F477885
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 729 | 496 | 547 | 323 |
Family's Representative Sequence
| Representative Sequence | 3300048924|Ga0496121_0106268|Ga0496121_0106268_765_1751 |
| Length | 328 |
| Sequence | MPRAVVCRELGPPESLKLEDVPRAPLAPRQGQGQVRVAIHAAGLNFPDILMAAGEYQLKPPLPFTPGMEAAGEVTEVAGADGVSVGDKVIVKARFGCYADEIVVTPDQLVPLPSAFDYAQGAAFLAAHGTAYHALKDRAQMQPGEVLLVHGAGGGVGLAAVELGKVFGATVIACASSEEKLAVAQQRGADHGVLYGREPFKDAVKRITDGRGVDVVFDPVGGAIFEDSLRCIAWGARLLVIGFTGGIGVAKTNLVLIKGASVLGVRAGEAVRKNPALGVVRQHDLTRLANERRISPNISHRLPLEDYATAMRLLVDRRAIGRVVLTMR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 3 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 4 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 5 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 6 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 7 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 8 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 9 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 10 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 11 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 12 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 13 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 14 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 15 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 16 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 17 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 18 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 19 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 20 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 21 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 22 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 23 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 24 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 25 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 26 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 27 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 28 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 29 | 2791355199 | |||
| 30 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 31 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 32 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 33 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 34 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 35 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 36 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 37 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 38 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 39 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 40 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 41 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 42 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 43 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 44 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 45 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 46 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 47 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 48 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 49 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 50 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 51 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 52 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 53 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 54 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 55 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 56 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 57 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 58 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 59 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 60 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 61 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 62 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 63 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 64 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 65 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 66 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 67 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 68 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 69 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 70 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 71 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 72 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 73 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 74 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 75 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 76 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 77 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 78 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 79 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 80 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 81 | 2904699407 | |||
| 82 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 83 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 84 | 2906610324 | |||
| 85 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 86 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 87 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 88 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 89 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 90 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 91 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 92 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 93 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 94 | 2922368715 | |||
| 95 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 96 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 97 | 2922425934 | |||
| 98 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 99 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 100 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 101 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 102 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 103 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 104 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 105 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 106 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 107 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 108 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 109 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 110 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 111 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 112 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 113 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 114 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 115 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 116 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 117 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 118 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 119 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 120 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 121 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 122 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 123 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 124 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 125 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 126 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 127 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 128 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 129 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 130 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 131 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 132 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 133 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 134 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 135 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 136 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 137 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 138 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 139 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 140 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 141 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 142 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 143 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 144 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 145 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 146 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 147 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 148 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 149 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 150 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 151 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 152 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 153 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 154 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 155 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 156 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 157 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 158 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 159 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 160 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 161 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 162 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 163 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 164 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 165 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 166 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 167 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 168 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 169 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 170 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 171 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 172 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 173 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 174 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 175 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 176 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 177 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 178 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 179 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 180 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 181 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 182 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 183 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 184 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 185 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 186 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 187 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 188 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 189 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 190 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 191 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 192 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 193 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 194 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 195 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 196 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 197 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 198 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 199 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 201 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 202 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 203 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 204 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 206 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 207 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 208 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 209 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 211 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 213 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 214 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 215 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 216 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 217 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 218 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 219 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 220 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 221 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 222 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 223 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 224 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 225 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 226 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 227 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 228 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 229 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 230 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 231 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 232 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 233 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 234 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 