F477885

General Info

Members Datasets Scaffolds Average Seq Length
729 496 547 323

Family's Representative Sequence

Representative Sequence 3300048924|Ga0496121_0106268|Ga0496121_0106268_765_1751
Length 328
Sequence MPRAVVCRELGPPESLKLEDVPRAPLAPRQGQGQVRVAIHAAGLNFPDILMAAGEYQLKPPLPFTPGMEAAGEVTEVAGADGVSVGDKVIVKARFGCYADEIVVTPDQLVPLPSAFDYAQGAAFLAAHGTAYHALKDRAQMQPGEVLLVHGAGGGVGLAAVELGKVFGATVIACASSEEKLAVAQQRGADHGVLYGREPFKDAVKRITDGRGVDVVFDPVGGAIFEDSLRCIAWGARLLVIGFTGGIGVAKTNLVLIKGASVLGVRAGEAVRKNPALGVVRQHDLTRLANERRISPNISHRLPLEDYATAMRLLVDRRAIGRVVLTMR

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
3 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
4 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
5 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
6 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
7 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
8 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
9 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
10 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
11 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
12 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
13 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
14 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
15 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
16 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
17 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
18 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
19 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
20 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
21 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
22 2643221651 Afipia sp. Root123D2 Isolate Unclassified
23 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
24 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
25 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
26 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
27 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
28 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
29 2791355199
30 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
31 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
32 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
33 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
34 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
35 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
36 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
37 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
38 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
39 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
40 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
41 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
42 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
43 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
44 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
45 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
46 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
47 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
48 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
49 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
50 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
51 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
52 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
53 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
54 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
55 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
56 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
57 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
58 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
59 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
60 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
61 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
62 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
63 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
64 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
65 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
66 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
67 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
68 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
69 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
70 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
71 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
72 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
73 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
74 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
75 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
76 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
77 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
78 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
79 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
80 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
81 2904699407
82 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
83 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
84 2906610324
85 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
86 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
87 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
88 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
89 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
90 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
91 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
92 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
93 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
94 2922368715
95 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
96 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
97 2922425934
98 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
99 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
100 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
101 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
102 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
103 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
104 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
105 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
106 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
107 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
108 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
109 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
110 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
111 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
112 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
113 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
114 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
115 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
116 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
117 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
118 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
119 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
120 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
121 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
122 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
123 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
124 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
125 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
126 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
127 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
128 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
129 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
130 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
131 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
132 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
133 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
134 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
135 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
136 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
137 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
138 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
139 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
140 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
141 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
142 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
143 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
144 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
145 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
146 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
147 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
148 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
149 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
150 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
151 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
152 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
153 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
154 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
155 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
156 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
157 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
158 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
159 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
160 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
161 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
162 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
163 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
164 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
165 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
166 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
167 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
168 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
169 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
170 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
171 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
172 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
173 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
174 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
175 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
176 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
177 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
178 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
179 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
180 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
181 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
182 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
183 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
184 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
185 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
186 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
187 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
188 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
189 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
190 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
191 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
192 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
193 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
194 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
195 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
196 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
197 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
198 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
199 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
200 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
201 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
202 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
203 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
204 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
205 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
206 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
207 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
208 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
209 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
210 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
211 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
212 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
213 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
214 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
215 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
216 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
217 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
218 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
219 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
220 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
221 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
222 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
223 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
224 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
225 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
226 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
227 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
228 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
229 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
230 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
231 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
232 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
233 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
234 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
235 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
236 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
237 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
238 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
239 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
240 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
241 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
242 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
271 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
274 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
275 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
277 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
278 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
279 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
281 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
282 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
283 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
284 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
285 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
287 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
288 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
289 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
290 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
291 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
292 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
293 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
294 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
295 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
296 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
297 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
298 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
299 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
300 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
301 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
302 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
303 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
304 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
305 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
306 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
307 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
308 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
309 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
310 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
311 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
312 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
313 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
314 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
315 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
316 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
317 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
318 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
319 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
320 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
321 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
322 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
323 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
324 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
325 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
326 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
327 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
328 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
329 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
330 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
331 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
332 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
333 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
334 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
335 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
336 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
