422 90
398 3300045051 Ga0451576_0030134 Ga0451576_0030134_4679_4981 90
399 3300045051 Ga0451576_0351745 Ga0451576_0351745_747_1049 90
400 3300045051 Ga0451576_0784513 Ga0451576_0784513_333_635 90
401 3300045836 Ga0466958_0596039 Ga0466958_0596039_241_543 90
402 3300045836 Ga0466958_0661044 Ga0466958_0661044_365_667 90
403 3300045836 Ga0466958_1100712 Ga0466958_1100712_65_370 90
404 3300045976 Ga0466967_0543479 Ga0466967_0543479_519_824 90
405 3300046472 Ga0495580_0171971 Ga0495580_0171971_951_1232 90
406 3300046472 Ga0495580_0266112 Ga0495580_0266112_720_1022 90
407 3300046492 Ga0495585_0591764 Ga0495585_0591764_88_390 90
408 3300046499 Ga0495594_0680927 Ga0495594_0680927_100_402 90
409 3300046559 Ga0495667_0829637 Ga0495667_0829637_67_369 90
410 3300046663 Ga0495635_0118526 Ga0495635_0118526_1298_1600 90
411 3300046678 Ga0495599_0406105 Ga0495599_0406105_371_673 90
412 3300046684 Ga0495669_0078748 Ga0495669_0078748_224_526 90
413 3300046684 Ga0495669_0249349 Ga0495669_0249349_21_323 90
414 3300047315 Ga0495581_0022818 Ga0495581_0022818_2007_2309 90
415 3300047319 Ga0495674_1293952 Ga0495674_1293952_116_418 90
416 3300047472 Ga0495686_0003824 Ga0495686_0003824_3130_3441 90
417 3300047472 Ga0495686_0005390 Ga0495686_0005390_7711_8013 90
418 3300047472 Ga0495686_0026007 Ga0495686_0026007_1004_1306 90
419 3300047472 Ga0495686_0292125 Ga0495686_0292125_152_454 90
420 3300048903 Ga0496100_0694447 Ga0496100_0694447_331_633 90
421 3300048907 Ga0496104_0135839 Ga0496104_0135839_1040_1342 90
422 3300048907 Ga0496104_0241759 Ga0496104_0241759_204_506 90
423 3300048907 Ga0496104_0396684 Ga0496104_0396684_506_808 90
424 3300048907 Ga0496104_1734788 Ga0496104_1734788_156_458 90
425 3300048911 Ga0496108_0233264 Ga0496108_0233264_715_1017 90
426 3300048912 Ga0496109_0024187 Ga0496109_0024187_4513_4815 90
427 3300048913 Ga0496110_1774734 Ga0496110_1774734_34_336 90
428 3300048914 Ga0496111_0192568 Ga0496111_0192568_788_1090 90
429 3300048915 Ga0496112_0091714 Ga0496112_0091714_164_466 90
430 3300048915 Ga0496112_0119936 Ga0496112_0119936_237_539 90
431 3300048916 Ga0496113_0144525 Ga0496113_0144525_206_508 90
432 3300048920 Ga0496117_0216312 Ga0496117_0216312_41_343 90
433 3300048929 Ga0496126_0000005 Ga0496126_0000005_188822_189124 90
434 3300048929 Ga0496126_0018827 Ga0496126_0018827_5935_6240 90
435 3300049573 Ga0501037_0165424 Ga0501037_0165424_363_674 90
436 3300049581 Ga0501047_0043109 Ga0501047_0043109_3685_3996 90
437 3300049589 Ga0501073_0047586 Ga0501073_0047586_2521_2832 90
438 3300049742 Ga0501080_0537198 Ga0501080_0537198_258_569 90
439 3300049822 Ga0501035_0765432 Ga0501035_0765432_281_592 90
440 3300050507 nmdc:mga05p37_220967_c1 nmdc:mga05p37_220967_c1_1747_2049 90
441 3300050512 nmdc:mga0n895_6814_c1 nmdc:mga0n895_6814_c1_7100_7402 90
442 3300050513 nmdc:mga0rr50_106_c1 nmdc:mga0rr50_106_c1_36169_36471 90
443 3300050514 nmdc:mga08x19_26710_c1 nmdc:mga08x19_26710_c1_1393_1695 90
444 3300050514 nmdc:mga08x19_8213_c1 nmdc:mga08x19_8213_c1_2846_3148 90
445 3300050515 nmdc:mga0a205_131827_c1 nmdc:mga0a205_131827_c1_342_644 90
446 3300053085 Ga0495619_0580610 Ga0495619_0580610_376_678 90