235 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 236 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 237 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 238 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 239 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 240 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 241 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 242 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 282 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 283 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 284 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 285 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 289 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 290 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 291 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 292 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 293 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 294 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 295 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 296 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 297 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 298 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 299 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 300 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 301 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 302 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 303 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 304 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 305 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 306 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 307 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 308 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 309 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 310 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 311 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 312 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 313 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 314 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 315 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 316 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 317 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 318 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 319 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 320 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 321 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 322 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 323 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 324 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 325 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 326 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 327 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 328 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 329 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 330 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 331 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 332 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 333 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 334 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 335 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 336 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 337 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 338 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 339 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 340 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 341 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 397 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 398 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 399 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 400 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 401 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 402 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 403 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 404 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 405 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 406 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 407 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 408 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 409 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 410 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 411 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 412 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 413 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 414 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 415 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 416 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 417 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 418 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 419 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 420 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 421 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 423 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 424 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 425 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 426 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 427 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 428 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 429 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 430 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 431 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 432 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 433 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 434 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 436 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 439 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 440 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 441 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 442 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 443 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 444 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 445 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 446 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 447 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 448 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 449 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 450 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 451 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 452 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 453 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 454 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 455 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 456 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 457 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 458 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 459 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 460 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 461 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 462 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 463 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 464 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 465 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 466 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 467 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 468 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 469 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 470 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 471 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 472 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 473 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 474 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 475 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 476 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 477 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 478 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 479 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 480 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 481 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 482 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 483 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 484 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 485 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 486 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 487 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 488 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 489 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 490 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 491 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 492 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 493 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 494 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 495 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 496 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 75.55 |
| Metatranscriptomes | 0 |
| Isolates | 24.45 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.76 |
| Nodule | 19.75 |
| Rhizoplane | 7.13 |
| Rhizosphere | 47.19 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.17 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10006992 | 3300003215 | Bacteria | 5622 |
| 2 | JGI25153J46596_10013502 | 3300003215 | Bacteria | 3446 |
| 3 | JGI25153J46596_10028198 | 3300003215 | Bacteria | 1952 |
| 4 | JGI25160J50197_1003053 | 3300003354 | Bacteria | 7635 |
| 5 | JGI25160J50197_1006569 | 3300003354 | Bacteria | 4687 |
| 6 | JGI25160J50197_1008476 | 3300003354 | Bacteria | 3913 |
| 7 | Ga0055531_10002184 | 3300003794 | Bacteria | 13342 |
| 8 | Ga0055543_1002709 | 3300004625 | Bacteria | 5664 |
| 9 | Ga0055543_1019394 | 3300004625 | Bacteria | 1259 |
| 10 | Ga0065165_1002008 | 3300005262 | Bacteria | 19054 |
| 11 | Ga0065165_1003321 | 3300005262 | Bacteria | 11502 |
| 12 | Ga0065165_1019182 | 3300005262 | Bacteria | 2450 |
| 13 | Ga0070683_100104782 | 3300005329 | Bacteria | 2665 |
| 14 | Ga0070691_10136730 | 3300005341 | Bacteria | 1246 |
| 15 | Ga0070671_100040085 | 3300005355 | Bacteria | 3888 |
| 16 | Ga0070671_100152055 | 3300005355 | Bacteria | 1954 |
| 17 | Ga0070671_100397954 | 3300005355 | Bacteria | 1178 |
| 18 | Ga0070674_100026876 | 3300005356 | Bacteria | 3765 |
| 19 | Ga0070659_100118374 | 3300005366 | Bacteria | 2143 |
| 20 | Ga0070659_100136260 | 3300005366 | Bacteria | 1996 |
| 21 | Ga0070659_100176911 | 3300005366 | Bacteria | 1750 |
| 22 | Ga0070714_100072130 | 3300005435 | Bacteria | 2989 |
| 23 | Ga0070713_100027904 | 3300005436 | Bacteria | 4452 |
| 24 | Ga0070711_100061847 | 3300005439 | Bacteria | 2608 |
| 25 | Ga0070711_100170657 | 3300005439 | Bacteria | 1657 |
| 26 | Ga0070663_100059606 | 3300005455 | Bacteria | 2743 |
| 27 | Ga0070663_100117828 | 3300005455 | Bacteria | 2002 |
| 28 | Ga0070678_100063017 | 3300005456 | Bacteria | 2741 |
| 29 | Ga0070681_10207592 | 3300005458 | Bacteria | 1875 |
| 30 | Ga0068867_100335067 | 3300005459 | Bacteria | 1258 |
| 31 | Ga0070699_100289351 | 3300005518 | Bacteria | 1469 |
| 32 | Ga0070684_100210520 | 3300005535 | Bacteria | 1772 |
| 33 | Ga0068853_100032760 | 3300005539 | Bacteria | 4404 |
| 34 | Ga0068853_100080791 | 3300005539 | Bacteria | 2846 |
| 35 | Ga0068853_100432525 | 3300005539 | Bacteria | 1236 |
| 36 | Ga0070672_100303163 | 3300005543 | Bacteria | 1354 |
| 37 | Ga0070665_100091247 | 3300005548 | Bacteria | 3052 |
| 38 | Ga0070665_100164440 | 3300005548 | Bacteria | 2221 |
| 39 | Ga0070665_100176989 | 3300005548 | Bacteria | 2134 |
| 40 | Ga0070665_100262055 | 3300005548 | Bacteria | 1730 |
| 41 | Ga0068855_100029681 | 3300005563 | Bacteria | 6537 |
| 42 | Ga0068855_100272316 | 3300005563 | Bacteria | 1882 |
| 43 | Ga0068857_100034794 | 3300005577 | Bacteria | 4456 |
| 44 | Ga0068854_100033432 | 3300005578 | Bacteria | 3585 |
| 45 | Ga0068854_100311938 | 3300005578 | Bacteria | 1276 |
| 46 | Ga0068856_100059957 | 3300005614 | Bacteria | 3759 |
| 47 | Ga0068856_100151937 | 3300005614 | Bacteria | 2325 |
| 48 | Ga0068856_100172852 | 3300005614 | Bacteria | 2173 |
| 49 | Ga0068856_100316529 | 3300005614 | Bacteria | 1578 |
| 50 | Ga0068856_100426575 | 3300005614 | Bacteria | 1346 |
| 51 | Ga0068852_100127562 | 3300005616 | Bacteria | 2338 |
| 52 | Ga0068852_100140619 | 3300005616 | Bacteria | 2233 |
| 53 | Ga0068852_100210129 | 3300005616 | Bacteria | 1846 |
| 54 | Ga0068852_100462671 | 3300005616 | Bacteria | 1258 |
| 55 | Ga0068859_100293006 | 3300005617 | Bacteria | 1720 |
| 56 | Ga0068864_100041362 | 3300005618 | Bacteria | 3942 |
| 57 | Ga0068861_100028438 | 3300005719 | Bacteria | 4079 |
| 58 | Ga0068861_100058215 | 3300005719 | Bacteria | 2954 |
| 59 | Ga0068851_10086843 | 3300005834 | Bacteria | 1642 |
| 60 | Ga0068851_10090151 | 3300005834 | Bacteria | 1613 |
| 61 | Ga0068863_100455261 | 3300005841 | Bacteria | 1256 |
| 62 | Ga0068863_100468613 | 3300005841 | Bacteria | 1238 |
| 63 | Ga0068858_100015486 | 3300005842 | Bacteria | 7171 |
| 64 | Ga0068860_100006537 | 3300005843 | Bacteria | 11700 |
| 65 | Ga0068860_100063240 | 3300005843 | Bacteria | 3515 |