337 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
338 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
339 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
340 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
341 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
342 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
343 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
344 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
345 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
346 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
347 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
348 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
349 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
350 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
351 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
352 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
353 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
354 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
355 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
356 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
357 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
358 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
359 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
360 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
361 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
362 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
363 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
364 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
365 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
366 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
367 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
368 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
369 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
370 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
371 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
372 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
373 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
374 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
375 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
376 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
377 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
378 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
379 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
380 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
381 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
382 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
383 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
384 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
385 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
386 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
387 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
388 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
389 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
390 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
391 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
392 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
393 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
394 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
395 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
396 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
397 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
398 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
399 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
400 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
401 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
402 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
403 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
404 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
405 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
406 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
407 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
408 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
409 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
410 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
411 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
412 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
413 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
414 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
415 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
416 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
417 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
418 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
419 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
420 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
421 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
422 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
423 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
424 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
425 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
426 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
427 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
428 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
429 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
430 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
431 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
432 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
433 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
434 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
435 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
436 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
437 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
438 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
439 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
440 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
441 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
442 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
443 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
444 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
445 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
446 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
447 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
448 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
449 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
450 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
451 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
452 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
453 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
454 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
455 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
456 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
457 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
458 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
459 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
460 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
461 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
462 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
463 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
464 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
465 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
466 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
467 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
468 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
469 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
470 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
471 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
472 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
473 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
474 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
475 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
476 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
477 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
478 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
479 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
480 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
481 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
482 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
483 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
484 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
485 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
486 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
487 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
488 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
489 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
490 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
491 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
492 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
493 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
494 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
495 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
496 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 75.55
Metatranscriptomes 0
Isolates 24.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.76
Nodule 19.75
Rhizoplane 7.13
Rhizosphere 47.19
Stem 0
Stem Tuber 0
Unclassified 13.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10006992 3300003215 Bacteria 5622
2 JGI25153J46596_10013502 3300003215 Bacteria 3446
3 JGI25153J46596_10028198 3300003215 Bacteria 1952
4 JGI25160J50197_1003053 3300003354 Bacteria 7635
5 JGI25160J50197_1006569 3300003354 Bacteria 4687
6 JGI25160J50197_1008476 3300003354 Bacteria 3913
7 Ga0055531_10002184 3300003794 Bacteria 13342
8 Ga0055543_1002709 3300004625 Bacteria 5664
9 Ga0055543_1019394 3300004625 Bacteria 1259
10 Ga0065165_1002008 3300005262 Bacteria 19054
11 Ga0065165_1003321 3300005262 Bacteria 11502
12 Ga0065165_1019182 3300005262 Bacteria 2450
13 Ga0070683_100104782 3300005329 Bacteria 2665
14 Ga0070691_10136730 3300005341 Bacteria 1246
15 Ga0070671_100040085 3300005355 Bacteria 3888
16 Ga0070671_100152055 3300005355 Bacteria 1954
17 Ga0070671_100397954 3300005355 Bacteria 1178
18 Ga0070674_100026876 3300005356 Bacteria 3765
19 Ga0070659_100118374 3300005366 Bacteria 2143
20 Ga0070659_100136260 3300005366 Bacteria 1996
21 Ga0070659_100176911 3300005366 Bacteria 1750
22 Ga0070714_100072130 3300005435 Bacteria 2989
23 Ga0070713_100027904 3300005436 Bacteria 4452
24 Ga0070711_100061847 3300005439 Bacteria 2608
25 Ga0070711_100170657 3300005439 Bacteria 1657
26 Ga0070663_100059606 3300005455 Bacteria 2743
27 Ga0070663_100117828 3300005455 Bacteria 2002
28 Ga0070678_100063017 3300005456 Bacteria 2741
29 Ga0070681_10207592 3300005458 Bacteria 1875
30 Ga0068867_100335067 3300005459 Bacteria 1258
31 Ga0070699_100289351 3300005518 Bacteria 1469
32 Ga0070684_100210520 3300005535 Bacteria 1772
33 Ga0068853_100032760 3300005539 Bacteria 4404
34 Ga0068853_100080791 3300005539 Bacteria 2846
35 Ga0068853_100432525 3300005539 Bacteria 1236
36 Ga0070672_100303163 3300005543 Bacteria 1354
37 Ga0070665_100091247 3300005548 Bacteria 3052
38 Ga0070665_100164440 3300005548 Bacteria 2221
39 Ga0070665_100176989 3300005548 Bacteria 2134
40 Ga0070665_100262055 3300005548 Bacteria 1730
41 Ga0068855_100029681 3300005563 Bacteria 6537
42 Ga0068855_100272316 3300005563 Bacteria 1882
43 Ga0068857_100034794 3300005577 Bacteria 4456
44 Ga0068854_100033432 3300005578 Bacteria 3585
45 Ga0068854_100311938 3300005578 Bacteria 1276
46 Ga0068856_100059957 3300005614 Bacteria 3759
47 Ga0068856_100151937 3300005614 Bacteria 2325
48 Ga0068856_100172852 3300005614 Bacteria 2173
49 Ga0068856_100316529 3300005614 Bacteria 1578
50 Ga0068856_100426575 3300005614 Bacteria 1346
51 Ga0068852_100127562 3300005616 Bacteria 2338
52 Ga0068852_100140619 3300005616 Bacteria 2233
53 Ga0068852_100210129 3300005616 Bacteria 1846
54 Ga0068852_100462671 3300005616 Bacteria 1258
55 Ga0068859_100293006 3300005617 Bacteria 1720
56 Ga0068864_100041362 3300005618 Bacteria 3942
57 Ga0068861_100028438 3300005719 Bacteria 4079
58 Ga0068861_100058215 3300005719 Bacteria 2954
59 Ga0068851_10086843 3300005834 Bacteria 1642
60 Ga0068851_10090151 3300005834 Bacteria 1613
61 Ga0068863_100455261 3300005841 Bacteria 1256
62 Ga0068863_100468613 3300005841 Bacteria 1238
63 Ga0068858_100015486 3300005842 Bacteria 7171
64 Ga0068860_100006537 3300005843 Bacteria 11700
65 Ga0068860_100063240 3300005843 Bacteria 3515
66 Ga0068860_100405025 3300005843 Bacteria 1350
67 Ga0068862_100080802 3300005844 Bacteria 2819
68 Ga0068862_100147298 3300005844 Bacteria 2093
69 Ga0068862_100169042 3300005844 Bacteria 1956
70 Ga0081455_10007549 3300005937 Bacteria 11436
71 Ga0081540_1001498 3300005983 Bacteria 20120
72 Ga0081540_1007278 3300005983 Bacteria 7924
73 Ga0081540_1010330 3300005983 Bacteria 6331
74 Ga0081540_1011806 3300005983 Bacteria 5806
75 Ga0081540_1025933 3300005983 Bacteria 3359
76 Ga0081540_1061880 3300005983 Bacteria 1782
77 Ga0081540_1095883 3300005983 Bacteria 1291
78 Ga0081539_10000726 3300005985 Bacteria 66051
79 Ga0081539_10039521 3300005985 Bacteria 2782
80 Ga0081539_10088789 3300005985 Bacteria 1602
81 Ga0075365_10053901 3300006038 Bacteria 2665
82 Ga0075365_10116928 3300006038 Bacteria 1836
83 Ga0075365_10176280 3300006038 Bacteria 1493
84 Ga0075368_10041526 3300006042 Bacteria 1807
85 Ga0075363_100094919 3300006048 Bacteria 1644
86 Ga0075364_10024769 3300006051 Bacteria 3813
87 Ga0070712_100048762 3300006175 Bacteria 2937
88 Ga0075367_10002487 3300006178 Bacteria 8442
89 Ga0075367_10034297 3300006178 Bacteria 2931
90 Ga0075367_10112461 3300006178 Bacteria 1672
91 Ga0097621_100029785 3300006237 Bacteria 4314
92 Ga0097621_100111716 3300006237 Bacteria 2310
93 Ga0068871_100101694 3300006358 Bacteria 2408
94 Ga0075428_100227353 3300006844 Bacteria 2014
95 Ga0075434_100113763 3300006871 Bacteria 2718
96 Ga0068865_100167336 3300006881 Bacteria 1682
97 Ga0068865_100221467 3300006881 Bacteria 1479
98 Ga0097620_100293006 3300006931 Bacteria 1720
99 Ga0099824_1013588 3300006942 Bacteria 8399
100 Ga0099824_1032175 3300006942 Bacteria 1903
101 Ga0099823_1048446 3300006944 Bacteria 2701
102 Ga0075435_100115090 3300007076 Bacteria 2239
103 Ga0105240_10010641 3300009093 Bacteria 12917
104 Ga0105240_10345344 3300009093 Bacteria 1690
105 Ga0105240_10501239 3300009093 Bacteria 1350
106 Ga0111539_10121045 3300009094 Bacteria 3067
107 Ga0105245_10068511 3300009098 Bacteria 3216
108 Ga0105245_10118252 3300009098 Bacteria 2473
109 Ga0114129_10101918 3300009147 Bacteria 3970
110 Ga0105243_10025134 3300009148 Bacteria 4548
111 Ga0105243_10209828 3300009148 Bacteria 1714
112 Ga0105243_10395159 3300009148 Bacteria 1283
113 Ga0105241_10059471 3300009174 Bacteria 2938
114 Ga0105241_10201831 3300009174 Bacteria 1661
115 Ga0105241_10313071 3300009174 Bacteria 1351
116 Ga0105241_10318435 3300009174 Bacteria 1340
117 Ga0105248_10065648 3300009177 Bacteria 4075
118 Ga0105248_10186777 3300009177 Bacteria 2335
119 Ga0105248_10265965 3300009177 Bacteria 1930
120 Ga0105248_10351505 3300009177 Bacteria 1659
121 Ga0105237_10004145 3300009545 Bacteria 16891
122 Ga0105237_10024695 3300009545 Bacteria 6147
123 Ga0105237_10070302 3300009545 Bacteria 3496
124 Ga0105237_10152706 3300009545 Bacteria 2306
125 Ga0105237_10263430 3300009545 Bacteria 1726
126 Ga0105238_10080027 3300009551 Bacteria 3257
127 Ga0099796_10012659 3300010159 Bacteria 2389
128 Ga0105239_10046661 3300010375 Bacteria 4747
129 Ga0105239_10060893 3300010375 Bacteria 4143
130 Ga0105239_10062712 3300010375 Bacteria 4079
131 Ga0105239_10083618 3300010375 Bacteria 3515
132 Ga0105239_10151918 3300010375 Bacteria 2584
133 Ga0105239_10347772 3300010375 Bacteria 1674
134 Ga0105246_10010071 3300011119 Bacteria 5835
135 Ga0157370_10079560 3300013104 Bacteria 3086
136 Ga0157369_10395679 3300013105 Bacteria 1433
137 Ga0157374_10011421 3300013296 Bacteria 7689
138 Ga0157374_10079256 3300013296 Bacteria 3112
139 Ga0157378_10183677 3300013297 Bacteria 1968
140 Ga0163162_10094550 3300013306 Bacteria 3075
141 Ga0163162_10280498 3300013306 Bacteria 1798
142 Ga0157375_10148274 3300013308 Bacteria 2479
143 Ga0157375_10388808 3300013308 Bacteria 1562
144 Ga0163163_10059377 3300014325 Bacteria 3783
145 Ga0163163_10420762 3300014325 Bacteria 1395
146 Ga0157379_10016120 3300014968 Bacteria 6572
147 Ga0157379_10043659 3300014968 Bacteria 4002
148 Ga0157376_10347825 3300014969 Bacteria 1418
149 Ga0214544_1000006 3300021320 Bacteria 380728
150 Ga0214542_1000002 3300021321 Bacteria 720798
151 Ga0214545_1000002 3300021324 Bacteria 727485
152 Ga0214543_1000017 3300021327 Bacteria 290109
153 Ga0213871_10009496 3300021441 Bacteria 2181
154 Ga0209563_101461 3300025230 Bacteria 6240
155 Ga0209677_108682 3300025253 Bacteria 1930
156 Ga0209148_1000447 3300025254 Bacteria 45273
157 Ga0209564_1003910 3300025295 Bacteria 9545
158 Ga0209758_1000065 3300025297 Bacteria 306288
159 Ga0209758_1002429 3300025297 Bacteria 19044
160 Ga0209758_1003622 3300025297 Bacteria 13820
161 Ga0209758_1025282 3300025297 Bacteria 2611
162 Ga0209758_1025863 3300025297 Bacteria 2561
163 Ga0209256_1011253 3300025299 Bacteria 3607
164 Ga0209256_1021691 3300025299 Bacteria 1963
165 Ga0207426_1000554 3300025302 Bacteria 51521
166 Ga0207426_1000561 3300025302 Bacteria 50758
167 Ga0207426_1002946 3300025302 Bacteria 9999
168 Ga0209257_1000833 3300025304 Bacteria 44467
169 Ga0209257_1031441 3300025304 Bacteria 1697
170 Ga0207656_10066356 3300025321 Bacteria 1595
171 Ga0207688_10006431 3300025901 Bacteria 6399
172 Ga0207688_10019196 3300025901 Bacteria 3722
173 Ga0207647_10089740 3300025904 Bacteria 1834
174 Ga0207705_10304071 3300025909 Bacteria 1224