447 3300059426 Ga0590077_098864 Ga0590077_098864_259_561 90
448 3300007076 Ga0075435_100109271 Ga0075435_1001092712 91
449 3300046517 Ga0495630_0021830 Ga0495630_0021830_2669_2995 91
450 3300050513 nmdc:mga0rr50_146531_c1 nmdc:mga0rr50_146531_c1_1319_1639 91
451 3300026078 Ga0207702_11779850 Ga0207702_117798502 93
452 3300004803 Ga0058862_12769646 Ga0058862_127696462 94
453 3300004803 Ga0058862_12820602 Ga0058862_128206022 94
454 3300005329 Ga0070683_100128876 Ga0070683_1001288762 94
455 3300005329 Ga0070683_101138144 Ga0070683_1011381441 94
456 3300005337 Ga0070682_100703318 Ga0070682_1007033181 94
457 3300005337 Ga0070682_101224273 Ga0070682_1012242732 94
458 3300005338 Ga0068868_100066148 Ga0068868_1000661482 94
459 3300005344 Ga0070661_101304786 Ga0070661_1013047862 94
460 3300005345 Ga0070692_10319022 Ga0070692_103190222 94
461 3300005366 Ga0070659_102157780 Ga0070659_1021577802 94
462 3300005434 Ga0070709_10059863 Ga0070709_100598632 94
463 3300005434 Ga0070709_10266496 Ga0070709_102664962 94
464 3300005435 Ga0070714_100055894 Ga0070714_1000558942 94
465 3300005436 Ga0070713_100236696 Ga0070713_1002366962 94
466 3300005436 Ga0070713_100501452 Ga0070713_1005014523 94
467 3300005436 Ga0070713_101019634 Ga0070713_1010196342 94
468 3300005437 Ga0070710_10039958 Ga0070710_100399582 94
469 3300005437 Ga0070710_10400625 Ga0070710_104006252 94
470 3300005439 Ga0070711_100030675 Ga0070711_1000306752 94
471 3300005439 Ga0070711_100671184 Ga0070711_1006711842 94
472 3300005439 Ga0070711_100988385 Ga0070711_1009883852 94
473 3300005439 Ga0070711_101068061 Ga0070711_1010680612 94
474 3300005439 Ga0070711_101399606 Ga0070711_1013996061 94
475 3300005458 Ga0070681_10018593 Ga0070681_100185936 94
476 3300005458 Ga0070681_10505586 Ga0070681_105055862 94
477 3300005518 Ga0070699_101132454 Ga0070699_1011324542 94
478 3300005530 Ga0070679_100336113 Ga0070679_1003361132 94
479 3300005535 Ga0070684_100137182 Ga0070684_1001371822 94
480 3300005535 Ga0070684_100343930 Ga0070684_1003439302 94
481 3300005539 Ga0068853_100120740 Ga0068853_1001207403 94
482 3300005539 Ga0068853_101151329 Ga0068853_1011513291 94
483 3300005547 Ga0070693_100038736 Ga0070693_1000387361 94
484 3300005547 Ga0070693_100064127 Ga0070693_1000641273 94
485 3300005547 Ga0070693_100179659 Ga0070693_1001796592 94
486 3300005547 Ga0070693_100199901 Ga0070693_1001999012 94
487 3300005563 Ga0068855_100286687 Ga0068855_1002866873 94
488 3300005563 Ga0068855_100911847 Ga0068855_1009118472 94
489 3300005564 Ga0070664_101553023 Ga0070664_1015530232 94
490 3300005577 Ga0068857_100251604 Ga0068857_1002516042 94
491 3300005614 Ga0068856_100048619 Ga0068856_1000486192 94
492 3300005614 Ga0068856_100076571 Ga0068856_1000765713 94
493 3300005614 Ga0068856_102250687 Ga0068856_1022506871 94
494 3300005616 Ga0068852_100062115 Ga0068852_1000621152 94
495 3300005617 Ga0068859_101822634 Ga0068859_1018226342 94
496 3300005718 Ga0068866_10415730 Ga0068866_104157302 94
497 3300006028 Ga0070717_10145393 Ga0070717_101453932 94
498 3300006028 Ga0070717_10163768 Ga0070717_101637683 94
499 3300006028 Ga0070717_10915045 Ga0070717_109150451 94