| 66 | Ga0068860_100405025 | 3300005843 | Bacteria | 1350 |
| 67 | Ga0068862_100080802 | 3300005844 | Bacteria | 2819 |
| 68 | Ga0068862_100147298 | 3300005844 | Bacteria | 2093 |
| 69 | Ga0068862_100169042 | 3300005844 | Bacteria | 1956 |
| 70 | Ga0081455_10007549 | 3300005937 | Bacteria | 11436 |
| 71 | Ga0081540_1001498 | 3300005983 | Bacteria | 20120 |
| 72 | Ga0081540_1007278 | 3300005983 | Bacteria | 7924 |
| 73 | Ga0081540_1010330 | 3300005983 | Bacteria | 6331 |
| 74 | Ga0081540_1011806 | 3300005983 | Bacteria | 5806 |
| 75 | Ga0081540_1025933 | 3300005983 | Bacteria | 3359 |
| 76 | Ga0081540_1061880 | 3300005983 | Bacteria | 1782 |
| 77 | Ga0081540_1095883 | 3300005983 | Bacteria | 1291 |
| 78 | Ga0081539_10000726 | 3300005985 | Bacteria | 66051 |
| 79 | Ga0081539_10039521 | 3300005985 | Bacteria | 2782 |
| 80 | Ga0081539_10088789 | 3300005985 | Bacteria | 1602 |
| 81 | Ga0075365_10053901 | 3300006038 | Bacteria | 2665 |
| 82 | Ga0075365_10116928 | 3300006038 | Bacteria | 1836 |
| 83 | Ga0075365_10176280 | 3300006038 | Bacteria | 1493 |
| 84 | Ga0075368_10041526 | 3300006042 | Bacteria | 1807 |
| 85 | Ga0075363_100094919 | 3300006048 | Bacteria | 1644 |
| 86 | Ga0075364_10024769 | 3300006051 | Bacteria | 3813 |
| 87 | Ga0070712_100048762 | 3300006175 | Bacteria | 2937 |
| 88 | Ga0075367_10002487 | 3300006178 | Bacteria | 8442 |
| 89 | Ga0075367_10034297 | 3300006178 | Bacteria | 2931 |
| 90 | Ga0075367_10112461 | 3300006178 | Bacteria | 1672 |
| 91 | Ga0097621_100029785 | 3300006237 | Bacteria | 4314 |
| 92 | Ga0097621_100111716 | 3300006237 | Bacteria | 2310 |
| 93 | Ga0068871_100101694 | 3300006358 | Bacteria | 2408 |
| 94 | Ga0075428_100227353 | 3300006844 | Bacteria | 2014 |
| 95 | Ga0075434_100113763 | 3300006871 | Bacteria | 2718 |
| 96 | Ga0068865_100167336 | 3300006881 | Bacteria | 1682 |
| 97 | Ga0068865_100221467 | 3300006881 | Bacteria | 1479 |
| 98 | Ga0097620_100293006 | 3300006931 | Bacteria | 1720 |
| 99 | Ga0099824_1013588 | 3300006942 | Bacteria | 8399 |
| 100 | Ga0099824_1032175 | 3300006942 | Bacteria | 1903 |
| 101 | Ga0099823_1048446 | 3300006944 | Bacteria | 2701 |
| 102 | Ga0075435_100115090 | 3300007076 | Bacteria | 2239 |
| 103 | Ga0105240_10010641 | 3300009093 | Bacteria | 12917 |
| 104 | Ga0105240_10345344 | 3300009093 | Bacteria | 1690 |
| 105 | Ga0105240_10501239 | 3300009093 | Bacteria | 1350 |
| 106 | Ga0111539_10121045 | 3300009094 | Bacteria | 3067 |
| 107 | Ga0105245_10068511 | 3300009098 | Bacteria | 3216 |
| 108 | Ga0105245_10118252 | 3300009098 | Bacteria | 2473 |
| 109 | Ga0114129_10101918 | 3300009147 | Bacteria | 3970 |
| 110 | Ga0105243_10025134 | 3300009148 | Bacteria | 4548 |
| 111 | Ga0105243_10209828 | 3300009148 | Bacteria | 1714 |
| 112 | Ga0105243_10395159 | 3300009148 | Bacteria | 1283 |
| 113 | Ga0105241_10059471 | 3300009174 | Bacteria | 2938 |
| 114 | Ga0105241_10201831 | 3300009174 | Bacteria | 1661 |
| 115 | Ga0105241_10313071 | 3300009174 | Bacteria | 1351 |
| 116 | Ga0105241_10318435 | 3300009174 | Bacteria | 1340 |
| 117 | Ga0105248_10065648 | 3300009177 | Bacteria | 4075 |
| 118 | Ga0105248_10186777 | 3300009177 | Bacteria | 2335 |
| 119 | Ga0105248_10265965 | 3300009177 | Bacteria | 1930 |
| 120 | Ga0105248_10351505 | 3300009177 | Bacteria | 1659 |
| 121 | Ga0105237_10004145 | 3300009545 | Bacteria | 16891 |
| 122 | Ga0105237_10024695 | 3300009545 | Bacteria | 6147 |
| 123 | Ga0105237_10070302 | 3300009545 | Bacteria | 3496 |
| 124 | Ga0105237_10152706 | 3300009545 | Bacteria | 2306 |
| 125 | Ga0105237_10263430 | 3300009545 | Bacteria | 1726 |
| 126 | Ga0105238_10080027 | 3300009551 | Bacteria | 3257 |
| 127 | Ga0099796_10012659 | 3300010159 | Bacteria | 2389 |
| 128 | Ga0105239_10046661 | 3300010375 | Bacteria | 4747 |
| 129 | Ga0105239_10060893 | 3300010375 | Bacteria | 4143 |
| 130 | Ga0105239_10062712 | 3300010375 | Bacteria | 4079 |
| 131 | Ga0105239_10083618 | 3300010375 | Bacteria | 3515 |
| 132 | Ga0105239_10151918 | 3300010375 | Bacteria | 2584 |
| 133 | Ga0105239_10347772 | 3300010375 | Bacteria | 1674 |
| 134 | Ga0105246_10010071 | 3300011119 | Bacteria | 5835 |
| 135 | Ga0157370_10079560 | 3300013104 | Bacteria | 3086 |
| 136 | Ga0157369_10395679 | 3300013105 | Bacteria | 1433 |
| 137 | Ga0157374_10011421 | 3300013296 | Bacteria | 7689 |
| 138 | Ga0157374_10079256 | 3300013296 | Bacteria | 3112 |
| 139 | Ga0157378_10183677 | 3300013297 | Bacteria | 1968 |
| 140 | Ga0163162_10094550 | 3300013306 | Bacteria | 3075 |
| 141 | Ga0163162_10280498 | 3300013306 | Bacteria | 1798 |
| 142 | Ga0157375_10148274 | 3300013308 | Bacteria | 2479 |
| 143 | Ga0157375_10388808 | 3300013308 | Bacteria | 1562 |
| 144 | Ga0163163_10059377 | 3300014325 | Bacteria | 3783 |
| 145 | Ga0163163_10420762 | 3300014325 | Bacteria | 1395 |
| 146 | Ga0157379_10016120 | 3300014968 | Bacteria | 6572 |
| 147 | Ga0157379_10043659 | 3300014968 | Bacteria | 4002 |
| 148 | Ga0157376_10347825 | 3300014969 | Bacteria | 1418 |
| 149 | Ga0214544_1000006 | 3300021320 | Bacteria | 380728 |
| 150 | Ga0214542_1000002 | 3300021321 | Bacteria | 720798 |
| 151 | Ga0214545_1000002 | 3300021324 | Bacteria | 727485 |
| 152 | Ga0214543_1000017 | 3300021327 | Bacteria | 290109 |
| 153 | Ga0213871_10009496 | 3300021441 | Bacteria | 2181 |
| 154 | Ga0209563_101461 | 3300025230 | Bacteria | 6240 |
| 155 | Ga0209677_108682 | 3300025253 | Bacteria | 1930 |
| 156 | Ga0209148_1000447 | 3300025254 | Bacteria | 45273 |
| 157 | Ga0209564_1003910 | 3300025295 | Bacteria | 9545 |
| 158 | Ga0209758_1000065 | 3300025297 | Bacteria | 306288 |
| 159 | Ga0209758_1002429 | 3300025297 | Bacteria | 19044 |
| 160 | Ga0209758_1003622 | 3300025297 | Bacteria | 13820 |
| 161 | Ga0209758_1025282 | 3300025297 | Bacteria | 2611 |
| 162 | Ga0209758_1025863 | 3300025297 | Bacteria | 2561 |
| 163 | Ga0209256_1011253 | 3300025299 | Bacteria | 3607 |
| 164 | Ga0209256_1021691 | 3300025299 | Bacteria | 1963 |
| 165 | Ga0207426_1000554 | 3300025302 | Bacteria | 51521 |
| 166 | Ga0207426_1000561 | 3300025302 | Bacteria | 50758 |
| 167 | Ga0207426_1002946 | 3300025302 | Bacteria | 9999 |
| 168 | Ga0209257_1000833 | 3300025304 | Bacteria | 44467 |
| 169 | Ga0209257_1031441 | 3300025304 | Bacteria | 1697 |
| 170 | Ga0207656_10066356 | 3300025321 | Bacteria | 1595 |
| 171 | Ga0207688_10006431 | 3300025901 | Bacteria | 6399 |
| 172 | Ga0207688_10019196 | 3300025901 | Bacteria | 3722 |
| 173 | Ga0207647_10089740 | 3300025904 | Bacteria | 1834 |
| 174 | Ga0207705_10304071 | 3300025909 | Bacteria | 1224 |
| 175 | Ga0207654_10000803 | 3300025911 | Bacteria | 17284 |
| 176 | Ga0207654_10002540 | 3300025911 | Bacteria | 9257 |
| 177 | Ga0207707_10165102 | 3300025912 | Bacteria | 1935 |
| 178 | Ga0207695_10000029 | 3300025913 | Bacteria | 548364 |
| 179 | Ga0207695_10001543 | 3300025913 | Bacteria | 37956 |
| 180 | Ga0207671_10018788 | 3300025914 | Bacteria | 5296 |
| 181 | Ga0207671_10156511 | 3300025914 | Bacteria | 1763 |
| 182 | Ga0207693_10255227 | 3300025915 | Bacteria | 1375 |
| 183 | Ga0207663_10129358 | 3300025916 | Bacteria | 1742 |
| 184 | Ga0207657_10009798 | 3300025919 | Bacteria | 9604 |
| 185 | Ga0207694_10232227 | 3300025924 | Bacteria | 1507 |
| 186 | Ga0207650_10061111 | 3300025925 | Bacteria | 2812 |
| 187 | Ga0207659_10206460 | 3300025926 | Bacteria | 1572 |
| 188 | Ga0207687_10013194 | 3300025927 | Bacteria | 5397 |
| 189 | Ga0207687_10168295 | 3300025927 | Bacteria | 1688 |
| 190 | Ga0207700_10042530 | 3300025928 | Bacteria | 3332 |
| 191 | Ga0207700_10154985 | 3300025928 | Bacteria | 1897 |
| 192 | Ga0207664_10301067 | 3300025929 | Bacteria | 1411 |
| 193 | Ga0207690_10107884 | 3300025932 | Bacteria | 2000 |
| 194 | Ga0207706_10099577 | 3300025933 | Bacteria | 2557 |
| 195 | Ga0207706_10136104 | 3300025933 | Bacteria | 2161 |
| 196 | Ga0207706_10345983 | 3300025933 | Bacteria | 1293 |
| 197 | Ga0207709_10012963 | 3300025935 | Bacteria | 4596 |
| 198 | Ga0207669_10040409 | 3300025937 | Bacteria | 2706 |
| 199 | Ga0207669_10062176 | 3300025937 | Bacteria | 2298 |
| 200 | Ga0207704_10095030 | 3300025938 | Bacteria | 1970 |
| 201 | Ga0207691_10081307 | 3300025940 | Bacteria | 2912 |
| 202 | Ga0207691_10139582 | 3300025940 | Bacteria | 2136 |
| 203 | Ga0207689_10010305 | 3300025942 | Bacteria | 8050 |
| 204 | Ga0207689_10062250 | 3300025942 | Bacteria | 3068 |
| 205 | Ga0207667_10007604 | 3300025949 | Bacteria | 12991 |
| 206 | Ga0207667_10018352 | 3300025949 | Bacteria | 7849 |
| 207 | Ga0207667_10296277 | 3300025949 | Bacteria | 1652 |
| 208 | Ga0207712_10026160 | 3300025961 | Bacteria | 3885 |
| 209 | Ga0207668_10062476 | 3300025972 | Bacteria | 2622 |
| 210 | Ga0207658_10242860 | 3300025986 | Bacteria | 1527 |
| 211 | Ga0207703_10282370 | 3300026035 | Bacteria | 1508 |
| 212 | Ga0207703_10562422 | 3300026035 | Bacteria | 1076 |
| 213 | Ga0207639_10028861 | 3300026041 | Bacteria | 4055 |
| 214 | Ga0207678_10025273 | 3300026067 | Bacteria | 5185 |
| 215 | Ga0207678_10052363 | 3300026067 | Bacteria | 3522 |
| 216 | Ga0207678_10061520 | 3300026067 | Bacteria | 3229 |
| 217 | Ga0207678_10069743 | 3300026067 | Bacteria | 3014 |
| 218 | Ga0207678_10074580 | 3300026067 | Bacteria | 2907 |
| 219 | Ga0207678_10087953 | 3300026067 | Bacteria | 2655 |
| 220 | Ga0207678_10096275 | 3300026067 | Bacteria | 2529 |
| 221 | Ga0207678_10151195 | 3300026067 | Bacteria | 1982 |
| 222 | Ga0207702_10000005 | 3300026078 | Bacteria | 420296 |
| 223 | Ga0207702_10000081 | 3300026078 | Bacteria | 108009 |
| 224 | Ga0207702_10255519 | 3300026078 | Bacteria | 1647 |
| 225 | Ga0207702_10601286 | 3300026078 | Bacteria | 1079 |
| 226 | Ga0207641_10442313 | 3300026088 | Bacteria | 1255 |
| 227 | Ga0207648_10135637 | 3300026089 | Bacteria | 2168 |
| 228 | Ga0207676_10405879 | 3300026095 | Bacteria | 1274 |
| 229 | Ga0207674_10043098 | 3300026116 | Bacteria | 4655 |
| 230 | Ga0207675_100011579 | 3300026118 | Bacteria | 8248 |
| 231 | Ga0207675_100033023 | 3300026118 | Bacteria | 4822 |
| 232 | Ga0207683_10072768 | 3300026121 | Bacteria | 3040 |
| 233 | Ga0207683_10106285 | 3300026121 | Bacteria | 2510 |
| 234 | Ga0207683_10116567 | 3300026121 | Bacteria | 2394 |
| 235 | Ga0207683_10154195 | 3300026121 | Bacteria | 2074 |
| 236 | Ga0207683_10327657 | 3300026121 | Bacteria | 1403 |
| 237 | Ga0207698_10062290 | 3300026142 | Bacteria | 2912 |
| 238 | Ga0207698_10077585 | 3300026142 | Bacteria | 2664 |
| 239 | Ga0207698_10286857 | 3300026142 | Bacteria | 1525 |
| 240 | Ga0209389_1000011 | 3300027296 | Bacteria | 223265 |
| 241 | Ga0209389_1000025 | 3300027296 | Bacteria | 149588 |
| 242 | Ga0209589_1000009 | 3300027357 | Bacteria | 252104 |
| 243 | Ga0209589_1000066 | 3300027357 | Bacteria | 100795 |
| 244 | Ga0209489_100010 | 3300027361 | Bacteria | 252139 |
| 245 | Ga0209489_100017 | 3300027361 | Bacteria | 223265 |
| 246 | Ga0209489_100030 | 3300027361 | Bacteria | 185999 |
| 247 | Ga0209700_100017 | 3300027363 | Bacteria | 252104 |
| 248 | Ga0209700_100027 | 3300027363 | Bacteria | 223462 |
| 249 | Ga0268266_10001147 | 3300028379 | Bacteria | 32898 |
| 250 | Ga0268266_10008591 | 3300028379 | Bacteria | 9072 |
| 251 | Ga0268266_10014072 | 3300028379 | Bacteria | 6886 |
| 252 | Ga0268266_10033130 | 3300028379 | Bacteria | 4393 |
| 253 | Ga0268266_10066804 | 3300028379 | Bacteria | 3111 |
| 254 | Ga0268266_10426890 | 3300028379 | Bacteria | 1257 |
| 255 | Ga0268265_10044846 | 3300028380 | Bacteria | 3295 |
| 256 | Ga0268265_10082002 | 3300028380 | Bacteria | 2549 |
| 257 | Ga0268265_10156508 | 3300028380 | Bacteria | 1929 |
| 258 | Ga0268264_10000035 | 3300028381 | Bacteria | 398196 |
| 259 | Ga0265326_10002319 | 3300028558 | Bacteria | 6427 |
| 260 | Ga0265319_1001659 | 3300028563 | Bacteria | 12877 |
| 261 | Ga0265334_10000799 | 3300028573 | Bacteria | 15763 |
| 262 | Ga0265318_10010755 | 3300028577 | Bacteria | 3971 |
| 263 | Ga0265323_10003079 | 3300028653 | Bacteria | 7427 |
| 264 | Ga0265322_10002933 | 3300028654 | Bacteria | 5194 |
| 265 | Ga0265336_10000233 | 3300028666 | Bacteria | 39706 |
| 266 | Ga0307517_10000062 | 3300028786 | Bacteria | 145054 |
| 267 | Ga0307515_10063942 | 3300028794 | Bacteria | 5154 |
| 268 | Ga0265338_10000090 | 3300028800 | Bacteria | 171540 |
| 269 | Ga0265324_10006268 | 3300029957 | Bacteria | 4993 |
| 270 | Ga0265330_10036948 | 3300031235 | Bacteria | 2175 |
| 271 | Ga0265340_10001013 | 3300031247 | Bacteria | 15991 |
| 272 | Ga0265331_10100264 | 3300031250 | Bacteria | 1333 |
| 273 | Ga0307509_10015347 | 3300031507 | Bacteria | 8940 |
| 274 | Ga0307509_10287354 | 3300031507 | Bacteria | 1401 |
| 275 | Ga0307509_10358228 | 3300031507 | Bacteria | 1179 |
| 276 | Ga0307508_10000532 | 3300031616 | Bacteria | 45338 |
| 277 | Ga0307508_10007265 | 3300031616 | Bacteria | 10313 |
| 278 | Ga0265314_10043780 | 3300031711 | Bacteria | 3179 |
| 279 | Ga0265342_10154022 | 3300031712 | Bacteria | 1274 |
| 280 | Ga0265342_10188823 | 3300031712 | Bacteria | 1125 |
| 281 | Ga0307516_10012214 | 3300031730 | Bacteria | 9273 |
| 282 | Ga0307516_10012607 | 3300031730 | Bacteria | 9094 |
| 283 | Ga0307516_10097233 | 3300031730 | Bacteria | 2764 |
| 284 | Ga0307516_10192637 | 3300031730 | Bacteria | 1764 |
| 285 | Ga0307516_10310552 | 3300031730 | Bacteria | 1250 |
| 286 | Ga0307413_10279574 | 3300031824 | Bacteria | 1255 |
| 287 | Ga0307412_10075388 | 3300031911 | Bacteria | 2314 |
| 288 | Ga0307409_100462482 | 3300031995 | Bacteria | 1227 |
| 289 | Ga0307415_100061564 | 3300032126 | Bacteria | 2599 |
| 290 | Ga0307415_100324726 | 3300032126 | Bacteria | 1285 |
| 291 | Ga0307507_10023504 | 3300033179 | Bacteria | 6764 |