175 Ga0207654_10000803 3300025911 Bacteria 17284
176 Ga0207654_10002540 3300025911 Bacteria 9257
177 Ga0207707_10165102 3300025912 Bacteria 1935
178 Ga0207695_10000029 3300025913 Bacteria 548364
179 Ga0207695_10001543 3300025913 Bacteria 37956
180 Ga0207671_10018788 3300025914 Bacteria 5296
181 Ga0207671_10156511 3300025914 Bacteria 1763
182 Ga0207693_10255227 3300025915 Bacteria 1375
183 Ga0207663_10129358 3300025916 Bacteria 1742
184 Ga0207657_10009798 3300025919 Bacteria 9604
185 Ga0207694_10232227 3300025924 Bacteria 1507
186 Ga0207650_10061111 3300025925 Bacteria 2812
187 Ga0207659_10206460 3300025926 Bacteria 1572
188 Ga0207687_10013194 3300025927 Bacteria 5397
189 Ga0207687_10168295 3300025927 Bacteria 1688
190 Ga0207700_10042530 3300025928 Bacteria 3332
191 Ga0207700_10154985 3300025928 Bacteria 1897
192 Ga0207664_10301067 3300025929 Bacteria 1411
193 Ga0207690_10107884 3300025932 Bacteria 2000
194 Ga0207706_10099577 3300025933 Bacteria 2557
195 Ga0207706_10136104 3300025933 Bacteria 2161
196 Ga0207706_10345983 3300025933 Bacteria 1293
197 Ga0207709_10012963 3300025935 Bacteria 4596
198 Ga0207669_10040409 3300025937 Bacteria 2706
199 Ga0207669_10062176 3300025937 Bacteria 2298
200 Ga0207704_10095030 3300025938 Bacteria 1970
201 Ga0207691_10081307 3300025940 Bacteria 2912
202 Ga0207691_10139582 3300025940 Bacteria 2136
203 Ga0207689_10010305 3300025942 Bacteria 8050
204 Ga0207689_10062250 3300025942 Bacteria 3068
205 Ga0207667_10007604 3300025949 Bacteria 12991
206 Ga0207667_10018352 3300025949 Bacteria 7849
207 Ga0207667_10296277 3300025949 Bacteria 1652
208 Ga0207712_10026160 3300025961 Bacteria 3885
209 Ga0207668_10062476 3300025972 Bacteria 2622
210 Ga0207658_10242860 3300025986 Bacteria 1527
211 Ga0207703_10282370 3300026035 Bacteria 1508
212 Ga0207703_10562422 3300026035 Bacteria 1076
213 Ga0207639_10028861 3300026041 Bacteria 4055
214 Ga0207678_10025273 3300026067 Bacteria 5185
215 Ga0207678_10052363 3300026067 Bacteria 3522
216 Ga0207678_10061520 3300026067 Bacteria 3229
217 Ga0207678_10069743 3300026067 Bacteria 3014
218 Ga0207678_10074580 3300026067 Bacteria 2907
219 Ga0207678_10087953 3300026067 Bacteria 2655
220 Ga0207678_10096275 3300026067 Bacteria 2529
221 Ga0207678_10151195 3300026067 Bacteria 1982
222 Ga0207702_10000005 3300026078 Bacteria 420296
223 Ga0207702_10000081 3300026078 Bacteria 108009
224 Ga0207702_10255519 3300026078 Bacteria 1647
225 Ga0207702_10601286 3300026078 Bacteria 1079
226 Ga0207641_10442313 3300026088 Bacteria 1255
227 Ga0207648_10135637 3300026089 Bacteria 2168
228 Ga0207676_10405879 3300026095 Bacteria 1274
229 Ga0207674_10043098 3300026116 Bacteria 4655
230 Ga0207675_100011579 3300026118 Bacteria 8248
231 Ga0207675_100033023 3300026118 Bacteria 4822
232 Ga0207683_10072768 3300026121 Bacteria 3040
233 Ga0207683_10106285 3300026121 Bacteria 2510
234 Ga0207683_10116567 3300026121 Bacteria 2394
235 Ga0207683_10154195 3300026121 Bacteria 2074
236 Ga0207683_10327657 3300026121 Bacteria 1403
237 Ga0207698_10062290 3300026142 Bacteria 2912
238 Ga0207698_10077585 3300026142 Bacteria 2664
239 Ga0207698_10286857 3300026142 Bacteria 1525
240 Ga0209389_1000011 3300027296 Bacteria 223265
241 Ga0209389_1000025 3300027296 Bacteria 149588
242 Ga0209589_1000009 3300027357 Bacteria 252104
243 Ga0209589_1000066 3300027357 Bacteria 100795
244 Ga0209489_100010 3300027361 Bacteria 252139
245 Ga0209489_100017 3300027361 Bacteria 223265
246 Ga0209489_100030 3300027361 Bacteria 185999
247 Ga0209700_100017 3300027363 Bacteria 252104
248 Ga0209700_100027 3300027363 Bacteria 223462
249 Ga0268266_10001147 3300028379 Bacteria 32898
250 Ga0268266_10008591 3300028379 Bacteria 9072
251 Ga0268266_10014072 3300028379 Bacteria 6886
252 Ga0268266_10033130 3300028379 Bacteria 4393
253 Ga0268266_10066804 3300028379 Bacteria 3111
254 Ga0268266_10426890 3300028379 Bacteria 1257
255 Ga0268265_10044846 3300028380 Bacteria 3295
256 Ga0268265_10082002 3300028380 Bacteria 2549
257 Ga0268265_10156508 3300028380 Bacteria 1929
258 Ga0268264_10000035 3300028381 Bacteria 398196
259 Ga0265326_10002319 3300028558 Bacteria 6427
260 Ga0265319_1001659 3300028563 Bacteria 12877
261 Ga0265334_10000799 3300028573 Bacteria 15763
262 Ga0265318_10010755 3300028577 Bacteria 3971
263 Ga0265323_10003079 3300028653 Bacteria 7427
264 Ga0265322_10002933 3300028654 Bacteria 5194
265 Ga0265336_10000233 3300028666 Bacteria 39706
266 Ga0307517_10000062 3300028786 Bacteria 145054
267 Ga0307515_10063942 3300028794 Bacteria 5154
268 Ga0265338_10000090 3300028800 Bacteria 171540
269 Ga0265324_10006268 3300029957 Bacteria 4993
270 Ga0265330_10036948 3300031235 Bacteria 2175
271 Ga0265340_10001013 3300031247 Bacteria 15991
272 Ga0265331_10100264 3300031250 Bacteria 1333
273 Ga0307509_10015347 3300031507 Bacteria 8940
274 Ga0307509_10287354 3300031507 Bacteria 1401
275 Ga0307509_10358228 3300031507 Bacteria 1179
276 Ga0307508_10000532 3300031616 Bacteria 45338
277 Ga0307508_10007265 3300031616 Bacteria 10313
278 Ga0265314_10043780 3300031711 Bacteria 3179
279 Ga0265342_10154022 3300031712 Bacteria 1274
280 Ga0265342_10188823 3300031712 Bacteria 1125
281 Ga0307516_10012214 3300031730 Bacteria 9273
282 Ga0307516_10012607 3300031730 Bacteria 9094
283 Ga0307516_10097233 3300031730 Bacteria 2764
284 Ga0307516_10192637 3300031730 Bacteria 1764
285 Ga0307516_10310552 3300031730 Bacteria 1250
286 Ga0307413_10279574 3300031824 Bacteria 1255
287 Ga0307412_10075388 3300031911 Bacteria 2314
288 Ga0307409_100462482 3300031995 Bacteria 1227
289 Ga0307415_100061564 3300032126 Bacteria 2599
290 Ga0307415_100324726 3300032126 Bacteria 1285
291 Ga0307507_10023504 3300033179 Bacteria 6764
292 Ga0307510_10018748 3300033180 Bacteria 8132
293 Ga0307510_10075582 3300033180 Bacteria 3320
294 Ga0315911_1000009 3300033442 Bacteria 379354
295 Ga0373928_0008426 3300035084 Bacteria 2002
296 Ga0373939_0031774 3300035114 Bacteria 1529
297 Ga0373946_0028104 3300035171 Bacteria 2229
298 Ga0373931_0228115 3300035691 Bacteria 1124
299 Ga0373927_0082643 3300035695 Bacteria 2083
300 Ga0373927_0237369 3300035695 Bacteria 1198
301 Ga0373933_0000167 3300035724 Bacteria 42851
302 Ga0373947_0108025 3300035725 Bacteria 1755
303 Ga0373925_0087293 3300037068 Bacteria 2381
304 Ga0395899_0034271 3300037312 Bacteria 3812
305 Ga0395900_0019057 3300037418 Bacteria 6996
306 Ga0395898_0188863 3300037466 Bacteria 1969
307 Ga0395898_0222633 3300037466 Bacteria 1800
308 Ga0395905_0233194 3300037471 Bacteria 1721
309 Ga0436364_1156934 3300037853 Bacteria 1570
310 Ga0395901_0034427 3300038443 Bacteria 5231
311 Ga0395901_0152438 3300038443 Bacteria 2429
312 Ga0436360_1060898 3300039438 Bacteria 1415
313 Ga0436361_0152747 3300039447 Bacteria 2046
314 Ga0451853_1980775 3300041512 Bacteria 974
315 Ga0466969_0013180 3300044656 Bacteria 4356
316 Ga0466965_0056339 3300044683 Bacteria 1957
317 Ga0466966_0000148 3300044684 Bacteria 44828
318 Ga0466961_0000045 3300044693 Bacteria 75331
319 Ga0466964_0050790 3300044706 Bacteria 1701
320 Ga0466964_0060246 3300044706 Bacteria 1578
321 Ga0466968_0029823 3300044735 Bacteria 2257
322 Ga0466970_0042331 3300044765 Bacteria 2422
323 Ga0466957_0129504 3300044842 Bacteria 1615
324 Ga0466957_0157108 3300044842 Bacteria 1475
325 Ga0466960_0189599 3300044901 Bacteria 1118
326 Ga0466959_0003014 3300045049 Bacteria 10882
327 Ga0466959_0021412 3300045049 Bacteria 4768
328 Ga0495603_0018889 3300046455 Bacteria 4172
329 Ga0495603_0043688 3300046455 Bacteria 2675
330 Ga0495590_0015098 3300046457 Bacteria 2810
331 Ga0495629_0092111 3300046459 Bacteria 2116
332 Ga0495629_0096403 3300046459 Bacteria 2063
333 Ga0495638_0010390 3300046460 Bacteria 6470
334 Ga0495638_0020052 3300046460 Bacteria 4418
335 Ga0495638_0044353 3300046460 Bacteria 2801
336 Ga0495638_0129249 3300046460 Bacteria 1485
337 Ga0495651_0000472 3300046462 Bacteria 30989
338 Ga0495651_0311975 3300046462 Bacteria 1051
339 Ga0495653_0039871 3300046463 Bacteria 3676
340 Ga0495650_0040691 3300046471 Bacteria 1993
341 Ga0495580_0115154 3300046472 Bacteria 1867
342 Ga0495582_0120896 3300046473 Bacteria 1476
343 Ga0495664_0017778 3300046477 Bacteria 4065
344 Ga0495664_0316803 3300046477 Bacteria 941
345 Ga0495585_0065988 3300046492 Bacteria 1982
346 Ga0495594_0062068 3300046499 Bacteria 2069
347 Ga0495607_0067717 3300046501 Bacteria 2005
348 Ga0495606_0004247 3300046507 Bacteria 14485
349 Ga0495606_0005996 3300046507 Bacteria 11391
350 Ga0495606_0202546 3300046507 Bacteria 1130
351 Ga0495608_0018937 3300046511 Bacteria 4745
352 Ga0495610_0039561 3300046512 Bacteria 2383
353 Ga0495616_0100607 3300046513 Bacteria 1356
354 Ga0495628_0016126 3300046516 Bacteria 6234
355 Ga0495630_0136574 3300046517 Bacteria 1863
356 Ga0495631_0043205 3300046518 Bacteria 1988
357 Ga0495643_0029296 3300046522 Bacteria 3081
358 Ga0495643_0047211 3300046522 Bacteria 2333
359 Ga0495644_0021386 3300046523 Bacteria 2468
360 Ga0495648_0003979 3300046524 Bacteria 12789
361 Ga0495648_0092725 3300046524 Bacteria 1686
362 Ga0495663_0057358 3300046525 Bacteria 1218
363 Ga0495652_0001339 3300046529 Bacteria 27421
364 Ga0495587_0012944 3300046536 Bacteria 5245
365 Ga0495622_0027387 3300046557 Bacteria 2660
366 Ga0495622_0068564 3300046557 Bacteria 1638
367 Ga0495633_0135270 3300046558 Bacteria 1140
368 Ga0495667_0007621 3300046559 Bacteria 7343
369 Ga0495656_0001067 3300046615 Bacteria 8878
370 Ga0495656_0025016 3300046615 Bacteria 2363
371 Ga0495668_0024598 3300046616 Bacteria 3425
372 Ga0495668_0209439 3300046616 Bacteria 1067
373 Ga0495634_0013513 3300046642 Bacteria 5898
374 Ga0495611_0010250 3300046648 Bacteria 3965
375 Ga0495625_0043231 3300046660 Bacteria 3269
376 Ga0495625_0053001 3300046660 Bacteria 2903
377 Ga0495588_0046912 3300046674 Bacteria 2217
378 Ga0495657_0005672 3300046675 Bacteria 9843
379 Ga0495599_0016375 3300046678 Bacteria 4602
380 Ga0495623_0004396 3300046679 Bacteria 9261
381 Ga0495669_0024616 3300046684 Bacteria 2621
382 Ga0495669_0145660 3300046684 Bacteria 1119
383 Ga0495613_0027045 3300046689 Bacteria 4270
384 Ga0495670_0016306 3300046691 Bacteria 3650
385 Ga0495671_0119520 3300046692 Bacteria 1286
386 Ga0495649_0050747 3300046694 Bacteria 2250
387 Ga0495600_0006605 3300046809 Bacteria 7066
388 Ga0495581_0108464 3300047315 Bacteria 1614
389 Ga0495604_0000953 3300047317 Bacteria 24133
390 Ga0495674_0008322 3300047319 Bacteria 9890
391 Ga0495672_0015872 3300047320 Bacteria 5099
392 Ga0495672_0021750 3300047320 Bacteria 4178
393 Ga0495676_0014964 3300047321 Bacteria 6924
394 Ga0495680_0001642 3300047322 Bacteria 23759
395 Ga0495687_042517 3300047443 Bacteria 1985
396 Ga0495686_0128589 3300047472 Bacteria 1504
397 Ga0495686_0179108 3300047472 Bacteria 1229
398 Ga0495593_0041694 3300047673 Bacteria 2467
399 Ga0495602_0019800 3300048088 Bacteria 6667
400 Ga0495615_0039805 3300048090 Bacteria 1168
401 Ga0495615_0042269 3300048090 Bacteria 1143
402 Ga0495615_0049047 3300048090 Bacteria 1081
403 Ga0496100_0136209 3300048903 Bacteria 1735
404 Ga0496100_0150824 3300048903 Bacteria 1658
405 Ga0496101_0179936 3300048904 Bacteria 1628
406 Ga0496101_0289218 3300048904 Bacteria 1282
407 Ga0496102_0009044 3300048905 Bacteria 8548
408 Ga0496102_0057494 3300048905 Bacteria 3552
409 Ga0496102_0244571 3300048905 Bacteria 1692
410 Ga0496102_0285540 3300048905 Bacteria 1555
411 Ga0496102_0316404 3300048905 Bacteria 1470
412 Ga0496103_0015643 3300048906 Bacteria 4521
413 Ga0496103_0106108 3300048906 Bacteria 1781
414 Ga0496104_0004724 3300048907 Bacteria 11857
415 Ga0496104_0078088 3300048907 Bacteria 3154
416 Ga0496104_0194318 3300048907 Bacteria 1941
417 Ga0496104_0322309 3300048907 Bacteria 1458
418 Ga0496105_0011117 3300048908 Bacteria 7100
419 Ga0496105_0106881 3300048908 Bacteria 2310
420 Ga0496106_0027320 3300048909 Bacteria 4250
421 Ga0496106_0046484 3300048909 Bacteria 3264
422 Ga0496106_0063950 3300048909 Bacteria 2798
423 Ga0496106_0129070 3300048909 Bacteria 1981
424 Ga0496106_0216270 3300048909 Bacteria 1527
425 Ga0496106_0318787 3300048909 Bacteria 1248
426 Ga0496107_0065379 3300048910 Bacteria 2636
427 Ga0496107_0065968 3300048910 Bacteria 2624
428 Ga0496108_0015476 3300048911 Bacteria 6222
429 Ga0496108_0138255 3300048911 Bacteria 2098
430 Ga0496109_0019407 3300048912 Bacteria 5995
431 Ga0496109_0020502 3300048912 Bacteria 5839
432 Ga0496109_0112483 3300048912 Bacteria 2532
433 Ga0496110_0072371 3300048913 Bacteria 3058
434 Ga0496110_0074209 3300048913 Bacteria 3020
435 Ga0496111_0091246 3300048914 Bacteria 2232
436 Ga0496111_0296162 3300048914 Bacteria 1199
437 Ga0496112_0004323 3300048915 Bacteria 12012
438 Ga0496112_0088407 3300048915 Bacteria 3066
439 Ga0496112_0127333 3300048915 Bacteria 2517
440 Ga0496112_0214242 3300048915 Bacteria 1883
441 Ga0496113_0028782 3300048916 Bacteria 4000
442 Ga0496113_0063686 3300048916 Bacteria 2787
443 Ga0496113_0132218 3300048916 Bacteria 1959
444 Ga0496114_0031614 3300048917 Bacteria 4354
445 Ga0496114_0187808 3300048917 Bacteria 1807
446 Ga0496114_0221690 3300048917 Bacteria 1660
447 Ga0496115_0011656 3300048918 Bacteria 6598
448 Ga0496115_0050745 3300048918 Bacteria 3325
449 Ga0496115_0057194 3300048918 Bacteria 3136
450 Ga0496115_0063037 3300048918 Bacteria 2991
451 Ga0496115_0067141 3300048918 Bacteria 2900
452 Ga0496115_0129053 3300048918 Bacteria 2083
453 Ga0496116_0003781 3300048919 Bacteria 14794
454 Ga0496117_0077577 3300048920 Bacteria 2198
455 Ga0496117_0083558 3300048920 Bacteria 2087
456 Ga0496118_0021551 3300048921 Bacteria 5667
457 Ga0496118_0046349 3300048921 Bacteria 3383
458 Ga0496120_0166747 3300048923 Bacteria 1093
459 Ga0496121_0001443 3300048924 Bacteria 40145
460 Ga0496121_0001527 3300048924 Bacteria 38742
461 Ga0496121_0006578 3300048924 Bacteria 14342
462 Ga0496121_0032132 3300048924 Bacteria 4777
463 Ga0496121_0056496 3300048924 Bacteria 3260
464 Ga0496121_0102601 3300048924 Bacteria 2203
465 Ga0496121_0106268 3300048924 Bacteria 2152
466 Ga0496121_0106850 3300048924 Bacteria 2145
467 Ga0496122_0026944 3300048925 Bacteria 4934
468 Ga0496124_0002203 3300048927 Bacteria 25990
469 Ga0496124_0244482 3300048927 Bacteria 1332
470 Ga0496124_0249313 3300048927 Bacteria 1315
471 Ga0496125_0000092 3300048928 Bacteria 211050
472 Ga0496125_0009813 3300048928 Bacteria 9756
473 Ga0496125_0090446 3300048928 Bacteria 2297
474 Ga0496125_0097212 3300048928 Bacteria 2182
475 Ga0496125_0101012 3300048928 Bacteria 2124
476 Ga0496126_0006684 3300048929 Bacteria 12815
477 Ga0496126_0039188 3300048929 Bacteria 4399
478 Ga0496126_0077337 3300048929 Bacteria 2950
479 Ga0496126_0257206 3300048929 Bacteria 1453
480 Ga0495682_0010078 3300049460 Bacteria 3670
481 Ga0501042_0276773 3300049578 Bacteria 1212
482 Ga0501047_0050488 3300049581 Bacteria 4017
483 Ga0501068_0201606 3300049584 Bacteria 1262
484 Ga0501070_0185960 3300049586 Bacteria 1709
485 Ga0501044_0233648 3300049823 Bacteria 1785
486 nmdc:mga03n38_124944_c1 3300050490 Bacteria 1269
487 nmdc:mga03n38_83409_c1 3300050490 Bacteria 1507
488 nmdc:mga00v17_202324_c1 3300050491 Bacteria 1284
489 nmdc:mga0yw44_112073_c1 3300050492 Bacteria 1749
490 nmdc:mga0yw44_25249_c2 3300050492 Bacteria 1573
491 nmdc:mga06z11_45600_c1 3300050494 Bacteria 2217
492 nmdc:mga04h51_45470_c1 3300050495 Bacteria 1452
493 nmdc:mga05p37_141697_c1 3300050507 Bacteria 2945
494 nmdc:mga0rr50_174705_c1 3300050513 Bacteria 1752
495 Ga0495601_0042376 3300053077 Bacteria 2856
496 Ga0495601_0286446 3300053077 Bacteria 1074
497 Ga0500635_0028777 3300053080 Bacteria 1778
498 Ga0495595_0062252 3300053084 Bacteria 1749
499 Ga0495619_0028489 3300053085 Bacteria 3603
500 Ga0500643_000019 3300053087 Bacteria 294301
501 Ga0500651_0061733 3300053093 Bacteria 2340
502 Ga0500651_0067270 3300053093 Bacteria 2231
503 Ga0500566_0000693 3300053094 Bacteria 18973
504 Ga0500566_0003060 3300053094 Bacteria 9993
505 Ga0500566_0004708 3300053094 Bacteria 8125
506 Ga0500641_0009503 3300053096 Bacteria 3498
507 Ga0500641_0021737 3300053096 Bacteria 2450
508 Ga0500641_0063799 3300053096 Bacteria 1538
509 Ga0500650_0002857 3300053098 Bacteria 5835
510 Ga0500556_0000024 3300053104 Bacteria 167556
511 Ga0500569_017427 3300053109 Bacteria 1836
512 Ga0500595_000478 3300053119 Bacteria 24694
513 Ga0500595_008096 3300053119 Bacteria 4312
514 Ga0500607_036478 3300053121 Bacteria 2684
515 Ga0500608_001404 3300053122 Bacteria 8620
516 Ga0500618_012076 3300053125 Bacteria 2272
517 Ga0500642_0000035 3300053130 Bacteria 106656
518 Ga0500642_0000096 3300053130 Bacteria 42836
519 Ga0500642_0014156 3300053130 Bacteria 2959
520 Ga0500642_0053040 3300053130 Bacteria 1797
521 Ga0500652_000404 3300053131 Bacteria 15463
522 Ga0500658_0022678 3300053134 Bacteria 2390
523 Ga0500658_0043662 3300053134 Bacteria 1805
524 Ga0500559_0039548 3300053136 Bacteria 2052
525 Ga0500568_0005040 3300053139 Bacteria 6916
526 Ga0500568_0017048 3300053139 Bacteria 3214
527 Ga0500577_0001147 3300053142 Bacteria 6786
528 Ga0500577_0079393 3300053142 Bacteria 1305
529 Ga0500586_001242 3300053145 Bacteria 5328
530 Ga0500604_0001709 3300053151 Bacteria 6155
531 Ga0500604_0045570 3300053151 Bacteria 1338
532 Ga0500616_0000122 3300053153 Bacteria 140228
533 Ga0500622_0000790 3300053156 Bacteria 27440
534 Ga0500634_0161980 3300053161 Bacteria 1031
535 Ga0500638_024000 3300053162 Bacteria 2903
536 Ga0500636_0000410 3300053177 Bacteria 23626
537 Ga0500636_0006371 3300053177 Bacteria 6769
538 Ga0500636_0017882 3300053177 Bacteria 4190
539 Ga0500637_0000245 3300053178 Bacteria 20132
540 Ga0500625_000095 3300053729 Bacteria 16474
541 Ga0500609_003240 3300053731 Bacteria 2303
542 Ga0500596_013260 3300053735 Bacteria 1246
543 Ga0500599_006070 3300053736 Bacteria 1534
544 Ga0500601_000120 3300053737 Bacteria 16487
545 Ga0500661_000938 3300055283 Bacteria 5458
546 Ga0500661_008979 3300055283 Bacteria 1836
547 Ga0500661_011620 3300055283 Bacteria 1591