500 3300006028 Ga0070717_11042856 Ga0070717_110428562 94
501 3300006028 Ga0070717_11366423 Ga0070717_113664231 94
502 3300006163 Ga0070715_10142822 Ga0070715_101428222 94
503 3300006173 Ga0070716_101156678 Ga0070716_1011566782 94
504 3300006175 Ga0070712_100081304 Ga0070712_1000813042 94
505 3300006175 Ga0070712_100507658 Ga0070712_1005076582 94
506 3300006175 Ga0070712_101002961 Ga0070712_1010029612 94
507 3300006931 Ga0097620_101822995 Ga0097620_1018229952 94
508 3300007788 Ga0099795_10595412 Ga0099795_105954121 94
509 3300009093 Ga0105240_10189018 Ga0105240_101890183 94
510 3300009093 Ga0105240_11329094 Ga0105240_113290942 94
511 3300009093 Ga0105240_11357719 Ga0105240_113577192 94
512 3300009098 Ga0105245_10010071 Ga0105245_100100712 94
513 3300009098 Ga0105245_10098320 Ga0105245_100983202 94
514 3300009176 Ga0105242_10379835 Ga0105242_103798352 94
515 3300009545 Ga0105237_10976396 Ga0105237_109763961 94
516 3300009545 Ga0105237_11097414 Ga0105237_110974142 94
517 3300009551 Ga0105238_10043634 Ga0105238_100436344 94
518 3300009551 Ga0105238_10416522 Ga0105238_104165222 94
519 3300009551 Ga0105238_11118620 Ga0105238_111186202 94
520 3300010375 Ga0105239_10235564 Ga0105239_102355643 94
521 3300010375 Ga0105239_10376655 Ga0105239_103766553 94
522 3300010375 Ga0105239_10580574 Ga0105239_105805741 94
523 3300010375 Ga0105239_10733870 Ga0105239_107338702 94
524 3300010375 Ga0105239_11018909 Ga0105239_110189092 94
525 3300013104 Ga0157370_10416994 Ga0157370_104169942 94
526 3300013105 Ga0157369_10141538 Ga0157369_101415383 94
527 3300013105 Ga0157369_10206775 Ga0157369_102067752 94
528 3300013105 Ga0157369_12607401 Ga0157369_126074012 94
529 3300013296 Ga0157374_10330445 Ga0157374_103304454 94
530 3300013297 Ga0157378_10150600 Ga0157378_101506002 94
531 3300013306 Ga0163162_11222473 Ga0163162_112224732 94
532 3300013307 Ga0157372_11496441 Ga0157372_114964412 94
533 3300022467 Ga0224712_10277358 Ga0224712_102773582 94
534 3300025898 Ga0207692_10117801 Ga0207692_101178012 94
535 3300025899 Ga0207642_10342227 Ga0207642_103422272 94
536 3300025906 Ga0207699_10309416 Ga0207699_103094163 94
537 3300025912 Ga0207707_10211228 Ga0207707_102112282 94
538 3300025912 Ga0207707_10224070 Ga0207707_102240702 94
539 3300025915 Ga0207693_10018113 Ga0207693_100181135 94
540 3300025915 Ga0207693_10087302 Ga0207693_100873022 94
541 3300025915 Ga0207693_11038205 Ga0207693_110382052 94
542 3300025916 Ga0207663_10045568 Ga0207663_100455682 94
543 3300025916 Ga0207663_10782463 Ga0207663_107824632 94
544 3300025916 Ga0207663_10882056 Ga0207663_108820562 94
545 3300025916 Ga0207663_11353112 Ga0207663_113531122 94
546 3300025917 Ga0207660_10258846 Ga0207660_102588462 94
547 3300025921 Ga0207652_10407811 Ga0207652_104078111 94
548 3300025924 Ga0207694_10132933 Ga0207694_101329333 94
549 3300025924 Ga0207694_10253981 Ga0207694_102539812 94
550 3300025924 Ga0207694_10941615 Ga0207694_109416152 94
551 3300025927 Ga0207687_10005215 Ga0207687_100052158 94
552 3300025928 Ga0207700_10190948 Ga0207700_101909482 94
553 3300025928 Ga0207700_10351223 Ga0207700_103512231 94