| 292 | Ga0307510_10018748 | 3300033180 | Bacteria | 8132 |
| 293 | Ga0307510_10075582 | 3300033180 | Bacteria | 3320 |
| 294 | Ga0315911_1000009 | 3300033442 | Bacteria | 379354 |
| 295 | Ga0373928_0008426 | 3300035084 | Bacteria | 2002 |
| 296 | Ga0373939_0031774 | 3300035114 | Bacteria | 1529 |
| 297 | Ga0373946_0028104 | 3300035171 | Bacteria | 2229 |
| 298 | Ga0373931_0228115 | 3300035691 | Bacteria | 1124 |
| 299 | Ga0373927_0082643 | 3300035695 | Bacteria | 2083 |
| 300 | Ga0373927_0237369 | 3300035695 | Bacteria | 1198 |
| 301 | Ga0373933_0000167 | 3300035724 | Bacteria | 42851 |
| 302 | Ga0373947_0108025 | 3300035725 | Bacteria | 1755 |
| 303 | Ga0373925_0087293 | 3300037068 | Bacteria | 2381 |
| 304 | Ga0395899_0034271 | 3300037312 | Bacteria | 3812 |
| 305 | Ga0395900_0019057 | 3300037418 | Bacteria | 6996 |
| 306 | Ga0395898_0188863 | 3300037466 | Bacteria | 1969 |
| 307 | Ga0395898_0222633 | 3300037466 | Bacteria | 1800 |
| 308 | Ga0395905_0233194 | 3300037471 | Bacteria | 1721 |
| 309 | Ga0436364_1156934 | 3300037853 | Bacteria | 1570 |
| 310 | Ga0395901_0034427 | 3300038443 | Bacteria | 5231 |
| 311 | Ga0395901_0152438 | 3300038443 | Bacteria | 2429 |
| 312 | Ga0436360_1060898 | 3300039438 | Bacteria | 1415 |
| 313 | Ga0436361_0152747 | 3300039447 | Bacteria | 2046 |
| 314 | Ga0451853_1980775 | 3300041512 | Bacteria | 974 |
| 315 | Ga0466969_0013180 | 3300044656 | Bacteria | 4356 |
| 316 | Ga0466965_0056339 | 3300044683 | Bacteria | 1957 |
| 317 | Ga0466966_0000148 | 3300044684 | Bacteria | 44828 |
| 318 | Ga0466961_0000045 | 3300044693 | Bacteria | 75331 |
| 319 | Ga0466964_0050790 | 3300044706 | Bacteria | 1701 |
| 320 | Ga0466964_0060246 | 3300044706 | Bacteria | 1578 |
| 321 | Ga0466968_0029823 | 3300044735 | Bacteria | 2257 |
| 322 | Ga0466970_0042331 | 3300044765 | Bacteria | 2422 |
| 323 | Ga0466957_0129504 | 3300044842 | Bacteria | 1615 |
| 324 | Ga0466957_0157108 | 3300044842 | Bacteria | 1475 |
| 325 | Ga0466960_0189599 | 3300044901 | Bacteria | 1118 |
| 326 | Ga0466959_0003014 | 3300045049 | Bacteria | 10882 |
| 327 | Ga0466959_0021412 | 3300045049 | Bacteria | 4768 |
| 328 | Ga0495603_0018889 | 3300046455 | Bacteria | 4172 |
| 329 | Ga0495603_0043688 | 3300046455 | Bacteria | 2675 |
| 330 | Ga0495590_0015098 | 3300046457 | Bacteria | 2810 |
| 331 | Ga0495629_0092111 | 3300046459 | Bacteria | 2116 |
| 332 | Ga0495629_0096403 | 3300046459 | Bacteria | 2063 |
| 333 | Ga0495638_0010390 | 3300046460 | Bacteria | 6470 |
| 334 | Ga0495638_0020052 | 3300046460 | Bacteria | 4418 |
| 335 | Ga0495638_0044353 | 3300046460 | Bacteria | 2801 |
| 336 | Ga0495638_0129249 | 3300046460 | Bacteria | 1485 |
| 337 | Ga0495651_0000472 | 3300046462 | Bacteria | 30989 |
| 338 | Ga0495651_0311975 | 3300046462 | Bacteria | 1051 |
| 339 | Ga0495653_0039871 | 3300046463 | Bacteria | 3676 |
| 340 | Ga0495650_0040691 | 3300046471 | Bacteria | 1993 |
| 341 | Ga0495580_0115154 | 3300046472 | Bacteria | 1867 |
| 342 | Ga0495582_0120896 | 3300046473 | Bacteria | 1476 |
| 343 | Ga0495664_0017778 | 3300046477 | Bacteria | 4065 |
| 344 | Ga0495664_0316803 | 3300046477 | Bacteria | 941 |
| 345 | Ga0495585_0065988 | 3300046492 | Bacteria | 1982 |
| 346 | Ga0495594_0062068 | 3300046499 | Bacteria | 2069 |
| 347 | Ga0495607_0067717 | 3300046501 | Bacteria | 2005 |
| 348 | Ga0495606_0004247 | 3300046507 | Bacteria | 14485 |
| 349 | Ga0495606_0005996 | 3300046507 | Bacteria | 11391 |
| 350 | Ga0495606_0202546 | 3300046507 | Bacteria | 1130 |
| 351 | Ga0495608_0018937 | 3300046511 | Bacteria | 4745 |
| 352 | Ga0495610_0039561 | 3300046512 | Bacteria | 2383 |
| 353 | Ga0495616_0100607 | 3300046513 | Bacteria | 1356 |
| 354 | Ga0495628_0016126 | 3300046516 | Bacteria | 6234 |
| 355 | Ga0495630_0136574 | 3300046517 | Bacteria | 1863 |
| 356 | Ga0495631_0043205 | 3300046518 | Bacteria | 1988 |
| 357 | Ga0495643_0029296 | 3300046522 | Bacteria | 3081 |
| 358 | Ga0495643_0047211 | 3300046522 | Bacteria | 2333 |
| 359 | Ga0495644_0021386 | 3300046523 | Bacteria | 2468 |
| 360 | Ga0495648_0003979 | 3300046524 | Bacteria | 12789 |
| 361 | Ga0495648_0092725 | 3300046524 | Bacteria | 1686 |
| 362 | Ga0495663_0057358 | 3300046525 | Bacteria | 1218 |
| 363 | Ga0495652_0001339 | 3300046529 | Bacteria | 27421 |
| 364 | Ga0495587_0012944 | 3300046536 | Bacteria | 5245 |
| 365 | Ga0495622_0027387 | 3300046557 | Bacteria | 2660 |
| 366 | Ga0495622_0068564 | 3300046557 | Bacteria | 1638 |
| 367 | Ga0495633_0135270 | 3300046558 | Bacteria | 1140 |
| 368 | Ga0495667_0007621 | 3300046559 | Bacteria | 7343 |
| 369 | Ga0495656_0001067 | 3300046615 | Bacteria | 8878 |
| 370 | Ga0495656_0025016 | 3300046615 | Bacteria | 2363 |
| 371 | Ga0495668_0024598 | 3300046616 | Bacteria | 3425 |
| 372 | Ga0495668_0209439 | 3300046616 | Bacteria | 1067 |
| 373 | Ga0495634_0013513 | 3300046642 | Bacteria | 5898 |
| 374 | Ga0495611_0010250 | 3300046648 | Bacteria | 3965 |
| 375 | Ga0495625_0043231 | 3300046660 | Bacteria | 3269 |
| 376 | Ga0495625_0053001 | 3300046660 | Bacteria | 2903 |
| 377 | Ga0495588_0046912 | 3300046674 | Bacteria | 2217 |
| 378 | Ga0495657_0005672 | 3300046675 | Bacteria | 9843 |
| 379 | Ga0495599_0016375 | 3300046678 | Bacteria | 4602 |
| 380 | Ga0495623_0004396 | 3300046679 | Bacteria | 9261 |
| 381 | Ga0495669_0024616 | 3300046684 | Bacteria | 2621 |
| 382 | Ga0495669_0145660 | 3300046684 | Bacteria | 1119 |
| 383 | Ga0495613_0027045 | 3300046689 | Bacteria | 4270 |
| 384 | Ga0495670_0016306 | 3300046691 | Bacteria | 3650 |
| 385 | Ga0495671_0119520 | 3300046692 | Bacteria | 1286 |
| 386 | Ga0495649_0050747 | 3300046694 | Bacteria | 2250 |
| 387 | Ga0495600_0006605 | 3300046809 | Bacteria | 7066 |
| 388 | Ga0495581_0108464 | 3300047315 | Bacteria | 1614 |
| 389 | Ga0495604_0000953 | 3300047317 | Bacteria | 24133 |
| 390 | Ga0495674_0008322 | 3300047319 | Bacteria | 9890 |
| 391 | Ga0495672_0015872 | 3300047320 | Bacteria | 5099 |
| 392 | Ga0495672_0021750 | 3300047320 | Bacteria | 4178 |
| 393 | Ga0495676_0014964 | 3300047321 | Bacteria | 6924 |
| 394 | Ga0495680_0001642 | 3300047322 | Bacteria | 23759 |
| 395 | Ga0495687_042517 | 3300047443 | Bacteria | 1985 |
| 396 | Ga0495686_0128589 | 3300047472 | Bacteria | 1504 |
| 397 | Ga0495686_0179108 | 3300047472 | Bacteria | 1229 |
| 398 | Ga0495593_0041694 | 3300047673 | Bacteria | 2467 |
| 399 | Ga0495602_0019800 | 3300048088 | Bacteria | 6667 |
| 400 | Ga0495615_0039805 | 3300048090 | Bacteria | 1168 |
| 401 | Ga0495615_0042269 | 3300048090 | Bacteria | 1143 |
| 402 | Ga0495615_0049047 | 3300048090 | Bacteria | 1081 |
| 403 | Ga0496100_0136209 | 3300048903 | Bacteria | 1735 |
| 404 | Ga0496100_0150824 | 3300048903 | Bacteria | 1658 |
| 405 | Ga0496101_0179936 | 3300048904 | Bacteria | 1628 |
| 406 | Ga0496101_0289218 | 3300048904 | Bacteria | 1282 |
| 407 | Ga0496102_0009044 | 3300048905 | Bacteria | 8548 |
| 408 | Ga0496102_0057494 | 3300048905 | Bacteria | 3552 |
| 409 | Ga0496102_0244571 | 3300048905 | Bacteria | 1692 |
| 410 | Ga0496102_0285540 | 3300048905 | Bacteria | 1555 |
| 411 | Ga0496102_0316404 | 3300048905 | Bacteria | 1470 |
| 412 | Ga0496103_0015643 | 3300048906 | Bacteria | 4521 |
| 413 | Ga0496103_0106108 | 3300048906 | Bacteria | 1781 |
| 414 | Ga0496104_0004724 | 3300048907 | Bacteria | 11857 |
| 415 | Ga0496104_0078088 | 3300048907 | Bacteria | 3154 |
| 416 | Ga0496104_0194318 | 3300048907 | Bacteria | 1941 |
| 417 | Ga0496104_0322309 | 3300048907 | Bacteria | 1458 |
| 418 | Ga0496105_0011117 | 3300048908 | Bacteria | 7100 |
| 419 | Ga0496105_0106881 | 3300048908 | Bacteria | 2310 |
| 420 | Ga0496106_0027320 | 3300048909 | Bacteria | 4250 |
| 421 | Ga0496106_0046484 | 3300048909 | Bacteria | 3264 |
| 422 | Ga0496106_0063950 | 3300048909 | Bacteria | 2798 |
| 423 | Ga0496106_0129070 | 3300048909 | Bacteria | 1981 |
| 424 | Ga0496106_0216270 | 3300048909 | Bacteria | 1527 |
| 425 | Ga0496106_0318787 | 3300048909 | Bacteria | 1248 |
| 426 | Ga0496107_0065379 | 3300048910 | Bacteria | 2636 |
| 427 | Ga0496107_0065968 | 3300048910 | Bacteria | 2624 |
| 428 | Ga0496108_0015476 | 3300048911 | Bacteria | 6222 |
| 429 | Ga0496108_0138255 | 3300048911 | Bacteria | 2098 |
| 430 | Ga0496109_0019407 | 3300048912 | Bacteria | 5995 |
| 431 | Ga0496109_0020502 | 3300048912 | Bacteria | 5839 |
| 432 | Ga0496109_0112483 | 3300048912 | Bacteria | 2532 |
| 433 | Ga0496110_0072371 | 3300048913 | Bacteria | 3058 |
| 434 | Ga0496110_0074209 | 3300048913 | Bacteria | 3020 |
| 435 | Ga0496111_0091246 | 3300048914 | Bacteria | 2232 |
| 436 | Ga0496111_0296162 | 3300048914 | Bacteria | 1199 |
| 437 | Ga0496112_0004323 | 3300048915 | Bacteria | 12012 |
| 438 | Ga0496112_0088407 | 3300048915 | Bacteria | 3066 |
| 439 | Ga0496112_0127333 | 3300048915 | Bacteria | 2517 |
| 440 | Ga0496112_0214242 | 3300048915 | Bacteria | 1883 |
| 441 | Ga0496113_0028782 | 3300048916 | Bacteria | 4000 |
| 442 | Ga0496113_0063686 | 3300048916 | Bacteria | 2787 |
| 443 | Ga0496113_0132218 | 3300048916 | Bacteria | 1959 |
| 444 | Ga0496114_0031614 | 3300048917 | Bacteria | 4354 |
| 445 | Ga0496114_0187808 | 3300048917 | Bacteria | 1807 |
| 446 | Ga0496114_0221690 | 3300048917 | Bacteria | 1660 |
| 447 | Ga0496115_0011656 | 3300048918 | Bacteria | 6598 |
| 448 | Ga0496115_0050745 | 3300048918 | Bacteria | 3325 |
| 449 | Ga0496115_0057194 | 3300048918 | Bacteria | 3136 |
| 450 | Ga0496115_0063037 | 3300048918 | Bacteria | 2991 |
| 451 | Ga0496115_0067141 | 3300048918 | Bacteria | 2900 |
| 452 | Ga0496115_0129053 | 3300048918 | Bacteria | 2083 |
| 453 | Ga0496116_0003781 | 3300048919 | Bacteria | 14794 |
| 454 | Ga0496117_0077577 | 3300048920 | Bacteria | 2198 |
| 455 | Ga0496117_0083558 | 3300048920 | Bacteria | 2087 |
| 456 | Ga0496118_0021551 | 3300048921 | Bacteria | 5667 |
| 457 | Ga0496118_0046349 | 3300048921 | Bacteria | 3383 |
| 458 | Ga0496120_0166747 | 3300048923 | Bacteria | 1093 |
| 459 | Ga0496121_0001443 | 3300048924 | Bacteria | 40145 |
| 460 | Ga0496121_0001527 | 3300048924 | Bacteria | 38742 |
| 461 | Ga0496121_0006578 | 3300048924 | Bacteria | 14342 |
| 462 | Ga0496121_0032132 | 3300048924 | Bacteria | 4777 |
| 463 | Ga0496121_0056496 | 3300048924 | Bacteria | 3260 |
| 464 | Ga0496121_0102601 | 3300048924 | Bacteria | 2203 |
| 465 | Ga0496121_0106268 | 3300048924 | Bacteria | 2152 |
| 466 | Ga0496121_0106850 | 3300048924 | Bacteria | 2145 |
| 467 | Ga0496122_0026944 | 3300048925 | Bacteria | 4934 |
| 468 | Ga0496124_0002203 | 3300048927 | Bacteria | 25990 |
| 469 | Ga0496124_0244482 | 3300048927 | Bacteria | 1332 |
| 470 | Ga0496124_0249313 | 3300048927 | Bacteria | 1315 |
| 471 | Ga0496125_0000092 | 3300048928 | Bacteria | 211050 |
| 472 | Ga0496125_0009813 | 3300048928 | Bacteria | 9756 |
| 473 | Ga0496125_0090446 | 3300048928 | Bacteria | 2297 |
| 474 | Ga0496125_0097212 | 3300048928 | Bacteria | 2182 |
| 475 | Ga0496125_0101012 | 3300048928 | Bacteria | 2124 |
| 476 | Ga0496126_0006684 | 3300048929 | Bacteria | 12815 |
| 477 | Ga0496126_0039188 | 3300048929 | Bacteria | 4399 |
| 478 | Ga0496126_0077337 | 3300048929 | Bacteria | 2950 |
| 479 | Ga0496126_0257206 | 3300048929 | Bacteria | 1453 |
| 480 | Ga0495682_0010078 | 3300049460 | Bacteria | 3670 |
| 481 | Ga0501042_0276773 | 3300049578 | Bacteria | 1212 |
| 482 | Ga0501047_0050488 | 3300049581 | Bacteria | 4017 |
| 483 | Ga0501068_0201606 | 3300049584 | Bacteria | 1262 |
| 484 | Ga0501070_0185960 | 3300049586 | Bacteria | 1709 |
| 485 | Ga0501044_0233648 | 3300049823 | Bacteria | 1785 |
| 486 | nmdc:mga03n38_124944_c1 | 3300050490 | Bacteria | 1269 |
| 487 | nmdc:mga03n38_83409_c1 | 3300050490 | Bacteria | 1507 |
| 488 | nmdc:mga00v17_202324_c1 | 3300050491 | Bacteria | 1284 |
| 489 | nmdc:mga0yw44_112073_c1 | 3300050492 | Bacteria | 1749 |
| 490 | nmdc:mga0yw44_25249_c2 | 3300050492 | Bacteria | 1573 |
| 491 | nmdc:mga06z11_45600_c1 | 3300050494 | Bacteria | 2217 |
| 492 | nmdc:mga04h51_45470_c1 | 3300050495 | Bacteria | 1452 |
| 493 | nmdc:mga05p37_141697_c1 | 3300050507 | Bacteria | 2945 |
| 494 | nmdc:mga0rr50_174705_c1 | 3300050513 | Bacteria | 1752 |
| 495 | Ga0495601_0042376 | 3300053077 | Bacteria | 2856 |
| 496 | Ga0495601_0286446 | 3300053077 | Bacteria | 1074 |
| 497 | Ga0500635_0028777 | 3300053080 | Bacteria | 1778 |
| 498 | Ga0495595_0062252 | 3300053084 | Bacteria | 1749 |
| 499 | Ga0495619_0028489 | 3300053085 | Bacteria | 3603 |
| 500 | Ga0500643_000019 | 3300053087 | Bacteria | 294301 |
| 501 | Ga0500651_0061733 | 3300053093 | Bacteria | 2340 |
| 502 | Ga0500651_0067270 | 3300053093 | Bacteria | 2231 |
| 503 | Ga0500566_0000693 | 3300053094 | Bacteria | 18973 |
| 504 | Ga0500566_0003060 | 3300053094 | Bacteria | 9993 |
| 505 | Ga0500566_0004708 | 3300053094 | Bacteria | 8125 |
| 506 | Ga0500641_0009503 | 3300053096 | Bacteria | 3498 |
| 507 | Ga0500641_0021737 | 3300053096 | Bacteria | 2450 |
| 508 | Ga0500641_0063799 | 3300053096 | Bacteria | 1538 |
| 509 | Ga0500650_0002857 | 3300053098 | Bacteria | 5835 |
| 510 | Ga0500556_0000024 | 3300053104 | Bacteria | 167556 |
| 511 | Ga0500569_017427 | 3300053109 | Bacteria | 1836 |
| 512 | Ga0500595_000478 | 3300053119 | Bacteria | 24694 |
| 513 | Ga0500595_008096 | 3300053119 | Bacteria | 4312 |
| 514 | Ga0500607_036478 | 3300053121 | Bacteria | 2684 |
| 515 | Ga0500608_001404 | 3300053122 | Bacteria | 8620 |
| 516 | Ga0500618_012076 | 3300053125 | Bacteria | 2272 |
| 517 | Ga0500642_0000035 | 3300053130 | Bacteria | 106656 |
| 518 | Ga0500642_0000096 | 3300053130 | Bacteria | 42836 |
| 519 | Ga0500642_0014156 | 3300053130 | Bacteria | 2959 |
| 520 | Ga0500642_0053040 | 3300053130 | Bacteria | 1797 |