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049584 Ga0501068_0201606 Ga0501068_0201606_10_867 277
2 3300046557 Ga0495622_0027387 Ga0495622_0027387_765_1691 289
3 iso_pu_bacteria 8019555841 8019558326 294
4 3300046616 Ga0495668_0209439 Ga0495668_0209439_25_924 299
5 3300053735 Ga0500596_013260 Ga0500596_013260_331_1236 300
6 3300035691 Ga0373931_0228115 Ga0373931_0228115_168_1079 301
7 3300046477 Ga0495664_0316803 Ga0495664_0316803_11_916 301
8 3300048908 Ga0496105_0106881 Ga0496105_0106881_1238_2149 301
9 3300048910 Ga0496107_0065968 Ga0496107_0065968_592_1503 301
10 3300048912 Ga0496109_0019407 Ga0496109_0019407_4833_5744 301
11 3300048913 Ga0496110_0072371 Ga0496110_0072371_607_1518 301
12 3300048915 Ga0496112_0088407 Ga0496112_0088407_1115_2026 301
13 3300048916 Ga0496113_0132218 Ga0496113_0132218_924_1835 301
14 3300048918 Ga0496115_0050745 Ga0496115_0050745_634_1545 301
15 3300041512 Ga0451853_1980775 Ga0451853_1980775_18_941 307
16 3300053077 Ga0495601_0286446 Ga0495601_0286446_109_1038 309
17 3300031507 Ga0307509_10358228 Ga0307509_103582282 312
18 3300033179 Ga0307507_10023504 Ga0307507_100235042 312
19 3300046459 Ga0495629_0092111 Ga0495629_0092111_465_1514 312
20 3300031507 Ga0307509_10015347 Ga0307509_100153474 313
21 3300048919 Ga0496116_0003781 Ga0496116_0003781_4353_5297 313
22 3300048928 Ga0496125_0101012 Ga0496125_0101012_558_1502 313
23 3300053080 Ga0500635_0028777 Ga0500635_0028777_113_1111 313
24 3300053136 Ga0500559_0039548 Ga0500559_0039548_220_1197 317
25 iso_pu_bacteria 2617270741 2617377997 319
26 iso_pu_bacteria 2824746037 2824751082 319
27 iso_pu_bacteria 2857509624 2857510000 319
28 iso_pu_bacteria 2889033259 2889039174 319
29 iso_pu_bacteria 2893066018 2893068959 319
30 iso_pu_bacteria 2906610324 2906610671 319
31 iso_pu_bacteria 2922425934 2922428653 319
32 iso_pu_bacteria 2935694250 2935695456 319
33 iso_pu_bacteria 3005587118 3005590666 319
34 iso_pu_bacteria 8019565922 8019566967 319
35 3300005843 Ga0068860_100006537 Ga0068860_1000065376 320
36 3300028381 Ga0268264_10000035 Ga0268264_10000035216 320
37 3300031730 Ga0307516_10012214 Ga0307516_100122148 320
38 3300031730 Ga0307516_10097233 Ga0307516_100972333 320
39 iso_pu_bacteria 2507262055 2507509971 320
40 iso_pu_bacteria 2508501128 2509147611 320
41 iso_pu_bacteria 2511231028 2511398902 320
42 iso_pu_bacteria 2513237092 2513627614 320
43 iso_pu_bacteria 2513237094 2513645016 320
44 iso_pu_bacteria 2513237095 2513652261 320
45 iso_pu_bacteria 2513237096 2513659266 320
46 iso_pu_bacteria 2513237101 2513696092 320
47 iso_pu_bacteria 2513237137 2513862038 320
48 iso_pu_bacteria 2513237145 2513921472 320
49 iso_pu_bacteria 2513237161 2514011273 320
50 iso_pu_bacteria 2517093001 2517103276 320
51 iso_pu_bacteria 2517572143 2517893786 320
52 iso_pu_bacteria 2524023205 2524439004 320
53 iso_pu_bacteria 2524023210 2524469411 320
54 iso_pu_bacteria 2524023228 2524537734 320
55 iso_pu_bacteria 2528768022 2528852738 320
56 iso_pu_bacteria 2602042107 2603861107 320
57 iso_pu_bacteria 2617270735 2617353446 320
58 iso_pu_bacteria 2643221651 2644287860 320
59 iso_pu_bacteria 2667528175 2671124125 320
60 iso_pu_bacteria 2721755755 2723846327 320
61 iso_pu_bacteria 2728368998 2728752929 320
62 iso_pu_bacteria 2744054633 2745078883 320
63 iso_pu_bacteria 2791355196 2793060041 320
64 iso_pu_bacteria 2791355197 2793070713 320
65 iso_pu_bacteria 2791355199 2793083271 320
66 iso_pu_bacteria 2816332527 2818242486 320
67 iso_pu_bacteria 2824600985 2824605657 320
68 iso_pu_bacteria 2824609381 2824609908 320
69 iso_pu_bacteria 2824653114 2824655693 320
70 iso_pu_bacteria 2824661429 2824666579 320
71 iso_pu_bacteria 2824679649 2824686620 320
72 iso_pu_bacteria 2824704595 2824707786 320
73 iso_pu_bacteria 2824753945 2824758095 320
74 iso_pu_bacteria 2824763712 2824766233 320
75 iso_pu_bacteria 2824773399 2824774246 320
76 iso_pu_bacteria 2838122688 2838127583 320
77 iso_pu_bacteria 2841941048 2841941466 320
78 iso_pu_bacteria 2841949485 2841952523 320
79 iso_pu_bacteria 2841957949 2841959541 320
80 iso_pu_bacteria 2841966195 2841967607 320
81 iso_pu_bacteria 2841974524 2841979002 320
82 iso_pu_bacteria 2841983080 2841986544 320
83 iso_pu_bacteria 2842038055 2842038312 320
84 iso_pu_bacteria 2842045827 2842048743 320
85 iso_pu_bacteria 2844315083 2844317784 320
86 iso_pu_bacteria 2847930680 2847934570 320
87 iso_pu_bacteria 2849076700 2849080637 320
88 iso_pu_bacteria 2857524615 2857528764 320
89 iso_pu_bacteria 2874604998 2874610705 320
90 iso_pu_bacteria 2874612657 2874618271 320
91 iso_pu_bacteria 2874620515 2874623261 320
92 iso_pu_bacteria 2874628541 2874635961 320
93 iso_pu_bacteria 2874645413 2874653052 320
94 iso_pu_bacteria 2876761206 2876766642 320
95 iso_pu_bacteria 2876808645 2876811733 320
96 iso_pu_bacteria 2879083081 2879089758 320
97 iso_pu_bacteria 2879099564 2879104036 320
98 iso_pu_bacteria 2879110137 2879118784 320
99 iso_pu_bacteria 2879127579 2879130860 320
100 iso_pu_bacteria 2879142872 2879147550 320
101 iso_pu_bacteria 2881665667 2881671818 320
102 iso_pu_bacteria 2885374607 2885376270 320
103 iso_pu_bacteria 2885383462 2885388003 320
104 iso_pu_bacteria 2885409591 2885411795 320
105 iso_pu_bacteria 2888378607 2888382519 320
106 iso_pu_bacteria 2888388044 2888388179 320
107 iso_pu_bacteria 2888419890 2888423096 320
108 iso_pu_bacteria 2903727486 2903735462 320
109 iso_pu_bacteria 2903748898 2903755952 320
110 iso_pu_bacteria 2903768456 2903775947 320
111 iso_pu_bacteria 2904666416 2904670081 320
112 iso_pu_bacteria 2904690495 2904691557 320
113 iso_pu_bacteria 2904699407 2904705055 320
114 iso_pu_bacteria 2904711408 2904718415 320
115 iso_pu_bacteria 2906602504 2906607536 320
116 iso_pu_bacteria 2906626472 2906634935 320
117 iso_pu_bacteria 2906635258 2906641233 320
118 iso_pu_bacteria 2906643746 2906648971 320
119 iso_pu_bacteria 2906660503 2906665163 320
120 iso_pu_bacteria 2908739725 2908744194 320
121 iso_pu_bacteria 2908756301 2908761632 320
122 iso_pu_bacteria 2908775508 2908778760 320
123 iso_pu_bacteria 2919073203 2919079192 320
124 iso_pu_bacteria 2922361189 2922362133 320
125 iso_pu_bacteria 2922368715 2922375439 320
126 iso_pu_bacteria 2922386360 2922388103 320
127 iso_pu_bacteria 2922393267 2922395036 320
128 iso_pu_bacteria 2929615660 2929616176 320
129 iso_pu_bacteria 2929624759 2929624920 320
130 iso_pu_bacteria 2932784394 2932787159 320
131 iso_pu_bacteria 2932809354 2932811352 320
132 iso_pu_bacteria 2932818245 2932819775 320
133 iso_pu_bacteria 2932828146 2932835776 320
134 iso_pu_bacteria 2933577622 2933578540 320
135 iso_pu_bacteria 2935608549 2935611124 320
136 iso_pu_bacteria 2935616580 2935618961 320
137 iso_pu_bacteria 2935630451 2935634624 320
138 iso_pu_bacteria 2935638405 2935643222 320
139 iso_pu_bacteria 2935665750 2935669848 320
140 iso_pu_bacteria 2935675223 2935677011 320
141 iso_pu_bacteria 2935684952 2935693052 320
142 iso_pu_bacteria 2935703347 2935709433 320
143 iso_pu_bacteria 2935713505 2935719660 320
144 iso_pu_bacteria 2935722832 2935729573 320
145 iso_pu_bacteria 2935732158 2935739543 320
146 iso_pu_bacteria 2935741537 2935748581 320
147 iso_pu_bacteria 2935750917 2935756832 320
148 iso_pu_bacteria 2935760218 2935761180 320
149 iso_pu_bacteria 2935777560 2935779214 320
150 iso_pu_bacteria 2935801545 2935807365 320
151 iso_pu_bacteria 2935810662 2935812505 320
152 iso_pu_bacteria 2935819856 2935820609 320
153 iso_pu_bacteria 2935827899 2935832634 320
154 iso_pu_bacteria 2935837841 2935839287 320
155 iso_pu_bacteria 2935847175 2935849382 320
156 iso_pu_bacteria 2935855204 2935857326 320
157 iso_pu_bacteria 2935864058 2935864855 320
158 iso_pu_bacteria 2935873716 2935876633 320
159 iso_pu_bacteria 2935883170 2935885022 320
160 iso_pu_bacteria 2935908558 2935911843 320
161 iso_pu_bacteria 2935916978 2935920523 320
162 iso_pu_bacteria 2935926038 2935928872 320
163 iso_pu_bacteria 2935934488 2935938517 320
164 iso_pu_bacteria 2935942939 2935945591 320
165 iso_pu_bacteria 2935951376 2935954802 320
166 iso_pu_bacteria 2935959822 2935963401 320
167 iso_pu_bacteria 2935967501 2935970689 320
168 iso_pu_bacteria 2935992306 2935999015 320
169 iso_pu_bacteria 2936002035 2936008227 320
170 iso_pu_bacteria 2936037263 2936039098 320
171 iso_pu_bacteria 2940556831 2940562746 320
172 iso_pu_bacteria 2941507105 2941509110 320
173 iso_pu_bacteria 2941515067 2941516939 320
174 iso_pu_bacteria 2941523033 2941524966 320
175 iso_pu_bacteria 2941531003 2941536421 320
176 iso_pu_bacteria 2941538514 2941539977 320
177 iso_pu_bacteria 3005474847 3005478784 320
178 iso_pu_bacteria 3005483717 3005487983 320
179 iso_pu_bacteria 3005506211 3005508685 320
180 iso_pu_bacteria 3005594810 3005597537 320
181 iso_pu_bacteria 3005710791 3005713559 320
182 iso_pu_bacteria 3005718088 3005720961 320
183 iso_pu_bacteria 8006926726 8006926924 320
184 iso_pu_bacteria 8006933436 8006942561 320
185 iso_pu_bacteria 8006964411 8006964708 320
186 iso_pu_bacteria 8006973647 8006982285 320
187 iso_pu_bacteria 8006984368 8006991940 320
188 iso_pu_bacteria 8006994254 8006999872 320
189 iso_pu_bacteria 8016511872 8016515047 320
190 iso_pu_bacteria 8016583857 8016590901 320
191 iso_pu_bacteria 8016603502 8016612182 320
192 iso_pu_bacteria 8016613128 8016621620 320
193 iso_pu_bacteria 8016622563 8016628340 320
194 iso_pu_bacteria 8017057580 8017061406 320
195 iso_pu_bacteria 8019538911 8019543435 320
196 iso_pu_bacteria 8019547302 8019555419 320
197 iso_pu_bacteria 8019576017 8019580881 320
198 iso_pu_bacteria 8019586578 8019588615 320
199 iso_pu_bacteria 8019597564 8019602720 320
200 iso_pu_bacteria 8019608314 8019615839 320
201 iso_pu_bacteria 8019648815 8019656523 320
202 iso_pu_bacteria 8019678201 8019682808 320
203 iso_pu_bacteria 8019687851 8019688496 320
204 iso_pu_bacteria 8055742211 8055747823 320
205 iso_pu_bacteria 8056673599 8056680290 320
206 iso_pu_bacteria 8056681323 8056688392 320
207 iso_pu_bacteria 8056689827 8056695938 320
208 iso_pu_bacteria 8056967851 8056970029 320
209 iso_pu_bacteria 2513237098 2513676379 321
210 3300021441 Ga0213871_10009496 Ga0213871_100094962 322
211 3300031616 Ga0307508_10000532 Ga0307508_1000053218 322
212 3300039438 Ga0436360_1060898 Ga0436360_1060898_129_1100 322
213 3300039447 Ga0436361_0152747 Ga0436361_0152747_561_1532 322
214 3300047320 Ga0495672_0021750 Ga0495672_0021750_1039_2016 322
215 3300005355 Ga0070671_100152055 Ga0070671_1001520552 323
216 3300005617 Ga0068859_100293006 Ga0068859_1002930062 323
217 3300005983 Ga0081540_1025933 Ga0081540_10259332 323