554 3300025928 Ga0207700_10621500 Ga0207700_106215002 94
555 3300025928 Ga0207700_11984593 Ga0207700_119845931 94
556 3300025929 Ga0207664_11460003 Ga0207664_114600032 94
557 3300025934 Ga0207686_10217795 Ga0207686_102177952 94
558 3300025939 Ga0207665_10067673 Ga0207665_100676732 94
559 3300025944 Ga0207661_10050019 Ga0207661_100500192 94
560 3300025944 Ga0207661_11512796 Ga0207661_115127962 94
561 3300025945 Ga0207679_10766613 Ga0207679_107666132 94
562 3300025949 Ga0207667_10088724 Ga0207667_100887243 94
563 3300025949 Ga0207667_10607939 Ga0207667_106079392 94
564 3300025949 Ga0207667_10744404 Ga0207667_107444042 94
565 3300026023 Ga0207677_10084935 Ga0207677_100849352 94
566 3300026041 Ga0207639_10030717 Ga0207639_100307173 94
567 3300026041 Ga0207639_10285024 Ga0207639_102850242 94
568 3300026041 Ga0207639_10429024 Ga0207639_104290242 94
569 3300026078 Ga0207702_10828202 Ga0207702_108282022 94
570 3300026116 Ga0207674_10420147 Ga0207674_104201472 94
571 3300026142 Ga0207698_10126407 Ga0207698_101264072 94
572 3300034818 Ga0373950_0030479 Ga0373950_0030479_400_735 94
573 3300035083 Ga0373926_0020769 Ga0373926_0020769_133_468 94
574 3300035111 Ga0373923_0200027 Ga0373923_0200027_510_842 94
575 3300035111 Ga0373923_0556468 Ga0373923_0556468_77_412 94
576 3300035113 Ga0373936_0011212 Ga0373936_0011212_2808_3143 94
577 3300035113 Ga0373936_0014935 Ga0373936_0014935_695_1030 94
578 3300035116 Ga0373945_0009361 Ga0373945_0009361_2388_2723 94
579 3300035120 Ga0373957_0195161 Ga0373957_0195161_91_426 94
580 3300035170 Ga0373943_0017826 Ga0373943_0017826_2050_2385 94
581 3300035170 Ga0373943_0194459 Ga0373943_0194459_142_477 94
582 3300035171 Ga0373946_0015210 Ga0373946_0015210_76_411 94
583 3300035171 Ga0373946_0100458 Ga0373946_0100458_893_1228 94
584 3300035172 Ga0373955_0233933 Ga0373955_0233933_378_710 94
585 3300035410 Ga0373924_0000060 Ga0373924_0000060_8682_9017 94
586 3300035692 Ga0373935_0055471 Ga0373935_0055471_397_732 94
587 3300035692 Ga0373935_0298879 Ga0373935_0298879_640_975 94
588 3300035692 Ga0373935_0488116 Ga0373935_0488116_78_410 94
589 3300035695 Ga0373927_0036557 Ga0373927_0036557_714_1049 94
590 3300035695 Ga0373927_0354037 Ga0373927_0354037_502_837 94
591 3300035724 Ga0373933_0094755 Ga0373933_0094755_232_567 94
592 3300035724 Ga0373933_0107629 Ga0373933_0107629_326_658 94
593 3300035724 Ga0373933_0272169 Ga0373933_0272169_43_375 94
594 3300035725 Ga0373947_0044018 Ga0373947_0044018_721_1056 94
595 3300035725 Ga0373947_0046455 Ga0373947_0046455_754_1089 94
596 3300036401 Ga0373937_0000178 Ga0373937_0000178_26062_26394 94
597 3300036401 Ga0373937_0260590 Ga0373937_0260590_802_1137 94
598 3300036401 Ga0373937_0567197 Ga0373937_0567197_682_1014 94
599 3300036401 Ga0373937_0622375 Ga0373937_0622375_82_417 94
600 3300036401 Ga0373937_1900870 Ga0373937_1900870_32_364 94
601 3300037466 Ga0395898_0021558 Ga0395898_0021558_2537_2857 94
602 3300046454 Ga0495592_0293871 Ga0495592_0293871_227_562 94
603 3300046462 Ga0495651_0334267 Ga0495651_0334267_272_604 94
604 3300046463 Ga0495653_0241397 Ga0495653_0241397_677_1012 94
605 3300046472 Ga0495580_0116498 Ga0495580_0116498_919_1254 94