| 521 | Ga0500652_000404 | 3300053131 | Bacteria | 15463 |
| 522 | Ga0500658_0022678 | 3300053134 | Bacteria | 2390 |
| 523 | Ga0500658_0043662 | 3300053134 | Bacteria | 1805 |
| 524 | Ga0500559_0039548 | 3300053136 | Bacteria | 2052 |
| 525 | Ga0500568_0005040 | 3300053139 | Bacteria | 6916 |
| 526 | Ga0500568_0017048 | 3300053139 | Bacteria | 3214 |
| 527 | Ga0500577_0001147 | 3300053142 | Bacteria | 6786 |
| 528 | Ga0500577_0079393 | 3300053142 | Bacteria | 1305 |
| 529 | Ga0500586_001242 | 3300053145 | Bacteria | 5328 |
| 530 | Ga0500604_0001709 | 3300053151 | Bacteria | 6155 |
| 531 | Ga0500604_0045570 | 3300053151 | Bacteria | 1338 |
| 532 | Ga0500616_0000122 | 3300053153 | Bacteria | 140228 |
| 533 | Ga0500622_0000790 | 3300053156 | Bacteria | 27440 |
| 534 | Ga0500634_0161980 | 3300053161 | Bacteria | 1031 |
| 535 | Ga0500638_024000 | 3300053162 | Bacteria | 2903 |
| 536 | Ga0500636_0000410 | 3300053177 | Bacteria | 23626 |
| 537 | Ga0500636_0006371 | 3300053177 | Bacteria | 6769 |
| 538 | Ga0500636_0017882 | 3300053177 | Bacteria | 4190 |
| 539 | Ga0500637_0000245 | 3300053178 | Bacteria | 20132 |
| 540 | Ga0500625_000095 | 3300053729 | Bacteria | 16474 |
| 541 | Ga0500609_003240 | 3300053731 | Bacteria | 2303 |
| 542 | Ga0500596_013260 | 3300053735 | Bacteria | 1246 |
| 543 | Ga0500599_006070 | 3300053736 | Bacteria | 1534 |
| 544 | Ga0500601_000120 | 3300053737 | Bacteria | 16487 |
| 545 | Ga0500661_000938 | 3300055283 | Bacteria | 5458 |
| 546 | Ga0500661_008979 | 3300055283 | Bacteria | 1836 |
| 547 | Ga0500661_011620 | 3300055283 | Bacteria | 1591 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049584 | Ga0501068_0201606 | Ga0501068_0201606_10_867 | 277 |
| 2 | 3300046557 | Ga0495622_0027387 | Ga0495622_0027387_765_1691 | 289 |
| 3 | iso_pu_bacteria | 8019555841 | 8019558326 | 294 |
| 4 | 3300046616 | Ga0495668_0209439 | Ga0495668_0209439_25_924 | 299 |
| 5 | 3300053735 | Ga0500596_013260 | Ga0500596_013260_331_1236 | 300 |
| 6 | 3300035691 | Ga0373931_0228115 | Ga0373931_0228115_168_1079 | 301 |
| 7 | 3300046477 | Ga0495664_0316803 | Ga0495664_0316803_11_916 | 301 |
| 8 | 3300048908 | Ga0496105_0106881 | Ga0496105_0106881_1238_2149 | 301 |
| 9 | 3300048910 | Ga0496107_0065968 | Ga0496107_0065968_592_1503 | 301 |
| 10 | 3300048912 | Ga0496109_0019407 | Ga0496109_0019407_4833_5744 | 301 |
| 11 | 3300048913 | Ga0496110_0072371 | Ga0496110_0072371_607_1518 | 301 |
| 12 | 3300048915 | Ga0496112_0088407 | Ga0496112_0088407_1115_2026 | 301 |
| 13 | 3300048916 | Ga0496113_0132218 | Ga0496113_0132218_924_1835 | 301 |
| 14 | 3300048918 | Ga0496115_0050745 | Ga0496115_0050745_634_1545 | 301 |
| 15 | 3300041512 | Ga0451853_1980775 | Ga0451853_1980775_18_941 | 307 |
| 16 | 3300053077 | Ga0495601_0286446 | Ga0495601_0286446_109_1038 | 309 |
| 17 | 3300031507 | Ga0307509_10358228 | Ga0307509_103582282 | 312 |
| 18 | 3300033179 | Ga0307507_10023504 | Ga0307507_100235042 | 312 |
| 19 | 3300046459 | Ga0495629_0092111 | Ga0495629_0092111_465_1514 | 312 |
| 20 | 3300031507 | Ga0307509_10015347 | Ga0307509_100153474 | 313 |
| 21 | 3300048919 | Ga0496116_0003781 | Ga0496116_0003781_4353_5297 | 313 |
| 22 | 3300048928 | Ga0496125_0101012 | Ga0496125_0101012_558_1502 | 313 |
| 23 | 3300053080 | Ga0500635_0028777 | Ga0500635_0028777_113_1111 | 313 |
| 24 | 3300053136 | Ga0500559_0039548 | Ga0500559_0039548_220_1197 | 317 |
| 25 | iso_pu_bacteria | 2617270741 | 2617377997 | 319 |
| 26 | iso_pu_bacteria | 2824746037 | 2824751082 | 319 |
| 27 | iso_pu_bacteria | 2857509624 | 2857510000 | 319 |
| 28 | iso_pu_bacteria | 2889033259 | 2889039174 | 319 |
| 29 | iso_pu_bacteria | 2893066018 | 2893068959 | 319 |
| 30 | iso_pu_bacteria | 2906610324 | 2906610671 | 319 |
| 31 | iso_pu_bacteria | 2922425934 | 2922428653 | 319 |
| 32 | iso_pu_bacteria | 2935694250 | 2935695456 | 319 |
| 33 | iso_pu_bacteria | 3005587118 | 3005590666 | 319 |
| 34 | iso_pu_bacteria | 8019565922 | 8019566967 | 319 |
| 35 | 3300005843 | Ga0068860_100006537 | Ga0068860_1000065376 | 320 |
| 36 | 3300028381 | Ga0268264_10000035 | Ga0268264_10000035216 | 320 |
| 37 | 3300031730 | Ga0307516_10012214 | Ga0307516_100122148 | 320 |
| 38 | 3300031730 | Ga0307516_10097233 | Ga0307516_100972333 | 320 |
| 39 | iso_pu_bacteria | 2507262055 | 2507509971 | 320 |
| 40 | iso_pu_bacteria | 2508501128 | 2509147611 | 320 |
| 41 | iso_pu_bacteria | 2511231028 | 2511398902 | 320 |
| 42 | iso_pu_bacteria | 2513237092 | 2513627614 | 320 |
| 43 | iso_pu_bacteria | 2513237094 | 2513645016 | 320 |
| 44 | iso_pu_bacteria | 2513237095 | 2513652261 | 320 |
| 45 | iso_pu_bacteria | 2513237096 | 2513659266 | 320 |
| 46 | iso_pu_bacteria | 2513237101 | 2513696092 | 320 |
| 47 | iso_pu_bacteria | 2513237137 | 2513862038 | 320 |
| 48 | iso_pu_bacteria | 2513237145 | 2513921472 | 320 |
| 49 | iso_pu_bacteria | 2513237161 | 2514011273 | 320 |
| 50 | iso_pu_bacteria | 2517093001 | 2517103276 | 320 |
| 51 | iso_pu_bacteria | 2517572143 | 2517893786 | 320 |
| 52 | iso_pu_bacteria | 2524023205 | 2524439004 | 320 |
| 53 | iso_pu_bacteria | 2524023210 | 2524469411 | 320 |
| 54 | iso_pu_bacteria | 2524023228 | 2524537734 | 320 |
| 55 | iso_pu_bacteria | 2528768022 | 2528852738 | 320 |
| 56 | iso_pu_bacteria | 2602042107 | 2603861107 | 320 |
| 57 | iso_pu_bacteria | 2617270735 | 2617353446 | 320 |
| 58 | iso_pu_bacteria | 2643221651 | 2644287860 | 320 |
| 59 | iso_pu_bacteria | 2667528175 | 2671124125 | 320 |
| 60 | iso_pu_bacteria | 2721755755 | 2723846327 | 320 |
| 61 | iso_pu_bacteria | 2728368998 | 2728752929 | 320 |
| 62 | iso_pu_bacteria | 2744054633 | 2745078883 | 320 |
| 63 | iso_pu_bacteria | 2791355196 | 2793060041 | 320 |
| 64 | iso_pu_bacteria | 2791355197 | 2793070713 | 320 |
| 65 | iso_pu_bacteria | 2791355199 | 2793083271 | 320 |
| 66 | iso_pu_bacteria | 2816332527 | 2818242486 | 320 |
| 67 | iso_pu_bacteria | 2824600985 | 2824605657 | 320 |
| 68 | iso_pu_bacteria | 2824609381 | 2824609908 | 320 |
| 69 | iso_pu_bacteria | 2824653114 | 2824655693 | 320 |
| 70 | iso_pu_bacteria | 2824661429 | 2824666579 | 320 |
| 71 | iso_pu_bacteria | 2824679649 | 2824686620 | 320 |
| 72 | iso_pu_bacteria | 2824704595 | 2824707786 | 320 |
| 73 | iso_pu_bacteria | 2824753945 | 2824758095 | 320 |
| 74 | iso_pu_bacteria | 2824763712 | 2824766233 | 320 |
| 75 | iso_pu_bacteria | 2824773399 | 2824774246 | 320 |
| 76 | iso_pu_bacteria | 2838122688 | 2838127583 | 320 |
| 77 | iso_pu_bacteria | 2841941048 | 2841941466 | 320 |
| 78 | iso_pu_bacteria | 2841949485 | 2841952523 | 320 |
| 79 | iso_pu_bacteria | 2841957949 | 2841959541 | 320 |
| 80 | iso_pu_bacteria | 2841966195 | 2841967607 | 320 |
| 81 | iso_pu_bacteria | 2841974524 | 2841979002 | 320 |
| 82 | iso_pu_bacteria | 2841983080 | 2841986544 | 320 |
| 83 | iso_pu_bacteria | 2842038055 | 2842038312 | 320 |
| 84 | iso_pu_bacteria | 2842045827 | 2842048743 | 320 |
| 85 | iso_pu_bacteria | 2844315083 | 2844317784 | 320 |
| 86 | iso_pu_bacteria | 2847930680 | 2847934570 | 320 |
| 87 | iso_pu_bacteria | 2849076700 | 2849080637 | 320 |
| 88 | iso_pu_bacteria | 2857524615 | 2857528764 | 320 |
| 89 | iso_pu_bacteria | 2874604998 | 2874610705 | 320 |
| 90 | iso_pu_bacteria | 2874612657 | 2874618271 | 320 |
| 91 | iso_pu_bacteria | 2874620515 | 2874623261 | 320 |
| 92 | iso_pu_bacteria | 2874628541 | 2874635961 | 320 |
| 93 | iso_pu_bacteria | 2874645413 | 2874653052 | 320 |
| 94 | iso_pu_bacteria | 2876761206 | 2876766642 | 320 |
| 95 | iso_pu_bacteria | 2876808645 | 2876811733 | 320 |
| 96 | iso_pu_bacteria | 2879083081 | 2879089758 | 320 |
| 97 | iso_pu_bacteria | 2879099564 | 2879104036 | 320 |
| 98 | iso_pu_bacteria | 2879110137 | 2879118784 | 320 |
| 99 | iso_pu_bacteria | 2879127579 | 2879130860 | 320 |
| 100 | iso_pu_bacteria | 2879142872 | 2879147550 | 320 |
| 101 | iso_pu_bacteria | 2881665667 | 2881671818 | 320 |
| 102 | iso_pu_bacteria | 2885374607 | 2885376270 | 320 |
| 103 | iso_pu_bacteria | 2885383462 | 2885388003 | 320 |
| 104 | iso_pu_bacteria | 2885409591 | 2885411795 | 320 |
| 105 | iso_pu_bacteria | 2888378607 | 2888382519 | 320 |
| 106 | iso_pu_bacteria | 2888388044 | 2888388179 | 320 |
| 107 | iso_pu_bacteria | 2888419890 | 2888423096 | 320 |
| 108 | iso_pu_bacteria | 2903727486 | 2903735462 | 320 |
| 109 | iso_pu_bacteria | 2903748898 | 2903755952 | 320 |
| 110 | iso_pu_bacteria | 2903768456 | 2903775947 | 320 |
| 111 | iso_pu_bacteria | 2904666416 | 2904670081 | 320 |
| 112 | iso_pu_bacteria | 2904690495 | 2904691557 | 320 |
| 113 | iso_pu_bacteria | 2904699407 | 2904705055 | 320 |
| 114 | iso_pu_bacteria | 2904711408 | 2904718415 | 320 |
| 115 | iso_pu_bacteria | 2906602504 | 2906607536 | 320 |
| 116 | iso_pu_bacteria | 2906626472 | 2906634935 | 320 |
| 117 | iso_pu_bacteria | 2906635258 | 2906641233 | 320 |
| 118 | iso_pu_bacteria | 2906643746 | 2906648971 | 320 |
| 119 | iso_pu_bacteria | 2906660503 | 2906665163 | 320 |
| 120 | iso_pu_bacteria | 2908739725 | 2908744194 | 320 |
| 121 | iso_pu_bacteria | 2908756301 | 2908761632 | 320 |
| 122 | iso_pu_bacteria | 2908775508 | 2908778760 | 320 |
| 123 | iso_pu_bacteria | 2919073203 | 2919079192 | 320 |
| 124 | iso_pu_bacteria | 2922361189 | 2922362133 | 320 |
| 125 | iso_pu_bacteria | 2922368715 | 2922375439 | 320 |
| 126 | iso_pu_bacteria | 2922386360 | 2922388103 | 320 |
| 127 | iso_pu_bacteria | 2922393267 | 2922395036 | 320 |
| 128 | iso_pu_bacteria | 2929615660 | 2929616176 | 320 |
| 129 | iso_pu_bacteria | 2929624759 | 2929624920 | 320 |
| 130 | iso_pu_bacteria | 2932784394 | 2932787159 | 320 |
| 131 | iso_pu_bacteria | 2932809354 | 2932811352 | 320 |
| 132 | iso_pu_bacteria | 2932818245 | 2932819775 | 320 |
| 133 | iso_pu_bacteria | 2932828146 | 2932835776 | 320 |
| 134 | iso_pu_bacteria | 2933577622 | 2933578540 | 320 |
| 135 | iso_pu_bacteria | 2935608549 | 2935611124 | 320 |
| 136 | iso_pu_bacteria | 2935616580 | 2935618961 | 320 |
| 137 | iso_pu_bacteria | 2935630451 | 2935634624 | 320 |
| 138 | iso_pu_bacteria | 2935638405 | 2935643222 | 320 |
| 139 | iso_pu_bacteria | 2935665750 | 2935669848 | 320 |
| 140 | iso_pu_bacteria | 2935675223 | 2935677011 | 320 |
| 141 | iso_pu_bacteria | 2935684952 | 2935693052 | 320 |
| 142 | iso_pu_bacteria | 2935703347 | 2935709433 | 320 |
| 143 | iso_pu_bacteria | 2935713505 | 2935719660 | 320 |
| 144 | iso_pu_bacteria | 2935722832 | 2935729573 | 320 |
| 145 | iso_pu_bacteria | 2935732158 | 2935739543 | 320 |
| 146 | iso_pu_bacteria | 2935741537 | 2935748581 | 320 |
| 147 | iso_pu_bacteria | 2935750917 | 2935756832 | 320 |
| 148 | iso_pu_bacteria | 2935760218 | 2935761180 | 320 |
| 149 | iso_pu_bacteria | 2935777560 | 2935779214 | 320 |
| 150 | iso_pu_bacteria | 2935801545 | 2935807365 | 320 |
| 151 | iso_pu_bacteria | 2935810662 | 2935812505 | 320 |
| 152 | iso_pu_bacteria | 2935819856 | 2935820609 | 320 |
| 153 | iso_pu_bacteria | 2935827899 | 2935832634 | 320 |
| 154 | iso_pu_bacteria | 2935837841 | 2935839287 | 320 |
| 155 | iso_pu_bacteria | 2935847175 | 2935849382 | 320 |
| 156 | iso_pu_bacteria | 2935855204 | 2935857326 | 320 |
| 157 | iso_pu_bacteria | 2935864058 | 2935864855 | 320 |
| 158 | iso_pu_bacteria | 2935873716 | 2935876633 | 320 |
| 159 | iso_pu_bacteria | 2935883170 | 2935885022 | 320 |
| 160 | iso_pu_bacteria | 2935908558 | 2935911843 | 320 |
| 161 | iso_pu_bacteria | 2935916978 | 2935920523 | 320 |
| 162 | iso_pu_bacteria | 2935926038 | 2935928872 | 320 |
| 163 | iso_pu_bacteria | 2935934488 | 2935938517 | 320 |
| 164 | iso_pu_bacteria | 2935942939 | 2935945591 | 320 |
| 165 | iso_pu_bacteria | 2935951376 | 2935954802 | 320 |
| 166 | iso_pu_bacteria | 2935959822 | 2935963401 | 320 |
| 167 | iso_pu_bacteria | 2935967501 | 2935970689 | 320 |
| 168 | iso_pu_bacteria | 2935992306 | 2935999015 | 320 |
| 169 | iso_pu_bacteria | 2936002035 | 2936008227 | 320 |
| 170 | iso_pu_bacteria | 2936037263 | 2936039098 | 320 |
| 171 | iso_pu_bacteria | 2940556831 | 2940562746 | 320 |
| 172 | iso_pu_bacteria | 2941507105 | 2941509110 | 320 |
| 173 | iso_pu_bacteria | 2941515067 | 2941516939 | 320 |
| 174 | iso_pu_bacteria | 2941523033 | 2941524966 | 320 |
| 175 | iso_pu_bacteria | 2941531003 | 2941536421 | 320 |
| 176 | iso_pu_bacteria | 2941538514 | 2941539977 | 320 |
| 177 | iso_pu_bacteria | 3005474847 | 3005478784 | 320 |
| 178 | iso_pu_bacteria | 3005483717 | 3005487983 | 320 |
| 179 | iso_pu_bacteria | 3005506211 | 3005508685 | 320 |
| 180 | iso_pu_bacteria | 3005594810 | 3005597537 | 320 |
| 181 | iso_pu_bacteria | 3005710791 | 3005713559 | 320 |
| 182 | iso_pu_bacteria | 3005718088 | 3005720961 | 320 |
| 183 | iso_pu_bacteria | 8006926726 | 8006926924 | 320 |
| 184 | iso_pu_bacteria | 8006933436 | 8006942561 | 320 |
| 185 | iso_pu_bacteria | 8006964411 | 8006964708 | 320 |
| 186 | iso_pu_bacteria | 8006973647 | 8006982285 | 320 |
| 187 | iso_pu_bacteria | 8006984368 | 8006991940 | 320 |
| 188 | iso_pu_bacteria | 8006994254 | 8006999872 | 320 |
| 189 | iso_pu_bacteria | 8016511872 | 8016515047 | 320 |
| 190 | iso_pu_bacteria | 8016583857 | 8016590901 | 320 |
| 191 | iso_pu_bacteria | 8016603502 | 8016612182 | 320 |
| 192 | iso_pu_bacteria | 8016613128 | 8016621620 | 320 |
| 193 | iso_pu_bacteria | 8016622563 | 8016628340 | 320 |
| 194 | iso_pu_bacteria | 8017057580 | 8017061406 | 320 |
| 195 | iso_pu_bacteria | 8019538911 | 8019543435 | 320 |
| 196 | iso_pu_bacteria | 8019547302 | 8019555419 | 320 |
| 197 | iso_pu_bacteria | 8019576017 | 8019580881 | 320 |
| 198 | iso_pu_bacteria | 8019586578 | 8019588615 | 320 |
| 199 | iso_pu_bacteria | 8019597564 | 8019602720 | 320 |
| 200 | iso_pu_bacteria | 8019608314 | 8019615839 | 320 |