218 3300006931 Ga0097620_100293006 Ga0097620_1002930062 323
219 3300013105 Ga0157369_10395679 Ga0157369_103956792 323
220 3300013308 Ga0157375_10388808 Ga0157375_103888082 323
221 3300025914 Ga0207671_10156511 Ga0207671_101565112 323
222 3300026035 Ga0207703_10562422 Ga0207703_105624222 323
223 3300026121 Ga0207683_10154195 Ga0207683_101541952 323
224 3300028379 Ga0268266_10014072 Ga0268266_100140725 323
225 3300037466 Ga0395898_0188863 Ga0395898_0188863_305_1276 323
226 3300038443 Ga0395901_0152438 Ga0395901_0152438_940_1911 323
227 3300046462 Ga0495651_0311975 Ga0495651_0311975_29_1003 323
228 3300046557 Ga0495622_0068564 Ga0495622_0068564_22_996 323
229 3300048920 Ga0496117_0083558 Ga0496117_0083558_282_1280 323
230 3300048921 Ga0496118_0021551 Ga0496118_0021551_3524_4522 323
231 3300048924 Ga0496121_0001443 Ga0496121_0001443_24013_25011 323
232 3300048927 Ga0496124_0002203 Ga0496124_0002203_463_1461 323
233 3300048927 Ga0496124_0249313 Ga0496124_0249313_149_1123 323
234 3300048928 Ga0496125_0000092 Ga0496125_0000092_138738_139712 323
235 3300048929 Ga0496126_0006684 Ga0496126_0006684_3354_4352 323
236 3300053094 Ga0500566_0004708 Ga0500566_0004708_596_1570 323
237 3300053096 Ga0500641_0009503 Ga0500641_0009503_1305_2276 323
238 3300053121 Ga0500607_036478 Ga0500607_036478_850_1824 323
239 3300053122 Ga0500608_001404 Ga0500608_001404_2080_3054 323
240 3300053125 Ga0500618_012076 Ga0500618_012076_921_1895 323
241 3300053142 Ga0500577_0001147 Ga0500577_0001147_2371_3345 323
242 3300053145 Ga0500586_001242 Ga0500586_001242_80_1054 323
243 3300053177 Ga0500636_0006371 Ga0500636_0006371_5213_6187 323
244 3300003215 JGI25153J46596_10006992 JGI25153J46596_100069926 324
245 3300003215 JGI25153J46596_10013502 JGI25153J46596_100135023 324
246 3300003215 JGI25153J46596_10028198 JGI25153J46596_100281982 324
247 3300003354 JGI25160J50197_1003053 JGI25160J50197_10030532 324
248 3300003354 JGI25160J50197_1006569 JGI25160J50197_10065693 324
249 3300003354 JGI25160J50197_1008476 JGI25160J50197_10084763 324
250 3300003794 Ga0055531_10002184 Ga0055531_100021844 324
251 3300004625 Ga0055543_1002709 Ga0055543_10027092 324
252 3300004625 Ga0055543_1019394 Ga0055543_10193941 324
253 3300005262 Ga0065165_1002008 Ga0065165_10020085 324
254 3300005262 Ga0065165_1003321 Ga0065165_10033214 324
255 3300005262 Ga0065165_1019182 Ga0065165_10191823 324
256 3300005329 Ga0070683_100104782 Ga0070683_1001047823 324
257 3300005341 Ga0070691_10136730 Ga0070691_101367301 324
258 3300005355 Ga0070671_100040085 Ga0070671_1000400852 324
259 3300005355 Ga0070671_100397954 Ga0070671_1003979541 324
260 3300005356 Ga0070674_100026876 Ga0070674_1000268763 324
261 3300005366 Ga0070659_100118374 Ga0070659_1001183742 324
262 3300005366 Ga0070659_100136260 Ga0070659_1001362602 324
263 3300005366 Ga0070659_100176911 Ga0070659_1001769111 324
264 3300005435 Ga0070714_100072130 Ga0070714_1000721302 324
265 3300005436 Ga0070713_100027904 Ga0070713_1000279043 324
266 3300005439 Ga0070711_100061847 Ga0070711_1000618472 324
267 3300005439 Ga0070711_100170657 Ga0070711_1001706572 324
268 3300005455 Ga0070663_100059606 Ga0070663_1000596063 324
269 3300005455 Ga0070663_100117828 Ga0070663_1001178282 324
270 3300005456 Ga0070678_100063017 Ga0070678_1000630173 324
271 3300005458 Ga0070681_10207592 Ga0070681_102075922 324
272 3300005459 Ga0068867_100335067 Ga0068867_1003350671 324
273 3300005518 Ga0070699_100289351 Ga0070699_1002893512 324
274 3300005535 Ga0070684_100210520 Ga0070684_1002105202 324
275 3300005539 Ga0068853_100032760 Ga0068853_1000327605 324
276 3300005539 Ga0068853_100080791 Ga0068853_1000807913 324
277 3300005539 Ga0068853_100432525 Ga0068853_1004325251 324
278 3300005543 Ga0070672_100303163 Ga0070672_1003031632 324
279 3300005548 Ga0070665_100091247 Ga0070665_1000912472 324
280 3300005548 Ga0070665_100164440 Ga0070665_1001644403 324
281 3300005548 Ga0070665_100176989 Ga0070665_1001769892 324
282 3300005548 Ga0070665_100262055 Ga0070665_1002620552 324
283 3300005563 Ga0068855_100029681 Ga0068855_1000296815 324
284 3300005563 Ga0068855_100272316 Ga0068855_1002723161 324
285 3300005577 Ga0068857_100034794 Ga0068857_1000347946 324
286 3300005578 Ga0068854_100033432 Ga0068854_1000334322 324
287 3300005578 Ga0068854_100311938 Ga0068854_1003119382 324
288 3300005614 Ga0068856_100059957 Ga0068856_1000599572 324
289 3300005614 Ga0068856_100151937 Ga0068856_1001519371 324
290 3300005614 Ga0068856_100172852 Ga0068856_1001728522 324
291 3300005614 Ga0068856_100316529 Ga0068856_1003165292 324
292 3300005614 Ga0068856_100426575 Ga0068856_1004265752 324
293 3300005616 Ga0068852_100127562 Ga0068852_1001275622 324
294 3300005616 Ga0068852_100140619 Ga0068852_1001406193 324
295 3300005616 Ga0068852_100210129 Ga0068852_1002101292 324
296 3300005616 Ga0068852_100462671 Ga0068852_1004626712 324
297 3300005618 Ga0068864_100041362 Ga0068864_1000413622 324
298 3300005719 Ga0068861_100028438 Ga0068861_1000284384 324
299 3300005719 Ga0068861_100058215 Ga0068861_1000582153 324
300 3300005834 Ga0068851_10086843 Ga0068851_100868432 324
301 3300005834 Ga0068851_10090151 Ga0068851_100901512 324
302 3300005841 Ga0068863_100455261 Ga0068863_1004552612 324
303 3300005841 Ga0068863_100468613 Ga0068863_1004686131 324
304 3300005842 Ga0068858_100015486 Ga0068858_1000154864 324
305 3300005843 Ga0068860_100063240 Ga0068860_1000632404 324
306 3300005843 Ga0068860_100405025 Ga0068860_1004050252 324
307 3300005844 Ga0068862_100080802 Ga0068862_1000808023 324
308 3300005844 Ga0068862_100147298 Ga0068862_1001472983 324
309 3300005844 Ga0068862_100169042 Ga0068862_1001690422 324
310 3300005937 Ga0081455_10007549 Ga0081455_100075496 324
311 3300005983 Ga0081540_1001498 Ga0081540_100149815 324
312 3300005983 Ga0081540_1007278 Ga0081540_10072787 324
313 3300005983 Ga0081540_1010330 Ga0081540_10103305 324
314 3300005983 Ga0081540_1011806 Ga0081540_10118067 324
315 3300005983 Ga0081540_1061880 Ga0081540_10618802 324
316 3300005983 Ga0081540_1095883 Ga0081540_10958832 324
317 3300005985 Ga0081539_10000726 Ga0081539_1000072635 324
318 3300005985 Ga0081539_10039521 Ga0081539_100395211 324
319 3300005985 Ga0081539_10088789 Ga0081539_100887892 324
320 3300006038 Ga0075365_10053901 Ga0075365_100539012 324
321 3300006038 Ga0075365_10116928 Ga0075365_101169282 324
322 3300006038 Ga0075365_10176280 Ga0075365_101762802 324
323 3300006042 Ga0075368_10041526 Ga0075368_100415262 324
324 3300006048 Ga0075363_100094919 Ga0075363_1000949192 324
325 3300006051 Ga0075364_10024769 Ga0075364_100247694 324
326 3300006175 Ga0070712_100048762 Ga0070712_1000487622 324
327 3300006178 Ga0075367_10002487 Ga0075367_100024876 324
328 3300006178 Ga0075367_10034297 Ga0075367_100342972 324
329 3300006178 Ga0075367_10112461 Ga0075367_101124612 324
330 3300006237 Ga0097621_100029785 Ga0097621_1000297853 324
331 3300006237 Ga0097621_100111716 Ga0097621_1001117163 324
332 3300006358 Ga0068871_100101694 Ga0068871_1001016941 324
333 3300006844 Ga0075428_100227353 Ga0075428_1002273532 324
334 3300006871 Ga0075434_100113763 Ga0075434_1001137632 324
335 3300006881 Ga0068865_100167336 Ga0068865_1001673361 324
336 3300006881 Ga0068865_100221467 Ga0068865_1002214672 324
337 3300006942 Ga0099824_1013588 Ga0099824_10135887 324
338 3300006942 Ga0099824_1032175 Ga0099824_10321752 324
339 3300006944 Ga0099823_1048446 Ga0099823_10484463 324
340 3300007076 Ga0075435_100115090 Ga0075435_1001150902 324
341 3300009093 Ga0105240_10010641 Ga0105240_100106415 324
342 3300009093 Ga0105240_10345344 Ga0105240_103453442 324
343 3300009093 Ga0105240_10501239 Ga0105240_105012392 324
344 3300009094 Ga0111539_10121045 Ga0111539_101210452 324
345 3300009098 Ga0105245_10068511 Ga0105245_100685111 324
346 3300009098 Ga0105245_10118252 Ga0105245_101182523 324
347 3300009147 Ga0114129_10101918 Ga0114129_101019183 324
348 3300009148 Ga0105243_10025134 Ga0105243_100251343 324
349 3300009148 Ga0105243_10209828 Ga0105243_102098282 324
350 3300009148 Ga0105243_10395159 Ga0105243_103951591 324
351 3300009174 Ga0105241_10059471 Ga0105241_100594712 324
352 3300009174 Ga0105241_10201831 Ga0105241_102018312 324
353 3300009174 Ga0105241_10313071 Ga0105241_103130712 324
354 3300009174 Ga0105241_10318435 Ga0105241_103184352 324
355 3300009177 Ga0105248_10065648 Ga0105248_100656482 324
356 3300009177 Ga0105248_10186777 Ga0105248_101867773 324
357 3300009177 Ga0105248_10265965 Ga0105248_102659652 324
358 3300009177 Ga0105248_10351505 Ga0105248_103515051 324
359 3300009545 Ga0105237_10004145 Ga0105237_100041456 324
360 3300009545 Ga0105237_10024695 Ga0105237_100246955 324
361 3300009545 Ga0105237_10070302 Ga0105237_100703023 324
362 3300009545 Ga0105237_10152706 Ga0105237_101527062 324
363 3300009545 Ga0105237_10263430 Ga0105237_102634302 324
364 3300009551 Ga0105238_10080027 Ga0105238_100800272 324
365 3300010159 Ga0099796_10012659 Ga0099796_100126591 324
366 3300010375 Ga0105239_10046661 Ga0105239_100466616 324
367 3300010375 Ga0105239_10060893 Ga0105239_100608934 324
368 3300010375 Ga0105239_10062712 Ga0105239_100627124 324
369 3300010375 Ga0105239_10083618 Ga0105239_100836181 324
370 3300010375 Ga0105239_10151918 Ga0105239_101519182 324
371 3300010375 Ga0105239_10347772 Ga0105239_103477722 324
372 3300011119 Ga0105246_10010071 Ga0105246_100100712 324
373 3300013104 Ga0157370_10079560 Ga0157370_100795604 324
374 3300013296 Ga0157374_10011421 Ga0157374_100114213 324
375 3300013296 Ga0157374_10079256 Ga0157374_100792562 324
376 3300013297 Ga0157378_10183677 Ga0157378_101836772 324
377 3300013306 Ga0163162_10094550 Ga0163162_100945501 324
378 3300013306 Ga0163162_10280498 Ga0163162_102804982 324
379 3300013308 Ga0157375_10148274 Ga0157375_101482743 324
380 3300014325 Ga0163163_10059377 Ga0163163_100593772 324
381 3300014325 Ga0163163_10420762 Ga0163163_104207622 324
382 3300014968 Ga0157379_10016120 Ga0157379_100161202 324
383 3300014968 Ga0157379_10043659 Ga0157379_100436592 324
384 3300014969 Ga0157376_10347825 Ga0157376_103478252 324
385 3300021320 Ga0214544_1000006 Ga0214544_1000006360 324
386 3300021321 Ga0214542_1000002 Ga0214542_100000214 324
387 3300021324 Ga0214545_1000002 Ga0214545_1000002705 324
388 3300021327 Ga0214543_1000017 Ga0214543_1000017308 324
389 3300025230 Ga0209563_101461 Ga0209563_1014612 324
390 3300025253 Ga0209677_108682 Ga0209677_1086822 324
391 3300025254 Ga0209148_1000447 Ga0209148_100044724 324
392 3300025295 Ga0209564_1003910 Ga0209564_10039109 324
393 3300025297 Ga0209758_1000065 Ga0209758_100006575 324
394 3300025297 Ga0209758_1002429 Ga0209758_10024299 324
395 3300025297 Ga0209758_1003622 Ga0209758_10036224 324
396 3300025297 Ga0209758_1025282 Ga0209758_10252823 324
397 3300025297 Ga0209758_1025863 Ga0209758_10258632 324
398 3300025299 Ga0209256_1011253 Ga0209256_10112534 324
399 3300025299 Ga0209256_1021691 Ga0209256_10216912 324
400 3300025302 Ga0207426_1000554 Ga0207426_100055411 324
401 3300025302 Ga0207426_1000561 Ga0207426_100056128 324
402 3300025302 Ga0207426_1002946 Ga0207426_10029464 324
403 3300025304 Ga0209257_1000833 Ga0209257_10008337 324
404 3300025304 Ga0209257_1031441 Ga0209257_10314412 324
405 3300025321 Ga0207656_10066356 Ga0207656_100663562 324
406 3300025901 Ga0207688_10006431 Ga0207688_100064314 324
407 3300025901 Ga0207688_10019196 Ga0207688_100191964 324
408 3300025904 Ga0207647_10089740 Ga0207647_100897402 324
409 3300025909 Ga0207705_10304071 Ga0207705_103040712 324
410 3300025911 Ga0207654_10000803 Ga0207654_1000080316 324
411 3300025911 Ga0207654_10002540 Ga0207654_100025406 324
412 3300025912 Ga0207707_10165102 Ga0207707_101651022 324
413 3300025913 Ga0207695_10000029 Ga0207695_1000002937 324
414 3300025913 Ga0207695_10001543 Ga0207695_1000154310 324
415 3300025914 Ga0207671_10018788 Ga0207671_100187884 324
416 3300025915 Ga0207693_10255227 Ga0207693_102552272 324
417 3300025916 Ga0207663_10129358 Ga0207663_101293582 324
418 3300025919 Ga0207657_10009798 Ga0207657_100097981 324
419 3300025924 Ga0207694_10232227 Ga0207694_102322271 324
420 3300025925 Ga0207650_10061111 Ga0207650_100611113 324
421 3300025926 Ga0207659_10206460 Ga0207659_102064601 324
422 3300025927 Ga0207687_10013194 Ga0207687_100131944 324
423 3300025927 Ga0207687_10168295 Ga0207687_101682951 324
424 3300025928 Ga0207700_10042530 Ga0207700_100425304 324
425 3300025928 Ga0207700_10154985 Ga0207700_101549852 324
426 3300025929 Ga0207664_10301067 Ga0207664_103010672 324
427 3300025932 Ga0207690_10107884 Ga0207690_101078843 324
428 3300025933 Ga0207706_10099577 Ga0207706_100995773 324
429 3300025933 Ga0207706_10136104 Ga0207706_101361042 324
430 3300025933 Ga0207706_10345983 Ga0207706_103459832 324
431 3300025935 Ga0207709_10012963 Ga0207709_100129633 324
432 3300025937 Ga0207669_10040409 Ga0207669_100404093 324
433 3300025937 Ga0207669_10062176 Ga0207669_100621763 324
434 3300025938 Ga0207704_10095030 Ga0207704_100950302 324
435 3300025940 Ga0207691_10081307 Ga0207691_100813073 324
436 3300025940 Ga0207691_10139582 Ga0207691_101395823 324
437 3300025942 Ga0207689_10010305 Ga0207689_100103053 324
438 3300025942 Ga0207689_10062250 Ga0207689_100622502 324
439 3300025949 Ga0207667_10007604 Ga0207667_1000760415 324
440 3300025949 Ga0207667_10018352 Ga0207667_100183522 324
441 3300025949 Ga0207667_10296277 Ga0207667_102962772 324
442 3300025961 Ga0207712_10026160 Ga0207712_100261604 324
443 3300025972 Ga0207668_10062476 Ga0207668_100624763 324
444 3300025986 Ga0207658_10242860 Ga0207658_102428601 324
445 3300026035 Ga0207703_10282370 Ga0207703_102823702 324
446 3300026041 Ga0207639_10028861 Ga0207639_100288613 324
447 3300026067 Ga0207678_10025273 Ga0207678_100252736 324
448 3300026067 Ga0207678_10052363 Ga0207678_100523633 324
449 3300026067 Ga0207678_10061520 Ga0207678_100615202 324
450 3300026067 Ga0207678_10069743 Ga0207678_100697431 324
451 3300026067 Ga0207678_10074580 Ga0207678_100745803 324
452 3300026067 Ga0207678_10087953 Ga0207678_100879531 324
453 3300026067 Ga0207678_10096275 Ga0207678_100962752 324
454 3300026067 Ga0207678_10151195 Ga0207678_101511951 324
455 3300026078 Ga0207702_10000005 Ga0207702_10000005294 324
456 3300026078 Ga0207702_10000081 Ga0207702_10000081112 324
457 3300026078 Ga0207702_10255519 Ga0207702_102555192 324
458 3300026078 Ga0207702_10601286 Ga0207702_106012861 324
459 3300026088 Ga0207641_10442313 Ga0207641_104423131 324
460 3300026089 Ga0207648_10135637 Ga0207648_101356371 324
461 3300026095 Ga0207676_10405879 Ga0207676_104058792 324
462 3300026116 Ga0207674_10043098 Ga0207674_100430986 324
463 3300026118 Ga0207675_100011579 Ga0207675_1000115793 324
464 3300026118 Ga0207675_100033023 Ga0207675_1000330235 324
465 3300026121 Ga0207683_10072768 Ga0207683_100727683 324
466 3300026121 Ga0207683_10106285 Ga0207683_101062853 324
467 3300026121 Ga0207683_10116567 Ga0207683_101165672 324
468 3300026121 Ga0207683_10327657 Ga0207683_103276571 324
469 3300026142 Ga0207698_10062290 Ga0207698_100622903 324
470 3300026142 Ga0207698_10077585 Ga0207698_100775853 324
471 3300026142 Ga0207698_10286857 Ga0207698_102868572 324
472 3300027296 Ga0209389_1000011 Ga0209389_10000111 324
473 3300027296 Ga0209389_1000025 Ga0209389_100002556 324
474 3300027357 Ga0209589_1000009 Ga0209589_1000009248 324
475 3300027357 Ga0209589_1000066 Ga0209589_10000665 324
476 3300027361 Ga0209489_100010 Ga0209489_10001022 324
477 3300027361 Ga0209489_100017 Ga0209489_100017233 324
478 3300027361 Ga0209489_100030 Ga0209489_100030107 324
479 3300027363 Ga0209700_100017 Ga0209700_10001722 324
480 3300027363 Ga0209700_100027 Ga0209700_1000271 324
481 3300028379 Ga0268266_10001147 Ga0268266_1000114737 324
482 3300028379 Ga0268266_10008591 Ga0268266_100085912 324
483 3300028379 Ga0268266_10033130 Ga0268266_100331303 324
484 3300028379 Ga0268266_10066804 Ga0268266_100668043 324
485 3300028379 Ga0268266_10426890 Ga0268266_104268901 324
486 3300028380 Ga0268265_10044846 Ga0268265_100448463 324
487 3300028380 Ga0268265_10082002 Ga0268265_100820022 324
488 3300028380 Ga0268265_10156508 Ga0268265_101565083 324
489 3300028558 Ga0265326_10002319 Ga0265326_100023195 324
490 3300028563 Ga0265319_1001659 Ga0265319_10016597 324
491 3300028573 Ga0265334_10000799 Ga0265334_100007996 324
492 3300028577 Ga0265318_10010755 Ga0265318_100107553 324
493 3300028653 Ga0265323_10003079 Ga0265323_100030795 324
494 3300028654 Ga0265322_10002933 Ga0265322_100029335 324
495 3300028666 Ga0265336_10000233 Ga0265336_100002336 324
496 3300028786 Ga0307517_10000062 Ga0307517_1000006234 324
497 3300028794 Ga0307515_10063942 Ga0307515_100639425 324
498 3300028800 Ga0265338_10000090 Ga0265338_1000009023 324
499 3300029957 Ga0265324_10006268 Ga0265324_100062683 324
500 3300031235 Ga0265330_10036948 Ga0265330_100369482 324
501 3300031247 Ga0265340_10001013 Ga0265340_100010137 324
502 3300031250 Ga0265331_10100264 Ga0265331_101002642 324
503 3300031507 Ga0307509_10287354 Ga0307509_102873542 324
504 3300031616 Ga0307508_10007265 Ga0307508_100072658 324
505 3300031711 Ga0265314_10043780 Ga0265314_100437801 324
506 3300031712 Ga0265342_10154022 Ga0265342_101540222 324
507 3300031712 Ga0265342_10188823 Ga0265342_101888231 324
508 3300031730 Ga0307516_10012607 Ga0307516_100126077 324
509 3300031730 Ga0307516_10192637 Ga0307516_101926372 324
510 3300031730 Ga0307516_10310552 Ga0307516_103105521 324
511 3300031824 Ga0307413_10279574 Ga0307413_102795742 324
512 3300031911 Ga0307412_10075388 Ga0307412_100753882 324
513 3300031995 Ga0307409_100462482 Ga0307409_1004624821 324
514 3300032126 Ga0307415_100061564 Ga0307415_1000615642 324
515 3300032126 Ga0307415_100324726 Ga0307415_1003247262 324
516 3300033180 Ga0307510_10018748 Ga0307510_100187486 324
517 3300033180 Ga0307510_10075582 Ga0307510_100755821 324
518 3300033442 Ga0315911_1000009 Ga0315911_1000009374 324
519 3300035084 Ga0373928_0008426 Ga0373928_0008426_646_1620 324
520 3300035114 Ga0373939_0031774 Ga0373939_0031774_243_1217 324
521 3300035171 Ga0373946_0028104 Ga0373946_0028104_327_1301 324
522 3300035695 Ga0373927_0082643 Ga0373927_0082643_321_1313 324
523 3300035695 Ga0373927_0237369 Ga0373927_0237369_93_1067 324
524 3300035724 Ga0373933_0000167 Ga0373933_0000167_24297_25310 324
525 3300035725 Ga0373947_0108025 Ga0373947_0108025_124_1098 324
526 3300037068 Ga0373925_0087293 Ga0373925_0087293_1105_2079 324
527 3300037312 Ga0395899_0034271 Ga0395899_0034271_2574_3551 324
528 3300037418 Ga0395900_0019057 Ga0395900_0019057_1593_2570 324
529 3300037466 Ga0395898_0222633 Ga0395898_0222633_215_1192 324
530 3300037471 Ga0395905_0233194 Ga0395905_0233194_266_1243 324
531 3300037853 Ga0436364_1156934 Ga0436364_1156934_22_999 324
532 3300038443 Ga0395901_0034427 Ga0395901_0034427_3629_4606 324
533 3300044656 Ga0466969_0013180 Ga0466969_0013180_331_1308 324
534 3300044683 Ga0466965_0056339 Ga0466965_0056339_767_1744 324
535 3300044684 Ga0466966_0000148 Ga0466966_0000148_33432_34409 324
536 3300044693 Ga0466961_0000045 Ga0466961_0000045_64774_65751 324
537 3300044706 Ga0466964_0050790 Ga0466964_0050790_63_1040 324
538 3300044706 Ga0466964_0060246 Ga0466964_0060246_580_1557 324
539 3300044735 Ga0466968_0029823 Ga0466968_0029823_404_1381 324
540 3300044765 Ga0466970_0042331 Ga0466970_0042331_953_1930 324
541 3300044842 Ga0466957_0129504 Ga0466957_0129504_78_1055 324
542 3300044842 Ga0466957_0157108 Ga0466957_0157108_200_1180 324
543 3300044901 Ga0466960_0189599 Ga0466960_0189599_37_1014 324
544 3300045049 Ga0466959_0003014 Ga0466959_0003014_820_1797 324
545 3300045049 Ga0466959_0021412 Ga0466959_0021412_1908_2888 324
546 3300046455 Ga0495603_0018889 Ga0495603_0018889_1365_2339 324
547 3300046455 Ga0495603_0043688 Ga0495603_0043688_939_1913 324
548 3300046457 Ga0495590_0015098 Ga0495590_0015098_370_1344 324
549 3300046459 Ga0495629_0096403 Ga0495629_0096403_376_1350 324
550 3300046460 Ga0495638_0010390 Ga0495638_0010390_939_1916 324
551 3300046460 Ga0495638_0020052 Ga0495638_0020052_2449_3426 324
552 3300046460 Ga0495638_0044353 Ga0495638_0044353_129_1106 324
553 3300046460 Ga0495638_0129249 Ga0495638_0129249_345_1319 324
554 3300046462 Ga0495651_0000472 Ga0495651_0000472_19774_20751 324
555 3300046463 Ga0495653_0039871 Ga0495653_0039871_672_1649 324
556 3300046471 Ga0495650_0040691 Ga0495650_0040691_301_1275 324
557 3300046472 Ga0495580_0115154 Ga0495580_0115154_523_1497 324
558 3300046473 Ga0495582_0120896 Ga0495582_0120896_469_1443 324
559 3300046477 Ga0495664_0017778 Ga0495664_0017778_1930_2907 324
560 3300046492 Ga0495585_0065988 Ga0495585_0065988_394_1368 324
561 3300046499 Ga0495594_0062068 Ga0495594_0062068_1071_2045 324
562 3300046501 Ga0495607_0067717 Ga0495607_0067717_430_1407 324
563 3300046507 Ga0495606_0004247 Ga0495606_0004247_8200_9177 324
564 3300046507 Ga0495606_0005996 Ga0495606_0005996_6334_7311 324
565 3300046507 Ga0495606_0202546 Ga0495606_0202546_131_1108 324
566 3300046511 Ga0495608_0018937 Ga0495608_0018937_1542_2519 324
567 3300046512 Ga0495610_0039561 Ga0495610_0039561_553_1527 324
568 3300046513 Ga0495616_0100607 Ga0495616_0100607_225_1202 324
569 3300046516 Ga0495628_0016126 Ga0495628_0016126_4609_5586 324
570 3300046517 Ga0495630_0136574 Ga0495630_0136574_105_1082 324
571 3300046518 Ga0495631_0043205 Ga0495631_0043205_702_1676 324
572 3300046522 Ga0495643_0029296 Ga0495643_0029296_435_1412 324
573 3300046522 Ga0495643_0047211 Ga0495643_0047211_490_1464 324
574 3300046523 Ga0495644_0021386 Ga0495644_0021386_208_1182 324
575 3300046524 Ga0495648_0003979 Ga0495648_0003979_5676_6653 324
576 3300046524 Ga0495648_0092725 Ga0495648_0092725_228_1205 324
577 3300046525 Ga0495663_0057358 Ga0495663_0057358_127_1101 324
578 3300046529 Ga0495652_0001339 Ga0495652_0001339_20349_21326 324
579 3300046536 Ga0495587_0012944 Ga0495587_0012944_34_1011 324
580 3300046558 Ga0495633_0135270 Ga0495633_0135270_56_1030 324
581 3300046559 Ga0495667_0007621 Ga0495667_0007621_1374_2351 324
582 3300046615 Ga0495656_0001067 Ga0495656_0001067_979_1953 324
583 3300046615 Ga0495656_0025016 Ga0495656_0025016_81_1055 324
584 3300046616 Ga0495668_0024598 Ga0495668_0024598_1892_2869 324
585 3300046642 Ga0495634_0013513 Ga0495634_0013513_2515_3492 324
586 3300046648 Ga0495611_0010250 Ga0495611_0010250_1929_2903 324
587 3300046660 Ga0495625_0043231 Ga0495625_0043231_1861_2838 324
588 3300046660 Ga0495625_0053001 Ga0495625_0053001_67_1041 324
589 3300046674 Ga0495588_0046912 Ga0495588_0046912_418_1392 324
590 3300046675 Ga0495657_0005672 Ga0495657_0005672_4888_5865 324
591 3300046678 Ga0495599_0016375 Ga0495599_0016375_2475_3452 324
592 3300046679 Ga0495623_0004396 Ga0495623_0004396_7894_8871 324
593 3300046684 Ga0495669_0024616 Ga0495669_0024616_369_1343 324
594 3300046684 Ga0495669_0145660 Ga0495669_0145660_32_1006 324
595 3300046689 Ga0495613_0027045 Ga0495613_0027045_1473_2450 324
596 3300046691 Ga0495670_0016306 Ga0495670_0016306_49_1026 324
597 3300046692 Ga0495671_0119520 Ga0495671_0119520_271_1248 324
598 3300046694 Ga0495649_0050747 Ga0495649_0050747_314_1291 324
599 3300046809 Ga0495600_0006605 Ga0495600_0006605_1386_2363 324
600 3300047315 Ga0495581_0108464 Ga0495581_0108464_542_1516 324
601 3300047317 Ga0495604_0000953 Ga0495604_0000953_16327_17304 324
602 3300047319 Ga0495674_0008322 Ga0495674_0008322_2379_3356 324
603 3300047320 Ga0495672_0015872 Ga0495672_0015872_1758_2732 324
604 3300047321 Ga0495676_0014964 Ga0495676_0014964_5851_6825 324
605 3300047322 Ga0495680_0001642 Ga0495680_0001642_16959_17936 324
606 3300047443 Ga0495687_042517 Ga0495687_042517_634_1611 324
607 3300047472 Ga0495686_0128589 Ga0495686_0128589_451_1428 324
608 3300047472 Ga0495686_0179108 Ga0495686_0179108_230_1207 324
609 3300047673 Ga0495593_0041694 Ga0495593_0041694_336_1313 324
610 3300048088 Ga0495602_0019800 Ga0495602_0019800_4591_5568 324
611 3300048090 Ga0495615_0039805 Ga0495615_0039805_51_1025 324
612 3300048090 Ga0495615_0042269 Ga0495615_0042269_114_1088 324
613 3300048090 Ga0495615_0049047 Ga0495615_0049047_12_986 324
614 3300048903 Ga0496100_0136209 Ga0496100_0136209_325_1299 324
615 3300048903 Ga0496100_0150824 Ga0496100_0150824_102_1079 324
616 3300048904 Ga0496101_0179936 Ga0496101_0179936_317_1294 324
617 3300048904 Ga0496101_0289218 Ga0496101_0289218_69_1043 324
618 3300048905 Ga0496102_0009044 Ga0496102_0009044_6514_7488 324
619 3300048905 Ga0496102_0057494 Ga0496102_0057494_1099_2073 324
620 3300048905 Ga0496102_0244571 Ga0496102_0244571_131_1108 324
621 3300048905 Ga0496102_0285540 Ga0496102_0285540_348_1325 324
622 3300048905 Ga0496102_0316404 Ga0496102_0316404_82_1056 324
623 3300048906 Ga0496103_0015643 Ga0496103_0015643_701_1675 324
624 3300048906 Ga0496103_0106108 Ga0496103_0106108_154_1128 324
625 3300048907 Ga0496104_0004724 Ga0496104_0004724_6883_7863 324
626 3300048907 Ga0496104_0078088 Ga0496104_0078088_1868_2842 324
627 3300048907 Ga0496104_0194318 Ga0496104_0194318_316_1290 324
628 3300048907 Ga0496104_0322309 Ga0496104_0322309_183_1157 324
629 3300048908 Ga0496105_0011117 Ga0496105_0011117_5807_6781 324
630 3300048909 Ga0496106_0027320 Ga0496106_0027320_415_1392 324
631 3300048909 Ga0496106_0046484 Ga0496106_0046484_2191_3168 324
632 3300048909 Ga0496106_0063950 Ga0496106_0063950_785_1759 324
633 3300048909 Ga0496106_0129070 Ga0496106_0129070_225_1199 324
634 3300048909 Ga0496106_0216270 Ga0496106_0216270_456_1430 324
635 3300048909 Ga0496106_0318787 Ga0496106_0318787_84_1058 324
636 3300048910 Ga0496107_0065379 Ga0496107_0065379_383_1357 324
637 3300048911 Ga0496108_0015476 Ga0496108_0015476_2054_3028 324
638 3300048911 Ga0496108_0138255 Ga0496108_0138255_353_1330 324
639 3300048912 Ga0496109_0020502 Ga0496109_0020502_93_1067 324
640 3300048912 Ga0496109_0112483 Ga0496109_0112483_792_1766 324
641 3300048913 Ga0496110_0074209 Ga0496110_0074209_1632_2606 324
642 3300048914 Ga0496111_0091246 Ga0496111_0091246_871_1845 324
643 3300048914 Ga0496111_0296162 Ga0496111_0296162_42_1016 324
644 3300048915 Ga0496112_0004323 Ga0496112_0004323_3712_4689 324
645 3300048915 Ga0496112_0127333 Ga0496112_0127333_800_1774 324
646 3300048915 Ga0496112_0214242 Ga0496112_0214242_639_1616 324
647 3300048916 Ga0496113_0028782 Ga0496113_0028782_2256_3230 324
648 3300048916 Ga0496113_0063686 Ga0496113_0063686_1501_2478 324
649 3300048917 Ga0496114_0031614 Ga0496114_0031614_3291_4265 324
650 3300048917 Ga0496114_0187808 Ga0496114_0187808_74_1051 324
651 3300048917 Ga0496114_0221690 Ga0496114_0221690_640_1614 324
652 3300048918 Ga0496115_0011656 Ga0496115_0011656_39_1013 324
653 3300048918 Ga0496115_0057194 Ga0496115_0057194_1407_2381 324
654 3300048918 Ga0496115_0063037 Ga0496115_0063037_1920_2894 324
655 3300048918 Ga0496115_0067141 Ga0496115_0067141_539_1513 324
656 3300048918 Ga0496115_0129053 Ga0496115_0129053_936_1910 324
657 3300048920 Ga0496117_0077577 Ga0496117_0077577_526_1503 324
658 3300048921 Ga0496118_0046349 Ga0496118_0046349_1875_2852 324
659 3300048923 Ga0496120_0166747 Ga0496120_0166747_51_1028 324
660 3300048924 Ga0496121_0001527 Ga0496121_0001527_20251_21228 324
661 3300048924 Ga0496121_0006578 Ga0496121_0006578_7836_8813 324
662 3300048924 Ga0496121_0032132 Ga0496121_0032132_1836_2813 324
663 3300048924 Ga0496121_0056496 Ga0496121_0056496_1480_2454 324
664 3300048924 Ga0496121_0102601 Ga0496121_0102601_1154_2128 324
665 3300048924 Ga0496121_0106268 Ga0496121_0106268_765_1751 324
666 3300048924 Ga0496121_0106850 Ga0496121_0106850_979_1953 324
667 3300048925 Ga0496122_0026944 Ga0496122_0026944_390_1367 324
668 3300048927 Ga0496124_0244482 Ga0496124_0244482_131_1105 324
669 3300048928 Ga0496125_0009813 Ga0496125_0009813_4831_5808 324
670 3300048928 Ga0496125_0090446 Ga0496125_0090446_983_1960 324
671 3300048928 Ga0496125_0097212 Ga0496125_0097212_1190_2167 324
672 3300048929 Ga0496126_0039188 Ga0496126_0039188_791_1765 324
673 3300048929 Ga0496126_0077337 Ga0496126_0077337_251_1228 324
674 3300048929 Ga0496126_0257206 Ga0496126_0257206_25_1002 324
675 3300049460 Ga0495682_0010078 Ga0495682_0010078_631_1608 324
676 3300049578 Ga0501042_0276773 Ga0501042_0276773_42_1016 324
677 3300049581 Ga0501047_0050488 Ga0501047_0050488_2474_3448 324
678 3300049586 Ga0501070_0185960 Ga0501070_0185960_516_1490 324
679 3300049823 Ga0501044_0233648 Ga0501044_0233648_784_1758 324
680 3300050490 nmdc:mga03n38_124944_c1 nmdc:mga03n38_124944_c1_146_1123 324
681 3300050490 nmdc:mga03n38_83409_c1 nmdc:mga03n38_83409_c1_278_1252 324
682 3300050491 nmdc:mga00v17_202324_c1 nmdc:mga00v17_202324_c1_88_1065 324
683 3300050492 nmdc:mga0yw44_112073_c1 nmdc:mga0yw44_112073_c1_192_1169 324
684 3300050492 nmdc:mga0yw44_25249_c2 nmdc:mga0yw44_25249_c2_386_1360 324
685 3300050494 nmdc:mga06z11_45600_c1 nmdc:mga06z11_45600_c1_202_1194 324
686 3300050495 nmdc:mga04h51_45470_c1 nmdc:mga04h51_45470_c1_422_1399 324
687 3300050507 nmdc:mga05p37_141697_c1 nmdc:mga05p37_141697_c1_1791_2765 324
688 3300050513 nmdc:mga0rr50_174705_c1 nmdc:mga0rr50_174705_c1_627_1601 324
689 3300053077 Ga0495601_0042376 Ga0495601_0042376_1507_2481 324
690 3300053084 Ga0495595_0062252 Ga0495595_0062252_517_1494 324
691 3300053085 Ga0495619_0028489 Ga0495619_0028489_692_1666 324
692 3300053087 Ga0500643_000019 Ga0500643_000019_18116_19093 324
693 3300053093 Ga0500651_0061733 Ga0500651_0061733_324_1301 324
694 3300053093 Ga0500651_0067270 Ga0500651_0067270_177_1154 324
695 3300053094 Ga0500566_0000693 Ga0500566_0000693_3498_4475 324
696 3300053094 Ga0500566_0003060 Ga0500566_0003060_2094_3068 324
697 3300053096 Ga0500641_0021737 Ga0500641_0021737_841_1818 324
698 3300053096 Ga0500641_0063799 Ga0500641_0063799_488_1465 324
699 3300053098 Ga0500650_0002857 Ga0500650_0002857_2379_3356 324
700 3300053104 Ga0500556_0000024 Ga0500556_0000024_68462_69439 324
701 3300053109 Ga0500569_017427 Ga0500569_017427_516_1493 324
702 3300053119 Ga0500595_000478 Ga0500595_000478_11127_12101 324
703 3300053119 Ga0500595_008096 Ga0500595_008096_653_1627 324
704 3300053130 Ga0500642_0000035 Ga0500642_0000035_68388_69365 324
705 3300053130 Ga0500642_0000096 Ga0500642_0000096_13276_14253 324
706 3300053130 Ga0500642_0014156 Ga0500642_0014156_94_1071 324
707 3300053130 Ga0500642_0053040 Ga0500642_0053040_68_1042 324
708 3300053131 Ga0500652_000404 Ga0500652_000404_4355_5332 324
709 3300053134 Ga0500658_0022678 Ga0500658_0022678_187_1161 324
710 3300053134 Ga0500658_0043662 Ga0500658_0043662_138_1115 324
711 3300053139 Ga0500568_0005040 Ga0500568_0005040_4968_5945 324
712 3300053139 Ga0500568_0017048 Ga0500568_0017048_773_1750 324
713 3300053142 Ga0500577_0079393 Ga0500577_0079393_60_1034 324
714 3300053151 Ga0500604_0001709 Ga0500604_0001709_2571_3548 324
715 3300053151 Ga0500604_0045570 Ga0500604_0045570_202_1179 324
716 3300053153 Ga0500616_0000122 Ga0500616_0000122_71285_72262 324
717 3300053156 Ga0500622_0000790 Ga0500622_0000790_22376_23353 324
718 3300053161 Ga0500634_0161980 Ga0500634_0161980_12_989 324
719 3300053162 Ga0500638_024000 Ga0500638_024000_1447_2421 324
720 3300053177 Ga0500636_0000410 Ga0500636_0000410_3643_4620 324
721 3300053177 Ga0500636_0017882 Ga0500636_0017882_852_1829 324
722 3300053178 Ga0500637_0000245 Ga0500637_0000245_7049_8023 324
723 3300053729 Ga0500625_000095 Ga0500625_000095_3044_4021 324
724 3300053731 Ga0500609_003240 Ga0500609_003240_574_1551 324
725 3300053736 Ga0500599_006070 Ga0500599_006070_514_1491 324
726 3300053737 Ga0500601_000120 Ga0500601_000120_5356_6333 324
727 3300055283 Ga0500661_000938 Ga0500661_000938_383_1357 324
728 3300055283 Ga0500661_008979 Ga0500661_008979_45_1022 324
729 3300055283 Ga0500661_011620 Ga0500661_011620_274_1251 324

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

155

280

0.94

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

31

114

0.86

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

187

325

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
4eye-assembly2.cif.gz_B crystal structure of a probable oxidoreductase from mycobacterium abscessus solved by iodide ion sad 0.9253 2 322
4eye-assembly1.cif.gz_A crystal structure of a probable oxidoreductase from mycobacterium abscessus solved by iodide ion sad 0.92 2 322
4eye-assembly2.cif.gz_B crystal structure of a probable oxidoreductase from mycobacterium abscessus solved by iodide ion sad 0.9137 2 322
4eye-assembly1.cif.gz_A crystal structure of a probable oxidoreductase from mycobacterium abscessus solved by iodide ion sad 0.9031 2 322
1iyz-assembly1.cif.gz_A-2 crystal structures of the quinone oxidoreductase from thermus thermophilus hb8 and its complex with nadph 0.9022 3 323
ID Description Score Start End Superfamily
2eihB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9371 124 262 3.40.50.720
af_I1KB52_138_305_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9343 128 290 3.40.50.720
af_A0A286Y901_130_273_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9313 124 260 3.40.50.720
af_O74489_128_266_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.93 128 262 3.40.50.720
af_Q8MNM6_143_282_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9296 130 265 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A850CE27-F1-model_v4 Zinc-binding dehydrogenase 0.9466 76 324 GO:0016491
AF-A0A059DLV1-F1-model_v4 Enoyl reductase (ER) domain-containing protein 0.946 82 319 GO:0016491
AF-A0A812KMX0-F1-model_v4 Enoyl reductase (ER) domain-containing protein 0.9427 2 324 GO:0016020
GO:0016491
AF-A0A355B5N3-F1-model_v4 Enoyl reductase (ER) domain-containing protein 0.9421 112 324 GO:0008270
GO:0016491
AF-A0A4V2NFX9-F1-model_v4 Alcohol dehydrogenase-like C-terminal domain-containing protein 0.942 124 236 GO:0016491

Feature Viewer

pLDDT pTM Quality
87.29 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map