606 3300046473 Ga0495582_0045146 Ga0495582_0045146_148_483 94
607 3300046477 Ga0495664_0354842 Ga0495664_0354842_182_517 94
608 3300046526 Ga0495666_0256145 Ga0495666_0256145_153_488 94
609 3300046529 Ga0495652_0828144 Ga0495652_0828144_213_545 94
610 3300046531 Ga0495665_0128552 Ga0495665_0128552_278_613 94
611 3300046535 Ga0495586_0080052 Ga0495586_0080052_620_955 94
612 3300046559 Ga0495667_0180673 Ga0495667_0180673_421_756 94
613 3300046663 Ga0495635_0066288 Ga0495635_0066288_1671_2006 94
614 3300046683 Ga0495658_0077354 Ga0495658_0077354_253_588 94
615 3300046689 Ga0495613_0461394 Ga0495613_0461394_193_528 94
616 3300047319 Ga0495674_0122318 Ga0495674_0122318_1694_2029 94
617 3300048089 Ga0495614_0088813 Ga0495614_0088813_258_593 94
618 3300048903 Ga0496100_0643019 Ga0496100_0643019_462_794 94
619 3300048905 Ga0496102_0183869 Ga0496102_0183869_120_452 94
620 3300048906 Ga0496103_0728173 Ga0496103_0728173_121_453 94
621 3300048907 Ga0496104_0004857 Ga0496104_0004857_10887_11222 94
622 3300048907 Ga0496104_0446483 Ga0496104_0446483_76_408 94
623 3300048907 Ga0496104_0804154 Ga0496104_0804154_104_436 94
624 3300048910 Ga0496107_1086388 Ga0496107_1086388_78_410 94
625 3300048913 Ga0496110_0263839 Ga0496110_0263839_544_876 94
626 3300048913 Ga0496110_0865230 Ga0496110_0865230_114_449 94
627 3300048913 Ga0496110_1596047 Ga0496110_1596047_40_372 94
628 3300048914 Ga0496111_0010060 Ga0496111_0010060_5477_5812 94
629 3300048914 Ga0496111_0230728 Ga0496111_0230728_664_996 94
630 3300048915 Ga0496112_0053293 Ga0496112_0053293_259_594 94
631 3300048915 Ga0496112_0187053 Ga0496112_0187053_765_1097 94
632 3300048916 Ga0496113_0007159 Ga0496113_0007159_3240_3575 94
633 3300048916 Ga0496113_0026834 Ga0496113_0026834_3387_3719 94
634 3300048918 Ga0496115_0632316 Ga0496115_0632316_371_703 94
635 3300059510 Ga0587090_081336 Ga0587090_081336_198_518 94
636 3300059627 Ga0587117_067172 Ga0587117_067172_122_454 94
637 3300060344 Ga0587071_095094 Ga0587071_095094_73_405 94
638 3300031247 Ga0265340_10182324 Ga0265340_101823242 95
639 3300031249 Ga0265339_10203016 Ga0265339_102030161 95
640 3300044694 Ga0466963_0543005 Ga0466963_0543005_106_438 95
641 3300045049 Ga0466959_0087070 Ga0466959_0087070_1448_1780 95
642 3300048905 Ga0496102_0048790 Ga0496102_0048790_3225_3557 95
643 3300050512 nmdc:mga0n895_79118_c1 nmdc:mga0n895_79118_c1_2845_3177 95
644 3300004799 Ga0058863_10104695 Ga0058863_101046952 96
645 3300004800 Ga0058861_10097431 Ga0058861_100974312 96
646 3300004803 Ga0058862_10156525 Ga0058862_101565252 96
647 3300004803 Ga0058862_12488943 Ga0058862_124889432 96
648 3300005336 Ga0070680_100131229 Ga0070680_1001312292 96
649 3300005336 Ga0070680_100184279 Ga0070680_1001842792 96
650 3300005336 Ga0070680_100201115 Ga0070680_1002011152 96
651 3300005344 Ga0070661_101186183 Ga0070661_1011861831 96
652 3300005458 Ga0070681_10761946 Ga0070681_107619462 96
653 3300005458 Ga0070681_10929653 Ga0070681_109296531 96
654 3300005530 Ga0070679_100260398 Ga0070679_1002603982 96
655 3300005530 Ga0070679_100364957 Ga0070679_1003649572 96
656 3300005530 Ga0070679_100447533 Ga0070679_1004475332 96
657 3300005535 Ga0070684_102195285 Ga0070684_1021952852 96
658 3300005539 Ga0068853_100163808 Ga0068853_1001638083 96
659 3300005563 Ga0068855_100308385 Ga0068855_1003083852 96
660 3300005563 Ga0068855_100447150 Ga0068855_1004471502 96
661 3300005578 Ga0068854_101840410 Ga0068854_1018404102 96
662 3300005616 Ga0068852_100186916 Ga0068852_1001869162 96
663 3300006163 Ga0070715_10596827 Ga0070715_105968271 96
664 3300009093 Ga0105240_10354494 Ga0105240_103544943 96
665 3300009545 Ga0105237_10085926 Ga0105237_100859263 96
666 3300009551 Ga0105238_10722674 Ga0105238_107226743 96
667 3300009551 Ga0105238_12155571 Ga0105238_121555711 96
668 3300013100 Ga0157373_10035887 Ga0157373_100358874 96
669 3300013104 Ga0157370_10016641 Ga0157370_100166416 96
670 3300013104 Ga0157370_10482660 Ga0157370_104826602 96
671 3300013104 Ga0157370_11106298 Ga0157370_111062982 96
672 3300013104 Ga0157370_11579951 Ga0157370_115799512 96
673 3300013105 Ga0157369_10748137 Ga0157369_107481371 96
674 3300014969 Ga0157376_11433499 Ga0157376_114334992 96
675 3300020069 Ga0197907_11266770 Ga0197907_112667702 96
676 3300020070 Ga0206356_11352823 Ga0206356_113528232 96
677 3300020610 Ga0154015_1176295 Ga0154015_11762954 96
678 3300022467 Ga0224712_10065096 Ga0224712_100650962 96
679 3300025906 Ga0207699_10698099 Ga0207699_106980991 96
680 3300025912 Ga0207707_10015609 Ga0207707_100156092 96
681 3300025912 Ga0207707_10156504 Ga0207707_101565042 96
682 3300025912 Ga0207707_10708025 Ga0207707_107080252 96
683 3300025913 Ga0207695_10327109 Ga0207695_103271092 96
684 3300025913 Ga0207695_10756816 Ga0207695_107568162 96
685 3300025914 Ga0207671_10363413 Ga0207671_103634132 96
686 3300025916 Ga0207663_10776581 Ga0207663_107765811 96
687 3300025917 Ga0207660_10000965 Ga0207660_100009657 96
688 3300025917 Ga0207660_10079653 Ga0207660_100796533 96
689 3300025917 Ga0207660_10281279 Ga0207660_102812792 96
690 3300025917 Ga0207660_10804244 Ga0207660_108042441 96
691 3300025920 Ga0207649_10797304 Ga0207649_107973042 96
692 3300025921 Ga0207652_10001244 Ga0207652_100012442 96
693 3300025921 Ga0207652_10447020 Ga0207652_104470202 96
694 3300025921 Ga0207652_10610633 Ga0207652_106106331 96
695 3300025921 Ga0207652_10714987 Ga0207652_107149872 96
696 3300025924 Ga0207694_10430026 Ga0207694_104300263 96
697 3300025929 Ga0207664_10564209 Ga0207664_105642092 96
698 3300025929 Ga0207664_10939876 Ga0207664_109398762 96
699 3300025949 Ga0207667_10154513 Ga0207667_101545132 96
700 3300025949 Ga0207667_10403086 Ga0207667_104030862 96
701 3300026041 Ga0207639_10592331 Ga0207639_105923312 96
702 3300028800 Ga0265338_10208577 Ga0265338_102085772 96
703 3300035083 Ga0373926_0336705 Ga0373926_0336705_201_542 96
704 3300035119 Ga0373956_0006894 Ga0373956_0006894_3689_4030 96
705 3300035172 Ga0373955_0031388 Ga0373955_0031388_478_819 96
706 3300035692 Ga0373935_0041183 Ga0373935_0041183_2153_2494 96
707 3300035695 Ga0373927_0930936 Ga0373927_0930936_88_429 96
708 3300035725 Ga0373947_0176418 Ga0373947_0176418_990_1331 96
709 3300036401 Ga0373937_0015152 Ga0373937_0015152_3716_4057 96