| 201 | iso_pu_bacteria | 8019648815 | 8019656523 | 320 |
| 202 | iso_pu_bacteria | 8019678201 | 8019682808 | 320 |
| 203 | iso_pu_bacteria | 8019687851 | 8019688496 | 320 |
| 204 | iso_pu_bacteria | 8055742211 | 8055747823 | 320 |
| 205 | iso_pu_bacteria | 8056673599 | 8056680290 | 320 |
| 206 | iso_pu_bacteria | 8056681323 | 8056688392 | 320 |
| 207 | iso_pu_bacteria | 8056689827 | 8056695938 | 320 |
| 208 | iso_pu_bacteria | 8056967851 | 8056970029 | 320 |
| 209 | iso_pu_bacteria | 2513237098 | 2513676379 | 321 |
| 210 | 3300021441 | Ga0213871_10009496 | Ga0213871_100094962 | 322 |
| 211 | 3300031616 | Ga0307508_10000532 | Ga0307508_1000053218 | 322 |
| 212 | 3300039438 | Ga0436360_1060898 | Ga0436360_1060898_129_1100 | 322 |
| 213 | 3300039447 | Ga0436361_0152747 | Ga0436361_0152747_561_1532 | 322 |
| 214 | 3300047320 | Ga0495672_0021750 | Ga0495672_0021750_1039_2016 | 322 |
| 215 | 3300005355 | Ga0070671_100152055 | Ga0070671_1001520552 | 323 |
| 216 | 3300005617 | Ga0068859_100293006 | Ga0068859_1002930062 | 323 |
| 217 | 3300005983 | Ga0081540_1025933 | Ga0081540_10259332 | 323 |
| 218 | 3300006931 | Ga0097620_100293006 | Ga0097620_1002930062 | 323 |
| 219 | 3300013105 | Ga0157369_10395679 | Ga0157369_103956792 | 323 |
| 220 | 3300013308 | Ga0157375_10388808 | Ga0157375_103888082 | 323 |
| 221 | 3300025914 | Ga0207671_10156511 | Ga0207671_101565112 | 323 |
| 222 | 3300026035 | Ga0207703_10562422 | Ga0207703_105624222 | 323 |
| 223 | 3300026121 | Ga0207683_10154195 | Ga0207683_101541952 | 323 |
| 224 | 3300028379 | Ga0268266_10014072 | Ga0268266_100140725 | 323 |
| 225 | 3300037466 | Ga0395898_0188863 | Ga0395898_0188863_305_1276 | 323 |
| 226 | 3300038443 | Ga0395901_0152438 | Ga0395901_0152438_940_1911 | 323 |
| 227 | 3300046462 | Ga0495651_0311975 | Ga0495651_0311975_29_1003 | 323 |
| 228 | 3300046557 | Ga0495622_0068564 | Ga0495622_0068564_22_996 | 323 |
| 229 | 3300048920 | Ga0496117_0083558 | Ga0496117_0083558_282_1280 | 323 |
| 230 | 3300048921 | Ga0496118_0021551 | Ga0496118_0021551_3524_4522 | 323 |
| 231 | 3300048924 | Ga0496121_0001443 | Ga0496121_0001443_24013_25011 | 323 |
| 232 | 3300048927 | Ga0496124_0002203 | Ga0496124_0002203_463_1461 | 323 |
| 233 | 3300048927 | Ga0496124_0249313 | Ga0496124_0249313_149_1123 | 323 |
| 234 | 3300048928 | Ga0496125_0000092 | Ga0496125_0000092_138738_139712 | 323 |
| 235 | 3300048929 | Ga0496126_0006684 | Ga0496126_0006684_3354_4352 | 323 |
| 236 | 3300053094 | Ga0500566_0004708 | Ga0500566_0004708_596_1570 | 323 |
| 237 | 3300053096 | Ga0500641_0009503 | Ga0500641_0009503_1305_2276 | 323 |
| 238 | 3300053121 | Ga0500607_036478 | Ga0500607_036478_850_1824 | 323 |
| 239 | 3300053122 | Ga0500608_001404 | Ga0500608_001404_2080_3054 | 323 |
| 240 | 3300053125 | Ga0500618_012076 | Ga0500618_012076_921_1895 | 323 |
| 241 | 3300053142 | Ga0500577_0001147 | Ga0500577_0001147_2371_3345 | 323 |
| 242 | 3300053145 | Ga0500586_001242 | Ga0500586_001242_80_1054 | 323 |
| 243 | 3300053177 | Ga0500636_0006371 | Ga0500636_0006371_5213_6187 | 323 |
| 244 | 3300003215 | JGI25153J46596_10006992 | JGI25153J46596_100069926 | 324 |
| 245 | 3300003215 | JGI25153J46596_10013502 | JGI25153J46596_100135023 | 324 |
| 246 | 3300003215 | JGI25153J46596_10028198 | JGI25153J46596_100281982 | 324 |
| 247 | 3300003354 | JGI25160J50197_1003053 | JGI25160J50197_10030532 | 324 |
| 248 | 3300003354 | JGI25160J50197_1006569 | JGI25160J50197_10065693 | 324 |
| 249 | 3300003354 | JGI25160J50197_1008476 | JGI25160J50197_10084763 | 324 |
| 250 | 3300003794 | Ga0055531_10002184 | Ga0055531_100021844 | 324 |
| 251 | 3300004625 | Ga0055543_1002709 | Ga0055543_10027092 | 324 |
| 252 | 3300004625 | Ga0055543_1019394 | Ga0055543_10193941 | 324 |
| 253 | 3300005262 | Ga0065165_1002008 | Ga0065165_10020085 | 324 |
| 254 | 3300005262 | Ga0065165_1003321 | Ga0065165_10033214 | 324 |
| 255 | 3300005262 | Ga0065165_1019182 | Ga0065165_10191823 | 324 |
| 256 | 3300005329 | Ga0070683_100104782 | Ga0070683_1001047823 | 324 |
| 257 | 3300005341 | Ga0070691_10136730 | Ga0070691_101367301 | 324 |
| 258 | 3300005355 | Ga0070671_100040085 | Ga0070671_1000400852 | 324 |
| 259 | 3300005355 | Ga0070671_100397954 | Ga0070671_1003979541 | 324 |
| 260 | 3300005356 | Ga0070674_100026876 | Ga0070674_1000268763 | 324 |
| 261 | 3300005366 | Ga0070659_100118374 | Ga0070659_1001183742 | 324 |
| 262 | 3300005366 | Ga0070659_100136260 | Ga0070659_1001362602 | 324 |
| 263 | 3300005366 | Ga0070659_100176911 | Ga0070659_1001769111 | 324 |
| 264 | 3300005435 | Ga0070714_100072130 | Ga0070714_1000721302 | 324 |
| 265 | 3300005436 | Ga0070713_100027904 | Ga0070713_1000279043 | 324 |
| 266 | 3300005439 | Ga0070711_100061847 | Ga0070711_1000618472 | 324 |
| 267 | 3300005439 | Ga0070711_100170657 | Ga0070711_1001706572 | 324 |
| 268 | 3300005455 | Ga0070663_100059606 | Ga0070663_1000596063 | 324 |
| 269 | 3300005455 | Ga0070663_100117828 | Ga0070663_1001178282 | 324 |
| 270 | 3300005456 | Ga0070678_100063017 | Ga0070678_1000630173 | 324 |
| 271 | 3300005458 | Ga0070681_10207592 | Ga0070681_102075922 | 324 |
| 272 | 3300005459 | Ga0068867_100335067 | Ga0068867_1003350671 | 324 |
| 273 | 3300005518 | Ga0070699_100289351 | Ga0070699_1002893512 | 324 |
| 274 | 3300005535 | Ga0070684_100210520 | Ga0070684_1002105202 | 324 |
| 275 | 3300005539 | Ga0068853_100032760 | Ga0068853_1000327605 | 324 |
| 276 | 3300005539 | Ga0068853_100080791 | Ga0068853_1000807913 | 324 |
| 277 | 3300005539 | Ga0068853_100432525 | Ga0068853_1004325251 | 324 |
| 278 | 3300005543 | Ga0070672_100303163 | Ga0070672_1003031632 | 324 |
| 279 | 3300005548 | Ga0070665_100091247 | Ga0070665_1000912472 | 324 |
| 280 | 3300005548 | Ga0070665_100164440 | Ga0070665_1001644403 | 324 |
| 281 | 3300005548 | Ga0070665_100176989 | Ga0070665_1001769892 | 324 |
| 282 | 3300005548 | Ga0070665_100262055 | Ga0070665_1002620552 | 324 |
| 283 | 3300005563 | Ga0068855_100029681 | Ga0068855_1000296815 | 324 |
| 284 | 3300005563 | Ga0068855_100272316 | Ga0068855_1002723161 | 324 |
| 285 | 3300005577 | Ga0068857_100034794 | Ga0068857_1000347946 | 324 |
| 286 | 3300005578 | Ga0068854_100033432 | Ga0068854_1000334322 | 324 |
| 287 | 3300005578 | Ga0068854_100311938 | Ga0068854_1003119382 | 324 |
| 288 | 3300005614 | Ga0068856_100059957 | Ga0068856_1000599572 | 324 |
| 289 | 3300005614 | Ga0068856_100151937 | Ga0068856_1001519371 | 324 |
| 290 | 3300005614 | Ga0068856_100172852 | Ga0068856_1001728522 | 324 |
| 291 | 3300005614 | Ga0068856_100316529 | Ga0068856_1003165292 | 324 |
| 292 | 3300005614 | Ga0068856_100426575 | Ga0068856_1004265752 | 324 |
| 293 | 3300005616 | Ga0068852_100127562 | Ga0068852_1001275622 | 324 |
| 294 | 3300005616 | Ga0068852_100140619 | Ga0068852_1001406193 | 324 |
| 295 | 3300005616 | Ga0068852_100210129 | Ga0068852_1002101292 | 324 |
| 296 | 3300005616 | Ga0068852_100462671 | Ga0068852_1004626712 | 324 |
| 297 | 3300005618 | Ga0068864_100041362 | Ga0068864_1000413622 | 324 |
| 298 | 3300005719 | Ga0068861_100028438 | Ga0068861_1000284384 | 324 |
| 299 | 3300005719 | Ga0068861_100058215 | Ga0068861_1000582153 | 324 |
| 300 | 3300005834 | Ga0068851_10086843 | Ga0068851_100868432 | 324 |
| 301 | 3300005834 | Ga0068851_10090151 | Ga0068851_100901512 | 324 |
| 302 | 3300005841 | Ga0068863_100455261 | Ga0068863_1004552612 | 324 |
| 303 | 3300005841 | Ga0068863_100468613 | Ga0068863_1004686131 | 324 |
| 304 | 3300005842 | Ga0068858_100015486 | Ga0068858_1000154864 | 324 |
| 305 | 3300005843 | Ga0068860_100063240 | Ga0068860_1000632404 | 324 |
| 306 | 3300005843 | Ga0068860_100405025 | Ga0068860_1004050252 | 324 |
| 307 | 3300005844 | Ga0068862_100080802 | Ga0068862_1000808023 | 324 |
| 308 | 3300005844 | Ga0068862_100147298 | Ga0068862_1001472983 | 324 |
| 309 | 3300005844 | Ga0068862_100169042 | Ga0068862_1001690422 | 324 |
| 310 | 3300005937 | Ga0081455_10007549 | Ga0081455_100075496 | 324 |
| 311 | 3300005983 | Ga0081540_1001498 | Ga0081540_100149815 | 324 |
| 312 | 3300005983 | Ga0081540_1007278 | Ga0081540_10072787 | 324 |
| 313 | 3300005983 | Ga0081540_1010330 | Ga0081540_10103305 | 324 |
| 314 | 3300005983 | Ga0081540_1011806 | Ga0081540_10118067 | 324 |
| 315 | 3300005983 | Ga0081540_1061880 | Ga0081540_10618802 | 324 |
| 316 | 3300005983 | Ga0081540_1095883 | Ga0081540_10958832 | 324 |
| 317 | 3300005985 | Ga0081539_10000726 | Ga0081539_1000072635 | 324 |
| 318 | 3300005985 | Ga0081539_10039521 | Ga0081539_100395211 | 324 |
| 319 | 3300005985 | Ga0081539_10088789 | Ga0081539_100887892 | 324 |
| 320 | 3300006038 | Ga0075365_10053901 | Ga0075365_100539012 | 324 |
| 321 | 3300006038 | Ga0075365_10116928 | Ga0075365_101169282 | 324 |
| 322 | 3300006038 | Ga0075365_10176280 | Ga0075365_101762802 | 324 |
| 323 | 3300006042 | Ga0075368_10041526 | Ga0075368_100415262 | 324 |
| 324 | 3300006048 | Ga0075363_100094919 | Ga0075363_1000949192 | 324 |
| 325 | 3300006051 | Ga0075364_10024769 | Ga0075364_100247694 | 324 |
| 326 | 3300006175 | Ga0070712_100048762 | Ga0070712_1000487622 | 324 |
| 327 | 3300006178 | Ga0075367_10002487 | Ga0075367_100024876 | 324 |
| 328 | 3300006178 | Ga0075367_10034297 | Ga0075367_100342972 | 324 |
| 329 | 3300006178 | Ga0075367_10112461 | Ga0075367_101124612 | 324 |
| 330 | 3300006237 | Ga0097621_100029785 | Ga0097621_1000297853 | 324 |
| 331 | 3300006237 | Ga0097621_100111716 | Ga0097621_1001117163 | 324 |
| 332 | 3300006358 | Ga0068871_100101694 | Ga0068871_1001016941 | 324 |
| 333 | 3300006844 | Ga0075428_100227353 | Ga0075428_1002273532 | 324 |
| 334 | 3300006871 | Ga0075434_100113763 | Ga0075434_1001137632 | 324 |
| 335 | 3300006881 | Ga0068865_100167336 | Ga0068865_1001673361 | 324 |
| 336 | 3300006881 | Ga0068865_100221467 | Ga0068865_1002214672 | 324 |
| 337 | 3300006942 | Ga0099824_1013588 | Ga0099824_10135887 | 324 |
| 338 | 3300006942 | Ga0099824_1032175 | Ga0099824_10321752 | 324 |
| 339 | 3300006944 | Ga0099823_1048446 | Ga0099823_10484463 | 324 |
| 340 | 3300007076 | Ga0075435_100115090 | Ga0075435_1001150902 | 324 |
| 341 | 3300009093 | Ga0105240_10010641 | Ga0105240_100106415 | 324 |
| 342 | 3300009093 | Ga0105240_10345344 | Ga0105240_103453442 | 324 |
| 343 | 3300009093 | Ga0105240_10501239 | Ga0105240_105012392 | 324 |
| 344 | 3300009094 | Ga0111539_10121045 | Ga0111539_101210452 | 324 |
| 345 | 3300009098 | Ga0105245_10068511 | Ga0105245_100685111 | 324 |
| 346 | 3300009098 | Ga0105245_10118252 | Ga0105245_101182523 | 324 |
| 347 | 3300009147 | Ga0114129_10101918 | Ga0114129_101019183 | 324 |
| 348 | 3300009148 | Ga0105243_10025134 | Ga0105243_100251343 | 324 |
| 349 | 3300009148 | Ga0105243_10209828 | Ga0105243_102098282 | 324 |
| 350 | 3300009148 | Ga0105243_10395159 | Ga0105243_103951591 | 324 |
| 351 | 3300009174 | Ga0105241_10059471 | Ga0105241_100594712 | 324 |
| 352 | 3300009174 | Ga0105241_10201831 | Ga0105241_102018312 | 324 |
| 353 | 3300009174 | Ga0105241_10313071 | Ga0105241_103130712 | 324 |
| 354 | 3300009174 | Ga0105241_10318435 | Ga0105241_103184352 | 324 |
| 355 | 3300009177 | Ga0105248_10065648 | Ga0105248_100656482 | 324 |
| 356 | 3300009177 | Ga0105248_10186777 | Ga0105248_101867773 | 324 |
| 357 | 3300009177 | Ga0105248_10265965 | Ga0105248_102659652 | 324 |
| 358 | 3300009177 | Ga0105248_10351505 | Ga0105248_103515051 | 324 |
| 359 | 3300009545 | Ga0105237_10004145 | Ga0105237_100041456 | 324 |
| 360 | 3300009545 | Ga0105237_10024695 | Ga0105237_100246955 | 324 |
| 361 | 3300009545 | Ga0105237_10070302 | Ga0105237_100703023 | 324 |
| 362 | 3300009545 | Ga0105237_10152706 | Ga0105237_101527062 | 324 |
| 363 | 3300009545 | Ga0105237_10263430 | Ga0105237_102634302 | 324 |
| 364 | 3300009551 | Ga0105238_10080027 | Ga0105238_100800272 | 324 |
| 365 | 3300010159 | Ga0099796_10012659 | Ga0099796_100126591 | 324 |
| 366 | 3300010375 | Ga0105239_10046661 | Ga0105239_100466616 | 324 |
| 367 | 3300010375 | Ga0105239_10060893 | Ga0105239_100608934 | 324 |
| 368 | 3300010375 | Ga0105239_10062712 | Ga0105239_100627124 | 324 |
| 369 | 3300010375 | Ga0105239_10083618 | Ga0105239_100836181 | 324 |
| 370 | 3300010375 | Ga0105239_10151918 | Ga0105239_101519182 | 324 |
| 371 | 3300010375 | Ga0105239_10347772 | Ga0105239_103477722 | 324 |
| 372 | 3300011119 | Ga0105246_10010071 | Ga0105246_100100712 | 324 |
| 373 | 3300013104 | Ga0157370_10079560 | Ga0157370_100795604 | 324 |
| 374 | 3300013296 | Ga0157374_10011421 | Ga0157374_100114213 | 324 |
| 375 | 3300013296 | Ga0157374_10079256 | Ga0157374_100792562 | 324 |
| 376 | 3300013297 | Ga0157378_10183677 | Ga0157378_101836772 | 324 |
| 377 | 3300013306 | Ga0163162_10094550 | Ga0163162_100945501 | 324 |
| 378 | 3300013306 | Ga0163162_10280498 | Ga0163162_102804982 | 324 |
| 379 | 3300013308 | Ga0157375_10148274 | Ga0157375_101482743 | 324 |
| 380 | 3300014325 | Ga0163163_10059377 | Ga0163163_100593772 | 324 |
| 381 | 3300014325 | Ga0163163_10420762 | Ga0163163_104207622 | 324 |
| 382 | 3300014968 | Ga0157379_10016120 | Ga0157379_100161202 | 324 |
| 383 | 3300014968 | Ga0157379_10043659 | Ga0157379_100436592 | 324 |
| 384 | 3300014969 | Ga0157376_10347825 | Ga0157376_103478252 | 324 |
| 385 | 3300021320 | Ga0214544_1000006 | Ga0214544_1000006360 | 324 |
| 386 | 3300021321 | Ga0214542_1000002 | Ga0214542_100000214 | 324 |
| 387 | 3300021324 | Ga0214545_1000002 | Ga0214545_1000002705 | 324 |
| 388 | 3300021327 | Ga0214543_1000017 | Ga0214543_1000017308 | 324 |
| 389 | 3300025230 | Ga0209563_101461 | Ga0209563_1014612 | 324 |
| 390 | 3300025253 | Ga0209677_108682 | Ga0209677_1086822 | 324 |
| 391 | 3300025254 | Ga0209148_1000447 | Ga0209148_100044724 | 324 |
| 392 | 3300025295 | Ga0209564_1003910 | Ga0209564_10039109 | 324 |
| 393 | 3300025297 | Ga0209758_1000065 | Ga0209758_100006575 | 324 |
| 394 | 3300025297 | Ga0209758_1002429 | Ga0209758_10024299 | 324 |
| 395 | 3300025297 | Ga0209758_1003622 | Ga0209758_10036224 | 324 |
| 396 | 3300025297 | Ga0209758_1025282 | Ga0209758_10252823 | 324 |
| 397 | 3300025297 | Ga0209758_1025863 | Ga0209758_10258632 | 324 |
| 398 | 3300025299 | Ga0209256_1011253 | Ga0209256_10112534 | 324 |
| 399 | 3300025299 | Ga0209256_1021691 | Ga0209256_10216912 | 324 |
| 400 | 3300025302 | Ga0207426_1000554 | Ga0207426_100055411 | 324 |
| 401 | 3300025302 | Ga0207426_1000561 | Ga0207426_100056128 | 324 |
| 402 | 3300025302 | Ga0207426_1002946 | Ga0207426_10029464 | 324 |
| 403 | 3300025304 | Ga0209257_1000833 | Ga0209257_10008337 | 324 |
| 404 | 3300025304 | Ga0209257_1031441 | Ga0209257_10314412 | 324 |
| 405 | 3300025321 | Ga0207656_10066356 | Ga0207656_100663562 | 324 |
| 406 | 3300025901 | Ga0207688_10006431 | Ga0207688_100064314 | 324 |
| 407 | 3300025901 | Ga0207688_10019196 | Ga0207688_100191964 | 324 |
| 408 | 3300025904 | Ga0207647_10089740 | Ga0207647_100897402 | 324 |
| 409 | 3300025909 | Ga0207705_10304071 | Ga0207705_103040712 | 324 |
| 410 | 3300025911 | Ga0207654_10000803 | Ga0207654_1000080316 | 324 |
| 411 | 3300025911 | Ga0207654_10002540 | Ga0207654_100025406 | 324 |
| 412 | 3300025912 | Ga0207707_10165102 | Ga0207707_101651022 | 324 |
| 413 | 3300025913 | Ga0207695_10000029 | Ga0207695_1000002937 | 324 |
| 414 | 3300025913 | Ga0207695_10001543 | Ga0207695_1000154310 | 324 |
| 415 | 3300025914 | Ga0207671_10018788 | Ga0207671_100187884 | 324 |
| 416 | 3300025915 | Ga0207693_10255227 | Ga0207693_102552272 | 324 |
| 417 | 3300025916 | Ga0207663_10129358 | Ga0207663_101293582 | 324 |
| 418 | 3300025919 | Ga0207657_10009798 | Ga0207657_100097981 | 324 |
| 419 | 3300025924 | Ga0207694_10232227 | Ga0207694_102322271 | 324 |
| 420 | 3300025925 | Ga0207650_10061111 | Ga0207650_100611113 | 324 |
| 421 | 3300025926 | Ga0207659_10206460 | Ga0207659_102064601 | 324 |
| 422 | 3300025927 | Ga0207687_10013194 | Ga0207687_100131944 | 324 |
| 423 | 3300025927 | Ga0207687_10168295 | Ga0207687_101682951 | 324 |
| 424 | 3300025928 | Ga0207700_10042530 | Ga0207700_100425304 | 324 |
| 425 | 3300025928 | Ga0207700_10154985 | Ga0207700_101549852 | 324 |
| 426 | 3300025929 | Ga0207664_10301067 | Ga0207664_103010672 | 324 |
| 427 | 3300025932 | Ga0207690_10107884 | Ga0207690_101078843 | 324 |
| 428 | 3300025933 | Ga0207706_10099577 | Ga0207706_100995773 | 324 |
| 429 | 3300025933 | Ga0207706_10136104 | Ga0207706_101361042 | 324 |
| 430 | 3300025933 | Ga0207706_10345983 | Ga0207706_103459832 | 324 |
| 431 | 3300025935 | Ga0207709_10012963 | Ga0207709_100129633 | 324 |
| 432 | 3300025937 | Ga0207669_10040409 | Ga0207669_100404093 | 324 |
| 433 | 3300025937 | Ga0207669_10062176 | Ga0207669_100621763 | 324 |
| 434 | 3300025938 | Ga0207704_10095030 | Ga0207704_100950302 | 324 |
| 435 | 3300025940 | Ga0207691_10081307 | Ga0207691_100813073 | 324 |
| 436 | 3300025940 | Ga0207691_10139582 | Ga0207691_101395823 | 324 |
| 437 | 3300025942 | Ga0207689_10010305 | Ga0207689_100103053 | 324 |
| 438 | 3300025942 | Ga0207689_10062250 | Ga0207689_100622502 | 324 |
| 439 | 3300025949 | Ga0207667_10007604 | Ga0207667_1000760415 | 324 |
| 440 | 3300025949 | Ga0207667_10018352 | Ga0207667_100183522 | 324 |
| 441 | 3300025949 | Ga0207667_10296277 | Ga0207667_102962772 | 324 |
| 442 | 3300025961 | Ga0207712_10026160 | Ga0207712_100261604 | 324 |
| 443 | 3300025972 | Ga0207668_10062476 | Ga0207668_100624763 | 324 |
| 444 | 3300025986 | Ga0207658_10242860 | Ga0207658_102428601 | 324 |
| 445 | 3300026035 | Ga0207703_10282370 | Ga0207703_102823702 | 324 |
| 446 | 3300026041 | Ga0207639_10028861 | Ga0207639_100288613 | 324 |
| 447 | 3300026067 | Ga0207678_10025273 | Ga0207678_100252736 | 324 |
| 448 | 3300026067 | Ga0207678_10052363 | Ga0207678_100523633 | 324 |
| 449 | 3300026067 | Ga0207678_10061520 | Ga0207678_100615202 | 324 |
| 450 | 3300026067 | Ga0207678_10069743 | Ga0207678_100697431 | 324 |
| 451 | 3300026067 | Ga0207678_10074580 | Ga0207678_100745803 | 324 |
| 452 | 3300026067 | Ga0207678_10087953 | Ga0207678_100879531 | 324 |
| 453 | 3300026067 | Ga0207678_10096275 | Ga0207678_100962752 | 324 |
| 454 | 3300026067 | Ga0207678_10151195 | Ga0207678_101511951 | 324 |
| 455 | 3300026078 | Ga0207702_10000005 | Ga0207702_10000005294 | 324 |
| 456 | 3300026078 | Ga0207702_10000081 | Ga0207702_10000081112 | 324 |
| 457 | 3300026078 | Ga0207702_10255519 | Ga0207702_102555192 | 324 |
| 458 | 3300026078 | Ga0207702_10601286 | Ga0207702_106012861 | 324 |
| 459 | 3300026088 | Ga0207641_10442313 | Ga0207641_104423131 | 324 |
| 460 | 3300026089 | Ga0207648_10135637 | Ga0207648_101356371 | 324 |
| 461 | 3300026095 | Ga0207676_10405879 | Ga0207676_104058792 | 324 |
| 462 | 3300026116 | Ga0207674_10043098 | Ga0207674_100430986 | 324 |
| 463 | 3300026118 | Ga0207675_100011579 | Ga0207675_1000115793 | 324 |
| 464 | 3300026118 | Ga0207675_100033023 | Ga0207675_1000330235 | 324 |
| 465 | 3300026121 | Ga0207683_10072768 | Ga0207683_100727683 | 324 |
| 466 | 3300026121 | Ga0207683_10106285 | Ga0207683_101062853 | 324 |
| 467 | 3300026121 | Ga0207683_10116567 | Ga0207683_101165672 | 324 |
| 468 | 3300026121 | Ga0207683_10327657 | Ga0207683_103276571 | 324 |
| 469 | 3300026142 | Ga0207698_10062290 | Ga0207698_100622903 | 324 |
| 470 | 3300026142 | Ga0207698_10077585 | Ga0207698_100775853 | 324 |
| 471 | 3300026142 | Ga0207698_10286857 | Ga0207698_102868572 | 324 |
| 472 | 3300027296 | Ga0209389_1000011 | Ga0209389_10000111 | 324 |
| 473 | 3300027296 | Ga0209389_1000025 | Ga0209389_100002556 | 324 |
| 474 | 3300027357 | Ga0209589_1000009 | Ga0209589_1000009248 | 324 |
| 475 | 3300027357 | Ga0209589_1000066 | Ga0209589_10000665 | 324 |
| 476 | 3300027361 | Ga0209489_100010 | Ga0209489_10001022 | 324 |
| 477 | 3300027361 | Ga0209489_100017 | Ga0209489_100017233 | 324 |
| 478 | 3300027361 | Ga0209489_100030 | Ga0209489_100030107 | 324 |
| 479 | 3300027363 | Ga0209700_100017 | Ga0209700_10001722 | 324 |
| 480 | 3300027363 | Ga0209700_100027 | Ga0209700_1000271 | 324 |
| 481 | 3300028379 | Ga0268266_10001147 | Ga0268266_1000114737 | 324 |
| 482 | 3300028379 | Ga0268266_10008591 | Ga0268266_100085912 | 324 |
| 483 | 3300028379 | Ga0268266_10033130 | Ga0268266_100331303 | 324 |
| 484 | 3300028379 | Ga0268266_10066804 | Ga0268266_100668043 | 324 |
| 485 | 3300028379 | Ga0268266_10426890 | Ga0268266_104268901 | 324 |
| 486 | 3300028380 | Ga0268265_10044846 | Ga0268265_100448463 | 324 |
| 487 | 3300028380 | Ga0268265_10082002 | Ga0268265_100820022 | 324 |
| 488 | 3300028380 | Ga0268265_10156508 | Ga0268265_101565083 | 324 |
| 489 | 3300028558 | Ga0265326_10002319 | Ga0265326_100023195 | 324 |
| 490 | 3300028563 | Ga0265319_1001659 | Ga0265319_10016597 | 324 |
| 491 | 3300028573 | Ga0265334_10000799 | Ga0265334_100007996 | 324 |
| 492 | 3300028577 | Ga0265318_10010755 | Ga0265318_100107553 | 324 |
| 493 | 3300028653 | Ga0265323_10003079 | Ga0265323_100030795 | 324 |
| 494 | 3300028654 | Ga0265322_10002933 | Ga0265322_100029335 | 324 |
| 495 | 3300028666 | Ga0265336_10000233 | Ga0265336_100002336 | 324 |
| 496 | 3300028786 | Ga0307517_10000062 | Ga0307517_1000006234 | 324 |
| 497 | 3300028794 | Ga0307515_10063942 | Ga0307515_100639425 | 324 |
| 498 | 3300028800 | Ga0265338_10000090 | Ga0265338_1000009023 | 324 |
| 499 | 3300029957 | Ga0265324_10006268 | Ga0265324_100062683 | 324 |
| 500 | 3300031235 | Ga0265330_10036948 | Ga0265330_100369482 | 324 |
| 501 | 3300031247 | Ga0265340_10001013 | Ga0265340_100010137 | 324 |
| 502 | 3300031250 | Ga0265331_10100264 | Ga0265331_101002642 | 324 |
| 503 | 3300031507 | Ga0307509_10287354 | Ga0307509_102873542 | 324 |
| 504 | 3300031616 | Ga0307508_10007265 | Ga0307508_100072658 | 324 |
| 505 | 3300031711 | Ga0265314_10043780 | Ga0265314_100437801 | 324 |
| 506 | 3300031712 | Ga0265342_10154022 | Ga0265342_101540222 | 324 |
| 507 | 3300031712 | Ga0265342_10188823 | Ga0265342_101888231 | 324 |
| 508 | 3300031730 | Ga0307516_10012607 | Ga0307516_100126077 | 324 |
| 509 | 3300031730 | Ga0307516_10192637 | Ga0307516_101926372 | 324 |
| 510 | 3300031730 | Ga0307516_10310552 | Ga0307516_103105521 | 324 |
| 511 | 3300031824 | Ga0307413_10279574 | Ga0307413_102795742 | 324 |
| 512 | 3300031911 | Ga0307412_10075388 | Ga0307412_100753882 | 324 |
| 513 | 3300031995 | Ga0307409_100462482 | Ga0307409_1004624821 | 324 |
| 514 | 3300032126 | Ga0307415_100061564 | Ga0307415_1000615642 | 324 |
| 515 | 3300032126 | Ga0307415_100324726 | Ga0307415_1003247262 | 324 |
| 516 | 3300033180 | Ga0307510_10018748 | Ga0307510_100187486 | 324 |
| 517 | 3300033180 | Ga0307510_10075582 | Ga0307510_100755821 | 324 |
| 518 | 3300033442 | Ga0315911_1000009 | Ga0315911_1000009374 | 324 |
| 519 | 3300035084 | Ga0373928_0008426 | Ga0373928_0008426_646_1620 | 324 |
| 520 | 3300035114 | Ga0373939_0031774 | Ga0373939_0031774_243_1217 | 324 |
| 521 | 3300035171 | Ga0373946_0028104 | Ga0373946_0028104_327_1301 | 324 |
| 522 | 3300035695 | Ga0373927_0082643 | Ga0373927_0082643_321_1313 | 324 |
| 523 | 3300035695 | Ga0373927_0237369 | Ga0373927_0237369_93_1067 | 324 |
| 524 | 3300035724 | Ga0373933_0000167 | Ga0373933_0000167_24297_25310 | 324 |
| 525 | 3300035725 | Ga0373947_0108025 | Ga0373947_0108025_124_1098 | 324 |
| 526 | 3300037068 | Ga0373925_0087293 | Ga0373925_0087293_1105_2079 | 324 |
| 527 | 3300037312 | Ga0395899_0034271 | Ga0395899_0034271_2574_3551 | 324 |
| 528 | 3300037418 | Ga0395900_0019057 | Ga0395900_0019057_1593_2570 | 324 |
| 529 | 3300037466 | Ga0395898_0222633 | Ga0395898_0222633_215_1192 | 324 |
| 530 | 3300037471 | Ga0395905_0233194 | Ga0395905_0233194_266_1243 | 324 |
| 531 | 3300037853 | Ga0436364_1156934 | Ga0436364_1156934_22_999 | 324 |
| 532 | 3300038443 | Ga0395901_0034427 | Ga0395901_0034427_3629_4606 | 324 |
| 533 | 3300044656 | Ga0466969_0013180 | Ga0466969_0013180_331_1308 | 324 |
| 534 | 3300044683 | Ga0466965_0056339 | Ga0466965_0056339_767_1744 | 324 |
| 535 | 3300044684 | Ga0466966_0000148 | Ga0466966_0000148_33432_34409 | 324 |
| 536 | 3300044693 | Ga0466961_0000045 | Ga0466961_0000045_64774_65751 | 324 |
| 537 | 3300044706 | Ga0466964_0050790 | Ga0466964_0050790_63_1040 | 324 |
| 538 | 3300044706 | Ga0466964_0060246 | Ga0466964_0060246_580_1557 | 324 |
| 539 | 3300044735 | Ga0466968_0029823 | Ga0466968_0029823_404_1381 | 324 |
| 540 | 3300044765 | Ga0466970_0042331 | Ga0466970_0042331_953_1930 | 324 |
| 541 | 3300044842 | Ga0466957_0129504 | Ga0466957_0129504_78_1055 | 324 |
| 542 | 3300044842 | Ga0466957_0157108 | Ga0466957_0157108_200_1180 | 324 |
| 543 | 3300044901 | Ga0466960_0189599 | Ga0466960_0189599_37_1014 | 324 |
| 544 | 3300045049 | Ga0466959_0003014 | Ga0466959_0003014_820_1797 | 324 |
| 545 | 3300045049 | Ga0466959_0021412 | Ga0466959_0021412_1908_2888 | 324 |
| 546 | 3300046455 | Ga0495603_0018889 | Ga0495603_0018889_1365_2339 | 324 |
| 547 | 3300046455 | Ga0495603_0043688 | Ga0495603_0043688_939_1913 | 324 |
| 548 | 3300046457 | Ga0495590_0015098 | Ga0495590_0015098_370_1344 | 324 |
| 549 | 3300046459 | Ga0495629_0096403 | Ga0495629_0096403_376_1350 | 324 |
| 550 | 3300046460 | Ga0495638_0010390 | Ga0495638_0010390_939_1916 | 324 |
| 551 | 3300046460 | Ga0495638_0020052 | Ga0495638_0020052_2449_3426 | 324 |
| 552 | 3300046460 | Ga0495638_0044353 | Ga0495638_0044353_129_1106 | 324 |
| 553 | 3300046460 | Ga0495638_0129249 | Ga0495638_0129249_345_1319 | 324 |
| 554 | 3300046462 | Ga0495651_0000472 | Ga0495651_0000472_19774_20751 | 324 |
| 555 | 3300046463 | Ga0495653_0039871 | Ga0495653_0039871_672_1649 | 324 |
| 556 | 3300046471 | Ga0495650_0040691 | Ga0495650_0040691_301_1275 | 324 |
| 557 | 3300046472 | Ga0495580_0115154 | Ga0495580_0115154_523_1497 | 324 |
| 558 | 3300046473 | Ga0495582_0120896 | Ga0495582_0120896_469_1443 | 324 |
| 559 | 3300046477 | Ga0495664_0017778 | Ga0495664_0017778_1930_2907 | 324 |
| 560 | 3300046492 | Ga0495585_0065988 | Ga0495585_0065988_394_1368 | 324 |
| 561 | 3300046499 | Ga0495594_0062068 | Ga0495594_0062068_1071_2045 | 324 |
| 562 | 3300046501 | Ga0495607_0067717 | Ga0495607_0067717_430_1407 | 324 |
| 563 | 3300046507 | Ga0495606_0004247 | Ga0495606_0004247_8200_9177 | 324 |
| 564 | 3300046507 | Ga0495606_0005996 | Ga0495606_0005996_6334_7311 | 324 |
| 565 | 3300046507 | Ga0495606_0202546 | Ga0495606_0202546_131_1108 | 324 |
| 566 | 3300046511 | Ga0495608_0018937 | Ga0495608_0018937_1542_2519 | 324 |
| 567 | 3300046512 | Ga0495610_0039561 | Ga0495610_0039561_553_1527 | 324 |
| 568 | 3300046513 | Ga0495616_0100607 | Ga0495616_0100607_225_1202 | 324 |
| 569 | 3300046516 | Ga0495628_0016126 | Ga0495628_0016126_4609_5586 | 324 |
| 570 | 3300046517 | Ga0495630_0136574 | Ga0495630_0136574_105_1082 | 324 |
| 571 | 3300046518 | Ga0495631_0043205 | Ga0495631_0043205_702_1676 | 324 |
| 572 | 3300046522 | Ga0495643_0029296 | Ga0495643_0029296_435_1412 | 324 |
| 573 | 3300046522 | Ga0495643_0047211 | Ga0495643_0047211_490_1464 | 324 |
| 574 | 3300046523 | Ga0495644_0021386 | Ga0495644_0021386_208_1182 | 324 |
| 575 | 3300046524 | Ga0495648_0003979 | Ga0495648_0003979_5676_6653 | 324 |
| 576 | 3300046524 | Ga0495648_0092725 | Ga0495648_0092725_228_1205 | 324 |
| 577 | 3300046525 | Ga0495663_0057358 | Ga0495663_0057358_127_1101 | 324 |
| 578 | 3300046529 | Ga0495652_0001339 | Ga0495652_0001339_20349_21326 | 324 |
| 579 | 3300046536 | Ga0495587_0012944 | Ga0495587_0012944_34_1011 | 324 |