710 3300036401 Ga0373937_0694329 Ga0373937_0694329_427_768 96
711 3300037068 Ga0373925_0019116 Ga0373925_0019116_2354_2695 96
712 3300037466 Ga0395898_0512024 Ga0395898_0512024_336_671 96
713 3300044694 Ga0466963_0000697 Ga0466963_0000697_8563_8898 96
714 3300044842 Ga0466957_0000091 Ga0466957_0000091_9970_10332 96
715 3300045836 Ga0466958_1091681 Ga0466958_1091681_18_353 96
716 3300045976 Ga0466967_0004330 Ga0466967_0004330_4601_4936 96
717 3300045976 Ga0466967_0058846 Ga0466967_0058846_740_1075 96
718 3300046684 Ga0495669_0111833 Ga0495669_0111833_180_521 96
719 3300047317 Ga0495604_0033543 Ga0495604_0033543_744_1085 96
720 3300047322 Ga0495680_0821731 Ga0495680_0821731_12_353 96
721 3300048915 Ga0496112_0008453 Ga0496112_0008453_8235_8579 96
722 3300048916 Ga0496113_0632610 Ga0496113_0632610_282_626 96
723 3300053077 Ga0495601_0068298 Ga0495601_0068298_1879_2220 96
724 3300059490 Ga0587066_124454 Ga0587066_124454_145_480 96
725 3300059503 Ga0587080_101076 Ga0587080_101076_20_355 96
726 3300059513 Ga0587094_079710 Ga0587094_079710_20_355 96
727 3300059626 Ga0587115_086288 Ga0587115_086288_35_370 96
728 3300059644 Ga0587075_026980 Ga0587075_026980_354_689 96
729 3300059645 Ga0587076_096282 Ga0587076_096282_235_570 96
730 3300061719 Ga0466962_0331977 Ga0466962_0331977_251_586 96

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00420

Oxidored_q2

NADH-ubiquinone/plastoquinone oxidoreductase chain 4L

6

114

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qhm-assembly1.cif.gz_L cytochrome bcc-aa3 supercomplex (respiratory supercomplex iii2/iv2) from corynebacterium glutamicum (stigmatellin and azide bound) 0.8379 1 61
7qhm-assembly1.cif.gz_L cytochrome bcc-aa3 supercomplex (respiratory supercomplex iii2/iv2) from corynebacterium glutamicum (stigmatellin and azide bound) 0.8019 1 61
7q21-assembly1.cif.gz_k iii2-iv2 respiratory supercomplex from corynebacterium glutamicum 0.7734 1 61
6zkp-assembly1.cif.gz_K native complex i, open1 0.772 8 79
7q21-assembly1.cif.gz_k iii2-iv2 respiratory supercomplex from corynebacterium glutamicum 0.7432 1 61
ID Description Score Start End Superfamily
af_D3ZWV8_556_669_6.10.140.680 Special;Helix non-globular;Helix Hairpins; 0.8814 4 51 6.10.140.680
af_A0A0R0F7N4_1_104_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8483 1 80 1.20.1250.20
af_A0A0G2L969_41_315_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8159 4 61 1.25.40.10
5x19C01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8039 1 55 1.10.287.70
6nmpP01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8039 1 55 1.10.287.70
ID Description Score Start End GO Terms
AF-A0A380CJQ0-F1-model_v4 Preprotein translocase subunit SecE 0.8794 1 59 GO:0016020
AF-A0A7G5ZSZ6-F1-model_v4 MFS transporter 0.8707 1 80 GO:0016020
AF-A0A7Z8ABI3-F1-model_v4 deleted 0.8027 3 76
AF-A0A378IH31-F1-model_v4 Putative monovalent cation/H+ antiporter subunit G 0.8014 4 80 GO:0015297
GO:0016020
GO:0098662
AF-F8PY65-F1-model_v4 DUF202 domain-containing protein 0.7998 4 77 GO:0000329
GO:0012505
GO:0033254

Feature Viewer

pLDDT pTM Quality
72.92 0.55 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map