| 580 | 3300046558 | Ga0495633_0135270 | Ga0495633_0135270_56_1030 | 324 |
| 581 | 3300046559 | Ga0495667_0007621 | Ga0495667_0007621_1374_2351 | 324 |
| 582 | 3300046615 | Ga0495656_0001067 | Ga0495656_0001067_979_1953 | 324 |
| 583 | 3300046615 | Ga0495656_0025016 | Ga0495656_0025016_81_1055 | 324 |
| 584 | 3300046616 | Ga0495668_0024598 | Ga0495668_0024598_1892_2869 | 324 |
| 585 | 3300046642 | Ga0495634_0013513 | Ga0495634_0013513_2515_3492 | 324 |
| 586 | 3300046648 | Ga0495611_0010250 | Ga0495611_0010250_1929_2903 | 324 |
| 587 | 3300046660 | Ga0495625_0043231 | Ga0495625_0043231_1861_2838 | 324 |
| 588 | 3300046660 | Ga0495625_0053001 | Ga0495625_0053001_67_1041 | 324 |
| 589 | 3300046674 | Ga0495588_0046912 | Ga0495588_0046912_418_1392 | 324 |
| 590 | 3300046675 | Ga0495657_0005672 | Ga0495657_0005672_4888_5865 | 324 |
| 591 | 3300046678 | Ga0495599_0016375 | Ga0495599_0016375_2475_3452 | 324 |
| 592 | 3300046679 | Ga0495623_0004396 | Ga0495623_0004396_7894_8871 | 324 |
| 593 | 3300046684 | Ga0495669_0024616 | Ga0495669_0024616_369_1343 | 324 |
| 594 | 3300046684 | Ga0495669_0145660 | Ga0495669_0145660_32_1006 | 324 |
| 595 | 3300046689 | Ga0495613_0027045 | Ga0495613_0027045_1473_2450 | 324 |
| 596 | 3300046691 | Ga0495670_0016306 | Ga0495670_0016306_49_1026 | 324 |
| 597 | 3300046692 | Ga0495671_0119520 | Ga0495671_0119520_271_1248 | 324 |
| 598 | 3300046694 | Ga0495649_0050747 | Ga0495649_0050747_314_1291 | 324 |
| 599 | 3300046809 | Ga0495600_0006605 | Ga0495600_0006605_1386_2363 | 324 |
| 600 | 3300047315 | Ga0495581_0108464 | Ga0495581_0108464_542_1516 | 324 |
| 601 | 3300047317 | Ga0495604_0000953 | Ga0495604_0000953_16327_17304 | 324 |
| 602 | 3300047319 | Ga0495674_0008322 | Ga0495674_0008322_2379_3356 | 324 |
| 603 | 3300047320 | Ga0495672_0015872 | Ga0495672_0015872_1758_2732 | 324 |
| 604 | 3300047321 | Ga0495676_0014964 | Ga0495676_0014964_5851_6825 | 324 |
| 605 | 3300047322 | Ga0495680_0001642 | Ga0495680_0001642_16959_17936 | 324 |
| 606 | 3300047443 | Ga0495687_042517 | Ga0495687_042517_634_1611 | 324 |
| 607 | 3300047472 | Ga0495686_0128589 | Ga0495686_0128589_451_1428 | 324 |
| 608 | 3300047472 | Ga0495686_0179108 | Ga0495686_0179108_230_1207 | 324 |
| 609 | 3300047673 | Ga0495593_0041694 | Ga0495593_0041694_336_1313 | 324 |
| 610 | 3300048088 | Ga0495602_0019800 | Ga0495602_0019800_4591_5568 | 324 |
| 611 | 3300048090 | Ga0495615_0039805 | Ga0495615_0039805_51_1025 | 324 |
| 612 | 3300048090 | Ga0495615_0042269 | Ga0495615_0042269_114_1088 | 324 |
| 613 | 3300048090 | Ga0495615_0049047 | Ga0495615_0049047_12_986 | 324 |
| 614 | 3300048903 | Ga0496100_0136209 | Ga0496100_0136209_325_1299 | 324 |
| 615 | 3300048903 | Ga0496100_0150824 | Ga0496100_0150824_102_1079 | 324 |
| 616 | 3300048904 | Ga0496101_0179936 | Ga0496101_0179936_317_1294 | 324 |
| 617 | 3300048904 | Ga0496101_0289218 | Ga0496101_0289218_69_1043 | 324 |
| 618 | 3300048905 | Ga0496102_0009044 | Ga0496102_0009044_6514_7488 | 324 |
| 619 | 3300048905 | Ga0496102_0057494 | Ga0496102_0057494_1099_2073 | 324 |
| 620 | 3300048905 | Ga0496102_0244571 | Ga0496102_0244571_131_1108 | 324 |
| 621 | 3300048905 | Ga0496102_0285540 | Ga0496102_0285540_348_1325 | 324 |
| 622 | 3300048905 | Ga0496102_0316404 | Ga0496102_0316404_82_1056 | 324 |
| 623 | 3300048906 | Ga0496103_0015643 | Ga0496103_0015643_701_1675 | 324 |
| 624 | 3300048906 | Ga0496103_0106108 | Ga0496103_0106108_154_1128 | 324 |
| 625 | 3300048907 | Ga0496104_0004724 | Ga0496104_0004724_6883_7863 | 324 |
| 626 | 3300048907 | Ga0496104_0078088 | Ga0496104_0078088_1868_2842 | 324 |
| 627 | 3300048907 | Ga0496104_0194318 | Ga0496104_0194318_316_1290 | 324 |
| 628 | 3300048907 | Ga0496104_0322309 | Ga0496104_0322309_183_1157 | 324 |
| 629 | 3300048908 | Ga0496105_0011117 | Ga0496105_0011117_5807_6781 | 324 |
| 630 | 3300048909 | Ga0496106_0027320 | Ga0496106_0027320_415_1392 | 324 |
| 631 | 3300048909 | Ga0496106_0046484 | Ga0496106_0046484_2191_3168 | 324 |
| 632 | 3300048909 | Ga0496106_0063950 | Ga0496106_0063950_785_1759 | 324 |
| 633 | 3300048909 | Ga0496106_0129070 | Ga0496106_0129070_225_1199 | 324 |
| 634 | 3300048909 | Ga0496106_0216270 | Ga0496106_0216270_456_1430 | 324 |
| 635 | 3300048909 | Ga0496106_0318787 | Ga0496106_0318787_84_1058 | 324 |
| 636 | 3300048910 | Ga0496107_0065379 | Ga0496107_0065379_383_1357 | 324 |
| 637 | 3300048911 | Ga0496108_0015476 | Ga0496108_0015476_2054_3028 | 324 |
| 638 | 3300048911 | Ga0496108_0138255 | Ga0496108_0138255_353_1330 | 324 |
| 639 | 3300048912 | Ga0496109_0020502 | Ga0496109_0020502_93_1067 | 324 |
| 640 | 3300048912 | Ga0496109_0112483 | Ga0496109_0112483_792_1766 | 324 |
| 641 | 3300048913 | Ga0496110_0074209 | Ga0496110_0074209_1632_2606 | 324 |
| 642 | 3300048914 | Ga0496111_0091246 | Ga0496111_0091246_871_1845 | 324 |
| 643 | 3300048914 | Ga0496111_0296162 | Ga0496111_0296162_42_1016 | 324 |
| 644 | 3300048915 | Ga0496112_0004323 | Ga0496112_0004323_3712_4689 | 324 |
| 645 | 3300048915 | Ga0496112_0127333 | Ga0496112_0127333_800_1774 | 324 |
| 646 | 3300048915 | Ga0496112_0214242 | Ga0496112_0214242_639_1616 | 324 |
| 647 | 3300048916 | Ga0496113_0028782 | Ga0496113_0028782_2256_3230 | 324 |
| 648 | 3300048916 | Ga0496113_0063686 | Ga0496113_0063686_1501_2478 | 324 |
| 649 | 3300048917 | Ga0496114_0031614 | Ga0496114_0031614_3291_4265 | 324 |
| 650 | 3300048917 | Ga0496114_0187808 | Ga0496114_0187808_74_1051 | 324 |
| 651 | 3300048917 | Ga0496114_0221690 | Ga0496114_0221690_640_1614 | 324 |
| 652 | 3300048918 | Ga0496115_0011656 | Ga0496115_0011656_39_1013 | 324 |
| 653 | 3300048918 | Ga0496115_0057194 | Ga0496115_0057194_1407_2381 | 324 |
| 654 | 3300048918 | Ga0496115_0063037 | Ga0496115_0063037_1920_2894 | 324 |
| 655 | 3300048918 | Ga0496115_0067141 | Ga0496115_0067141_539_1513 | 324 |
| 656 | 3300048918 | Ga0496115_0129053 | Ga0496115_0129053_936_1910 | 324 |
| 657 | 3300048920 | Ga0496117_0077577 | Ga0496117_0077577_526_1503 | 324 |
| 658 | 3300048921 | Ga0496118_0046349 | Ga0496118_0046349_1875_2852 | 324 |
| 659 | 3300048923 | Ga0496120_0166747 | Ga0496120_0166747_51_1028 | 324 |
| 660 | 3300048924 | Ga0496121_0001527 | Ga0496121_0001527_20251_21228 | 324 |
| 661 | 3300048924 | Ga0496121_0006578 | Ga0496121_0006578_7836_8813 | 324 |
| 662 | 3300048924 | Ga0496121_0032132 | Ga0496121_0032132_1836_2813 | 324 |
| 663 | 3300048924 | Ga0496121_0056496 | Ga0496121_0056496_1480_2454 | 324 |
| 664 | 3300048924 | Ga0496121_0102601 | Ga0496121_0102601_1154_2128 | 324 |
| 665 | 3300048924 | Ga0496121_0106268 | Ga0496121_0106268_765_1751 | 324 |
| 666 | 3300048924 | Ga0496121_0106850 | Ga0496121_0106850_979_1953 | 324 |
| 667 | 3300048925 | Ga0496122_0026944 | Ga0496122_0026944_390_1367 | 324 |
| 668 | 3300048927 | Ga0496124_0244482 | Ga0496124_0244482_131_1105 | 324 |
| 669 | 3300048928 | Ga0496125_0009813 | Ga0496125_0009813_4831_5808 | 324 |
| 670 | 3300048928 | Ga0496125_0090446 | Ga0496125_0090446_983_1960 | 324 |
| 671 | 3300048928 | Ga0496125_0097212 | Ga0496125_0097212_1190_2167 | 324 |
| 672 | 3300048929 | Ga0496126_0039188 | Ga0496126_0039188_791_1765 | 324 |
| 673 | 3300048929 | Ga0496126_0077337 | Ga0496126_0077337_251_1228 | 324 |
| 674 | 3300048929 | Ga0496126_0257206 | Ga0496126_0257206_25_1002 | 324 |
| 675 | 3300049460 | Ga0495682_0010078 | Ga0495682_0010078_631_1608 | 324 |
| 676 | 3300049578 | Ga0501042_0276773 | Ga0501042_0276773_42_1016 | 324 |
| 677 | 3300049581 | Ga0501047_0050488 | Ga0501047_0050488_2474_3448 | 324 |
| 678 | 3300049586 | Ga0501070_0185960 | Ga0501070_0185960_516_1490 | 324 |
| 679 | 3300049823 | Ga0501044_0233648 | Ga0501044_0233648_784_1758 | 324 |
| 680 | 3300050490 | nmdc:mga03n38_124944_c1 | nmdc:mga03n38_124944_c1_146_1123 | 324 |
| 681 | 3300050490 | nmdc:mga03n38_83409_c1 | nmdc:mga03n38_83409_c1_278_1252 | 324 |
| 682 | 3300050491 | nmdc:mga00v17_202324_c1 | nmdc:mga00v17_202324_c1_88_1065 | 324 |
| 683 | 3300050492 | nmdc:mga0yw44_112073_c1 | nmdc:mga0yw44_112073_c1_192_1169 | 324 |
| 684 | 3300050492 | nmdc:mga0yw44_25249_c2 | nmdc:mga0yw44_25249_c2_386_1360 | 324 |
| 685 | 3300050494 | nmdc:mga06z11_45600_c1 | nmdc:mga06z11_45600_c1_202_1194 | 324 |
| 686 | 3300050495 | nmdc:mga04h51_45470_c1 | nmdc:mga04h51_45470_c1_422_1399 | 324 |
| 687 | 3300050507 | nmdc:mga05p37_141697_c1 | nmdc:mga05p37_141697_c1_1791_2765 | 324 |
| 688 | 3300050513 | nmdc:mga0rr50_174705_c1 | nmdc:mga0rr50_174705_c1_627_1601 | 324 |
| 689 | 3300053077 | Ga0495601_0042376 | Ga0495601_0042376_1507_2481 | 324 |
| 690 | 3300053084 | Ga0495595_0062252 | Ga0495595_0062252_517_1494 | 324 |
| 691 | 3300053085 | Ga0495619_0028489 | Ga0495619_0028489_692_1666 | 324 |
| 692 | 3300053087 | Ga0500643_000019 | Ga0500643_000019_18116_19093 | 324 |
| 693 | 3300053093 | Ga0500651_0061733 | Ga0500651_0061733_324_1301 | 324 |
| 694 | 3300053093 | Ga0500651_0067270 | Ga0500651_0067270_177_1154 | 324 |
| 695 | 3300053094 | Ga0500566_0000693 | Ga0500566_0000693_3498_4475 | 324 |
| 696 | 3300053094 | Ga0500566_0003060 | Ga0500566_0003060_2094_3068 | 324 |
| 697 | 3300053096 | Ga0500641_0021737 | Ga0500641_0021737_841_1818 | 324 |
| 698 | 3300053096 | Ga0500641_0063799 | Ga0500641_0063799_488_1465 | 324 |
| 699 | 3300053098 | Ga0500650_0002857 | Ga0500650_0002857_2379_3356 | 324 |
| 700 | 3300053104 | Ga0500556_0000024 | Ga0500556_0000024_68462_69439 | 324 |
| 701 | 3300053109 | Ga0500569_017427 | Ga0500569_017427_516_1493 | 324 |
| 702 | 3300053119 | Ga0500595_000478 | Ga0500595_000478_11127_12101 | 324 |
| 703 | 3300053119 | Ga0500595_008096 | Ga0500595_008096_653_1627 | 324 |
| 704 | 3300053130 | Ga0500642_0000035 | Ga0500642_0000035_68388_69365 | 324 |
| 705 | 3300053130 | Ga0500642_0000096 | Ga0500642_0000096_13276_14253 | 324 |
| 706 | 3300053130 | Ga0500642_0014156 | Ga0500642_0014156_94_1071 | 324 |
| 707 | 3300053130 | Ga0500642_0053040 | Ga0500642_0053040_68_1042 | 324 |
| 708 | 3300053131 | Ga0500652_000404 | Ga0500652_000404_4355_5332 | 324 |
| 709 | 3300053134 | Ga0500658_0022678 | Ga0500658_0022678_187_1161 | 324 |
| 710 | 3300053134 | Ga0500658_0043662 | Ga0500658_0043662_138_1115 | 324 |
| 711 | 3300053139 | Ga0500568_0005040 | Ga0500568_0005040_4968_5945 | 324 |
| 712 | 3300053139 | Ga0500568_0017048 | Ga0500568_0017048_773_1750 | 324 |
| 713 | 3300053142 | Ga0500577_0079393 | Ga0500577_0079393_60_1034 | 324 |
| 714 | 3300053151 | Ga0500604_0001709 | Ga0500604_0001709_2571_3548 | 324 |
| 715 | 3300053151 | Ga0500604_0045570 | Ga0500604_0045570_202_1179 | 324 |
| 716 | 3300053153 | Ga0500616_0000122 | Ga0500616_0000122_71285_72262 | 324 |
| 717 | 3300053156 | Ga0500622_0000790 | Ga0500622_0000790_22376_23353 | 324 |
| 718 | 3300053161 | Ga0500634_0161980 | Ga0500634_0161980_12_989 | 324 |
| 719 | 3300053162 | Ga0500638_024000 | Ga0500638_024000_1447_2421 | 324 |
| 720 | 3300053177 | Ga0500636_0000410 | Ga0500636_0000410_3643_4620 | 324 |
| 721 | 3300053177 | Ga0500636_0017882 | Ga0500636_0017882_852_1829 | 324 |
| 722 | 3300053178 | Ga0500637_0000245 | Ga0500637_0000245_7049_8023 | 324 |
| 723 | 3300053729 | Ga0500625_000095 | Ga0500625_000095_3044_4021 | 324 |
| 724 | 3300053731 | Ga0500609_003240 | Ga0500609_003240_574_1551 | 324 |
| 725 | 3300053736 | Ga0500599_006070 | Ga0500599_006070_514_1491 | 324 |
| 726 | 3300053737 | Ga0500601_000120 | Ga0500601_000120_5356_6333 | 324 |
| 727 | 3300055283 | Ga0500661_000938 | Ga0500661_000938_383_1357 | 324 |
| 728 | 3300055283 | Ga0500661_008979 | Ga0500661_008979_45_1022 | 324 |
| 729 | 3300055283 | Ga0500661_011620 | Ga0500661_011620_274_1251 | 324 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4eye-assembly2.cif.gz_B | crystal structure of a probable oxidoreductase from mycobacterium abscessus solved by iodide ion sad | 0.9253 | 2 | 322 |
| 4eye-assembly1.cif.gz_A | crystal structure of a probable oxidoreductase from mycobacterium abscessus solved by iodide ion sad | 0.92 | 2 | 322 |
| 4eye-assembly2.cif.gz_B | crystal structure of a probable oxidoreductase from mycobacterium abscessus solved by iodide ion sad | 0.9137 | 2 | 322 |
| 4eye-assembly1.cif.gz_A | crystal structure of a probable oxidoreductase from mycobacterium abscessus solved by iodide ion sad | 0.9031 | 2 | 322 |
| 1iyz-assembly1.cif.gz_A-2 | crystal structures of the quinone oxidoreductase from thermus thermophilus hb8 and its complex with nadph | 0.9022 | 3 | 323 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2eihB02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9371 | 124 | 262 | 3.40.50.720 |
| af_I1KB52_138_305_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9343 | 128 | 290 | 3.40.50.720 |
| af_A0A286Y901_130_273_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9313 | 124 | 260 | 3.40.50.720 |
| af_O74489_128_266_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.93 | 128 | 262 | 3.40.50.720 |
| af_Q8MNM6_143_282_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9296 | 130 | 265 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A850CE27-F1-model_v4 | Zinc-binding dehydrogenase | 0.9466 | 76 | 324 |
GO:0016491
|
| AF-A0A059DLV1-F1-model_v4 | Enoyl reductase (ER) domain-containing protein | 0.946 | 82 | 319 |
GO:0016491
|
| AF-A0A812KMX0-F1-model_v4 | Enoyl reductase (ER) domain-containing protein | 0.9427 | 2 | 324 |
GO:0016020
GO:0016491 |
| AF-A0A355B5N3-F1-model_v4 | Enoyl reductase (ER) domain-containing protein | 0.9421 | 112 | 324 |
GO:0008270
GO:0016491 |
| AF-A0A4V2NFX9-F1-model_v4 | Alcohol dehydrogenase-like C-terminal domain-containing protein | 0.942 | 124 | 236 |
GO:0016491
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar