F477730

General Info

Members Datasets Scaffolds Average Seq Length
727 367 716 114

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_10182129|Ga0070709_101821291
Length 129
Sequence MATEGIEAVFMETHNWGRAAKFFQALGYRLDFETDHNSGQLSNGTGPSVFIAEVPADRETDLQLVLKVPDAAACRLDPVVEVVTPFEDTHFGTRIMTVRDPDGRLWSLQAPAAATAGGAAHAGNGAGHE

Samples

Sample ID Description Type Environment
1 2506783011 Frankia datiscae Dg1 Isolate Nodule
2 2508501039 Frankia saprophytica CN3 Isolate Nodule
3 2547132424 Nocardia nova SH22a Isolate Unclassified
4 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
5 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
6 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
7 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
8 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
9 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
10 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
11 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
12 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
13 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
14 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
15 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
16 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
17 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
18 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
19 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
42 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
51 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
75 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
78 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
79 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
80 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
81 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
82 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
83 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
84 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
85 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
88 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
89 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
90 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
91 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
92 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
93 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
94 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
96 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
97 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
98 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
99 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
100 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
101 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
102 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
104 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
105 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
106 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
107 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
108 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
109 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
110 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
111 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
112 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
113 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
114 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
115 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
116 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
117 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
118 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
119 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
120 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
121 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
122 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
123 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
124 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
125 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
126 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
129 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
130 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
131 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
132 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
187 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
188 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300030882 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300031043 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
192 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
193 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
194 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
195 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
196 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
197 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
198 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
199 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
200 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
201 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
202 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
203 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
204 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
205 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
206 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
207 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
208 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
209 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
210 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
211 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
212 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
213 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
214 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
215 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
216 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
217 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
218 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
219 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
220 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
221 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
222 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
223 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
224 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
225 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
226 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
227 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
228 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
229 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
230 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
231 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
232 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
233 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
234 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
235 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
236 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
237 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
238 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
239 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
240 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
241 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
242 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
243 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
244 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
245 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
246 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
247 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
248 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
249 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
250 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
251 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
252 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
253 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
254 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
255 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
256 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
257 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
258 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
259 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
260 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
261 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
262 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
263 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
264 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
265 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
266 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
267 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
268 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
269 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
270 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
271 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
272 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
273 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
274 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
275 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
276 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
277 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
278 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
279 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
280 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
281 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
282 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
283 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
284 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
285 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
286 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
287 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
288 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
289 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
290 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
291 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
292 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
293 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
294 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
295 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
296 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
297 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
298 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
299 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
300 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
301 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
302 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
303 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
304 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
305 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
306 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
307 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
308 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
309 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
310 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
311 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
312 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
313 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
314 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
315 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
316 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
319 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
324 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
326 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
327 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
330 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
331 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
332 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
333 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
334 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
335 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
336 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
337 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
338 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
339 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
340 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
341 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
342 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
343 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
344 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
345 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
346 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
347 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
348 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
349 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
350 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
351 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
352 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
353 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
354 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
355 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
356 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
357 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
358 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
359 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
360 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
361 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
362 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
363 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
364 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
365 8002784119 Frankia sp. AgB1.9 Isolate Nodule
366 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
367 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.11
Metatranscriptomes 1.38
Isolates 1.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.62
Nodule 0.69
Rhizoplane 6.74
Rhizosphere 73.45
Stem 0
Stem Tuber 0
Unclassified 5.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10029444 3300001990 Bacteria 1722
2 JGI24743J22301_10002724 3300001991 Bacteria 2706
3 JGI24743J22301_10003790 3300001991 Bacteria 2417
4 JGI24750J21931_1030232 3300002070 Bacteria 792
5 JGI24750J21931_1039437 3300002070 Bacteria 714
6 JGI24745J21846_1008600 3300002073 Bacteria 1152
7 JGI24748J21848_1014728 3300002074 Bacteria 929
8 JGI24738J21930_10007081 3300002075 Bacteria 2604
9 JGI24749J21850_1004169 3300002076 Bacteria 2020
10 JGI24744J21845_10000768 3300002077 Bacteria 5983
11 JGI24742J22300_10054849 3300002244 Bacteria 726
12 rootH1_10064519 3300003323 Bacteria 1138
13 JGI25160J50197_1007165 3300003354 Bacteria 4395
14 JGI25160J50197_1055960 3300003354 Bacteria 810
15 Ga0070690_100053684 3300005330 Bacteria 2578
16 Ga0068869_100046073 3300005334 Bacteria 3143
17 Ga0068869_100909791 3300005334 Bacteria 762
18 Ga0068869_101122902 3300005334 Bacteria 688
19 Ga0070666_10446687 3300005335 Bacteria 933
20 Ga0070666_10576461 3300005335 Bacteria 820
21 Ga0070680_100243202 3300005336 Bacteria 1521
22 Ga0070680_101100509 3300005336 Bacteria 687
23 Ga0068868_100085099 3300005338 Bacteria 2540
24 Ga0068868_100120875 3300005338 Bacteria 2136
25 Ga0068868_100459682 3300005338 Bacteria 1108
26 Ga0068868_101014736 3300005338 Bacteria 760
27 Ga0070660_100102747 3300005339 Bacteria 2266
28 Ga0070691_10006144 3300005341 Bacteria 5480
29 Ga0070687_100374472 3300005343 Bacteria 926
30 Ga0070668_100005230 3300005347 Bacteria 9627
31 Ga0070668_100137539 3300005347 Bacteria 1966
32 Ga0070668_100172169 3300005347 Bacteria 1763
33 Ga0070668_100512717 3300005347 Bacteria 1039
34 Ga0070668_100750618 3300005347 Bacteria 864
35 Ga0070669_100010473 3300005353 Bacteria 6586
36 Ga0070675_100153278 3300005354 Bacteria 1977
37 Ga0070671_100001105 3300005355 Bacteria 20006
38 Ga0070671_100056915 3300005355 Bacteria 3253
39 Ga0070671_100515899 3300005355 Bacteria 1029
40 Ga0070674_100002194 3300005356 Bacteria 10727
41 Ga0070674_100484940 3300005356 Bacteria 1027
42 Ga0070688_100002996 3300005365 Bacteria 8617
43 Ga0070688_100034762 3300005365 Bacteria 3056
44 Ga0070659_100160147 3300005366 Bacteria 1840
45 Ga0070667_100004831 3300005367 Bacteria 11291
46 Ga0070667_100019932 3300005367 Bacteria 5565
47 Ga0070667_100057013 3300005367 Bacteria 3300
48 Ga0070709_10101629 3300005434 Bacteria 1916
49 Ga0070709_10182129 3300005434 Bacteria 1476
50 Ga0070709_10579727 3300005434 Bacteria 861
51 Ga0070709_11551455 3300005434 Bacteria 539
52 Ga0070714_100014627 3300005435 Bacteria 6307
53 Ga0070714_100155966 3300005435 Bacteria 2061
54 Ga0070714_100231039 3300005435 Bacteria 1704
55 Ga0070714_100535042 3300005435 Bacteria 1120
56 Ga0070714_101633775 3300005435 Bacteria 629
57 Ga0070713_100024506 3300005436 Bacteria 4701
58 Ga0070713_100356772 3300005436 Bacteria 1357
59 Ga0070713_102400823 3300005436 Bacteria 510
60 Ga0070710_10007509 3300005437 Bacteria 5281
61 Ga0070710_10098735 3300005437 Bacteria 1735
62 Ga0070710_10376908 3300005437 Bacteria 945
63 Ga0070710_10387119 3300005437 Bacteria 934
64 Ga0070710_11239824 3300005437 Bacteria 552
65 Ga0070710_11449794 3300005437 Bacteria 514
66 Ga0070701_10057237 3300005438 Bacteria 2043
67 Ga0070711_100003545 3300005439 Bacteria 9107
68 Ga0070711_101882462 3300005439 Bacteria 525
69 Ga0070705_100007488 3300005440 Bacteria 5374
70 Ga0070705_100131616 3300005440 Bacteria 1633
71 Ga0070700_100011622 3300005441 Bacteria 4881
72 Ga0070700_100021032 3300005441 Bacteria 3789
73 Ga0070708_100013584 3300005445 Bacteria 6674
74 Ga0070663_100226980 3300005455 Bacteria 1469
75 Ga0070678_100002269 3300005456 Bacteria 10464
76 Ga0070678_102151678 3300005456 Bacteria 529
77 Ga0070662_100012535 3300005457 Bacteria 5623
78 Ga0070662_100257661 3300005457 Bacteria 1404
79 Ga0068867_101516052 3300005459 Bacteria 625
80 Ga0070685_10096375 3300005466 Bacteria 1800
81 Ga0070685_10425575 3300005466 Bacteria 925
82 Ga0070706_100583427 3300005467 Bacteria 1039
83 Ga0070707_100353046 3300005468 Bacteria 1428
84 Ga0070679_100192987 3300005530 Bacteria 2005
85 Ga0070697_100307168 3300005536 Bacteria 1364
86 Ga0068853_100006828 3300005539 Bacteria 9101
87 Ga0070672_100153486 3300005543 Bacteria 1906
88 Ga0070686_100121298 3300005544 Bacteria 1795
89 Ga0070686_100130176 3300005544 Bacteria 1739
90 Ga0070696_100004005 3300005546 Bacteria 9820
91 Ga0070696_100246816 3300005546 Bacteria 1349
92 Ga0070693_100012471 3300005547 Bacteria 4301
93 Ga0070693_100856860 3300005547 Bacteria 678
94 Ga0070665_100002727 3300005548 Bacteria 19143
95 Ga0070665_100053329 3300005548 Bacteria 4055
96 Ga0070665_100117553 3300005548 Bacteria 2661
97 Ga0070704_100000296 3300005549 Bacteria 21955
98 Ga0068855_100047853 3300005563 Bacteria 5051
99 Ga0068855_100285905 3300005563 Bacteria 1830
100 Ga0068855_101562486 3300005563 Bacteria 676
101 Ga0068854_100006482 3300005578 Bacteria 7448
102 Ga0068856_100970156 3300005614 Bacteria 868
103 Ga0070702_100000597 3300005615 Bacteria 13239
104 Ga0068859_100000044 3300005617 Bacteria 144391
105 Ga0068859_100019721 3300005617 Bacteria 6771
106 Ga0068859_100338393 3300005617 Bacteria 1599
107 Ga0068859_102231760 3300005617 Bacteria 604
108 Ga0068864_100131730 3300005618 Bacteria 2247
109 Ga0068864_100212487 3300005618 Bacteria 1782
110 Ga0068866_10001105 3300005718 Bacteria 11859
111 Ga0068861_100029994 3300005719 Bacteria 3983
112 Ga0068861_101654380 3300005719 Bacteria 632
113 Ga0068870_10530848 3300005840 Bacteria 789
114 Ga0068863_100015528 3300005841 Bacteria 7316
115 Ga0068863_100089808 3300005841 Bacteria 2913
116 Ga0068863_100236891 3300005841 Bacteria 1761
117 Ga0068858_100002423 3300005842 Bacteria 18892
118 Ga0068858_100015624 3300005842 Bacteria 7139
119 Ga0068858_100054705 3300005842 Bacteria 3690
120 Ga0068860_100009137 3300005843 Bacteria 9859
121 Ga0068860_100201639 3300005843 Bacteria 1928
122 Ga0068860_100364393 3300005843 Bacteria 1424
123 Ga0068862_100005455 3300005844 Bacteria 10627
124 Ga0068862_100187437 3300005844 Bacteria 1860
125 Ga0068862_100481815 3300005844 Bacteria 1174
126 Ga0081455_10016844 3300005937 Bacteria 7029
127 Ga0081455_10202779 3300005937 Bacteria 1484
128 Ga0081455_10372578 3300005937 Bacteria 1000
129 Ga0081538_10111883 3300005981 Bacteria 1338
130 Ga0070717_10533832 3300006028 Bacteria 1062
131 Ga0070717_10911773 3300006028 Bacteria 800
132 Ga0075365_10021101 3300006038 Bacteria 4056
133 Ga0075365_10023404 3300006038 Bacteria 3885
134 Ga0075365_10023875 3300006038 Bacteria 3851
135 Ga0075365_10084632 3300006038 Bacteria 2153
136 Ga0075365_10089239 3300006038 Bacteria 2098
137 Ga0075365_10249753 3300006038 Bacteria 1246
138 Ga0075365_10303906 3300006038 Bacteria 1123
139 Ga0075365_11026785 3300006038 Bacteria 581
140 Ga0075363_100002334 3300006048 Bacteria 7714
141 Ga0075363_100006020 3300006048 Bacteria 5467
142 Ga0075363_100014560 3300006048 Bacteria 3847
143 Ga0075363_100051731 3300006048 Bacteria 2191
144 Ga0075363_100079221 3300006048 Bacteria 1795
145 Ga0075363_100300448 3300006048 Bacteria 931
146 Ga0075364_10001374 3300006051 Bacteria 13133
147 Ga0075364_10006662 3300006051 Bacteria 6808
148 Ga0075364_10039979 3300006051 Bacteria 3041
149 Ga0075364_10053475 3300006051 Bacteria 2640
150 Ga0075364_10055840 3300006051 Bacteria 2584
151 Ga0075364_10128648 3300006051 Bacteria 1699
152 Ga0075364_10330236 3300006051 Bacteria 1039
153 Ga0075364_10413250 3300006051 Bacteria 921
154 Ga0075364_10449365 3300006051 Bacteria 880
155 Ga0070715_10002818 3300006163 Bacteria 5415
156 Ga0070715_10004177 3300006163 Bacteria 4701
157 Ga0070716_100001631 3300006173 Bacteria 10115
158 Ga0070716_100025500 3300006173 Bacteria 3155
159 Ga0070716_101719316 3300006173 Bacteria 518
160 Ga0070716_101827781 3300006173 Bacteria 503
161 Ga0070712_100007150 3300006175 Bacteria 6960
162 Ga0070712_100211110 3300006175 Bacteria 1531
163 Ga0070712_100277263 3300006175 Bacteria 1349
164 Ga0070712_100777633 3300006175 Bacteria 820
165 Ga0070712_101871470 3300006175 Bacteria 525
166 Ga0075362_10108632 3300006177 Bacteria 1304
167 Ga0075362_10356194 3300006177 Bacteria 733
168 Ga0075367_10124073 3300006178 Bacteria 1593
169 Ga0075367_10129597 3300006178 Bacteria 1559
170 Ga0075367_10180546 3300006178 Bacteria 1316
171 Ga0075367_10297985 3300006178 Bacteria 1015
172 Ga0075367_10354657 3300006178 Bacteria 926
173 Ga0075367_10410360 3300006178 Bacteria 857
174 Ga0075367_10901688 3300006178 Bacteria 564
175 Ga0075367_11034599 3300006178 Bacteria 525
176 Ga0075369_10003527 3300006186 Bacteria 5695
177 Ga0075369_10004452 3300006186 Bacteria 5176
178 Ga0075369_10012578 3300006186 Bacteria 3344
179 Ga0075369_10026816 3300006186 Bacteria 2404
180 Ga0075369_10385118 3300006186 Bacteria 660
181 Ga0075369_10424872 3300006186 Bacteria 628
182 Ga0097621_100507887 3300006237 Bacteria 1092
183 Ga0097621_100580725 3300006237 Bacteria 1023
184 Ga0075370_10007156 3300006353 Bacteria 5666
185 Ga0075370_10029291 3300006353 Bacteria 3066
186 Ga0075370_10152694 3300006353 Bacteria 1353
187 Ga0075370_10223618 3300006353 Bacteria 1113
188 Ga0075370_10794959 3300006353 Bacteria 577
189 Ga0075428_100014553 3300006844 Bacteria 8738
190 Ga0075430_100080156 3300006846 Bacteria 2735
191 Ga0075430_100098198 3300006846 Bacteria 2447
192 Ga0075431_100089968 3300006847 Bacteria 3168
193 Ga0075433_10505741 3300006852 Bacteria 1063
194 Ga0075434_101628895 3300006871 Bacteria 654
195 Ga0068865_100002240 3300006881 Bacteria 11380
196 Ga0097620_100000044 3300006931 Bacteria 144391
197 Ga0097620_100019721 3300006931 Bacteria 6771
198 Ga0097620_100338445 3300006931 Bacteria 1599
199 Ga0097620_102231981 3300006931 Bacteria 604
200 Ga0075435_100578607 3300007076 Bacteria 973
201 Ga0099795_10229402 3300007788 Bacteria 793
202 Ga0105244_10213707 3300009036 Bacteria 906
203 Ga0105250_10168412 3300009092 Bacteria 916
204 Ga0105240_11046854 3300009093 Bacteria 871
205 Ga0105240_12511821 3300009093 Bacteria 533
206 Ga0105245_10003298 3300009098 Bacteria 14490
207 Ga0105245_10707297 3300009098 Bacteria 1041
208 Ga0105245_10722784 3300009098 Bacteria 1030
209 Ga0105247_10001904 3300009101 Bacteria 14569
210 Ga0105247_10015654 3300009101 Bacteria 4540
211 Ga0114129_10617852 3300009147 Bacteria 1402
212 Ga0105243_10001353 3300009148 Bacteria 21797
213 Ga0105241_10048185 3300009174 Bacteria 3242
214 Ga0105241_11526043 3300009174 Bacteria 644
215 Ga0105242_10012280 3300009176 Bacteria 6593
216 Ga0105248_10006452 3300009177 Bacteria 12873
217 Ga0105248_10944609 3300009177 Bacteria 974
218 Ga0105248_11119138 3300009177 Bacteria 890
219 Ga0105248_12294114 3300009177 Bacteria 614
220 Ga0105237_10028982 3300009545 Bacteria 5631
221 Ga0105237_10630005 3300009545 Bacteria 1079
222 Ga0105237_10795809 3300009545 Bacteria 952
223 Ga0105237_11243367 3300009545 Bacteria 751
224 Ga0105237_11255355 3300009545 Bacteria 747
225 Ga0105238_10092685 3300009551 Bacteria 3009
226 Ga0105238_10841928 3300009551 Bacteria 934
227 Ga0105249_10006656 3300009553 Bacteria 10059
228 Ga0105249_10033047 3300009553 Bacteria 4683
229 Ga0105249_10341596 3300009553 Bacteria 1514
230 Ga0105239_10008146 3300010375 Bacteria 11960
231 Ga0105239_10411845 3300010375 Bacteria 1531
232 Ga0105239_10655611 3300010375 Bacteria 1199
233 Ga0105239_10707093 3300010375 Bacteria 1152
234 Ga0105239_11178402 3300010375 Bacteria 883
235 Ga0105246_10476442 3300011119 Bacteria 1055
236 Ga0157345_1059555 3300012498 Bacteria 505
237 Ga0157373_10283325 3300013100 Bacteria 1175
238 Ga0157369_10725168 3300013105 Bacteria 1023
239 Ga0157374_10018933 3300013296 Bacteria 6088
240 Ga0157374_10771817 3300013296 Bacteria 976
241 Ga0157378_10029837 3300013297 Bacteria 4816
242 Ga0157378_10522278 3300013297 Bacteria 1189
243 Ga0163162_10015988 3300013306 Bacteria 7334
244 Ga0163162_10073949 3300013306 Bacteria 3466
245 Ga0163162_10998113 3300013306 Bacteria 946
246 Ga0157372_11231789 3300013307 Bacteria 864
247 Ga0157375_10004140 3300013308 Bacteria 12585
248 Ga0157375_10006206 3300013308 Bacteria 10407
249 Ga0163163_10055612 3300014325 Bacteria 3911
250 Ga0157380_10042950 3300014326 Bacteria 3536
251 Ga0157380_10240074 3300014326 Bacteria 1633
252 Ga0157380_10793598 3300014326 Bacteria 963
253 Ga0157377_10023445 3300014745 Bacteria 3271
254 Ga0157377_10052736 3300014745 Bacteria 2297
255 Ga0157379_10007492 3300014968 Bacteria 9446
256 Ga0157379_10151639 3300014968 Bacteria 2091
257 Ga0157379_11366494 3300014968 Bacteria 686
258 Ga0163161_10002596 3300017792 Bacteria 12877
259 Ga0163161_10163246 3300017792 Bacteria 1700
260 Ga0163161_10174330 3300017792 Bacteria 1646
261 Ga0163161_10726265 3300017792 Bacteria 829
262 Ga0206355_1651516 3300020076 Bacteria 527
263 Ga0206354_11416303 3300020081 Bacteria 1537
264 Ga0206353_10179585 3300020082 Bacteria 1247
265 Ga0213876_10001772 3300021384 Bacteria 13079
266 Ga0213876_10349311 3300021384 Bacteria 787
267 Ga0213875_10046442 3300021388 Bacteria 2038
268 Ga0224572_1026858 3300024225 Bacteria 1103
269 Ga0224572_1068525 3300024225 Bacteria 656
270 Ga0207426_1002141 3300025302 Bacteria 13481
271 Ga0207426_1014742 3300025302 Bacteria 2857
272 Ga0207653_10043880 3300025885 Bacteria 1473
273 Ga0207692_10007036 3300025898 Bacteria 4593
274 Ga0207692_10207298 3300025898 Bacteria 1156
275 Ga0207692_10552026 3300025898 Bacteria 736
276 Ga0207710_10275425 3300025900 Bacteria 846
277 Ga0207710_10336090 3300025900 Bacteria 768
278 Ga0207710_10665116 3300025900 Bacteria 546
279 Ga0207688_10002256 3300025901 Bacteria 10373
280 Ga0207688_10015760 3300025901 Bacteria 4099
281 Ga0207680_10014155 3300025903 Bacteria 4119
282 Ga0207680_10439242 3300025903 Bacteria 926
283 Ga0207680_10739000 3300025903 Bacteria 705
284 Ga0207685_10002905 3300025905 Bacteria 4045
285 Ga0207685_10026638 3300025905 Bacteria 2013
286 Ga0207699_10030008 3300025906 Bacteria 3039
287 Ga0207699_10034493 3300025906 Bacteria 2871
288 Ga0207699_10426806 3300025906 Bacteria 948
289 Ga0207699_10551351 3300025906 Bacteria 836
290 Ga0207699_11098280 3300025906 Bacteria 589
291 Ga0207654_10063027 3300025911 Bacteria 2174
292 Ga0207695_11496840 3300025913 Bacteria 555
293 Ga0207671_10070883 3300025914 Bacteria 2599
294 Ga0207671_10558867 3300025914 Bacteria 912
295 Ga0207693_10002138 3300025915 Bacteria 17228
296 Ga0207693_10067573 3300025915 Bacteria 2799
297 Ga0207693_10243901 3300025915 Bacteria 1410
298 Ga0207693_10271285 3300025915 Bacteria 1329
299 Ga0207663_10066729 3300025916 Bacteria 2304
300 Ga0207663_10473316 3300025916 Bacteria 969
301 Ga0207663_11328073 3300025916 Bacteria 579
302 Ga0207660_10141829 3300025917 Bacteria 1838
303 Ga0207660_10853807 3300025917 Bacteria 743
304 Ga0207657_10426828 3300025919 Bacteria 1041
305 Ga0207646_10118711 3300025922 Bacteria 2376
306 Ga0207681_10118932 3300025923 Bacteria 1934
307 Ga0207694_10193712 3300025924 Bacteria 1652
308 Ga0207650_10325086 3300025925 Bacteria 1260
309 Ga0207659_10100404 3300025926 Bacteria 2180
310 Ga0207687_10008447 3300025927 Bacteria 6736
311 Ga0207687_11956603 3300025927 Bacteria 501
312 Ga0207700_10091706 3300025928 Bacteria 2400
313 Ga0207700_10718081 3300025928 Bacteria 892
314 Ga0207700_10720099 3300025928 Bacteria 891
315 Ga0207664_10033835 3300025929 Bacteria 3932
316 Ga0207664_10039077 3300025929 Bacteria 3682
317 Ga0207664_10062491 3300025929 Bacteria 2974
318 Ga0207664_10102470 3300025929 Bacteria 2367
319 Ga0207664_10224082 3300025929 Bacteria 1632
320 Ga0207644_10001385 3300025931 Bacteria 15631
321 Ga0207644_10004961 3300025931 Bacteria 8681
322 Ga0207644_10229309 3300025931 Bacteria 1475
323 Ga0207644_11540861 3300025931 Bacteria 558
324 Ga0207690_10739842 3300025932 Bacteria 810
325 Ga0207706_10001778 3300025933 Bacteria 21172
326 Ga0207686_10085692 3300025934 Bacteria 2067
327 Ga0207709_10007635 3300025935 Bacteria 6001
328 Ga0207704_10005156 3300025938 Bacteria 6017
329 Ga0207665_10003399 3300025939 Bacteria 10654
330 Ga0207665_10072021 3300025939 Bacteria 2360
331 Ga0207665_11563964 3300025939 Bacteria 523
332 Ga0207691_10024897 3300025940 Bacteria 5624
333 Ga0207691_10570953 3300025940 Bacteria 958
334 Ga0207691_11123783 3300025940 Bacteria 653
335 Ga0207711_10036998 3300025941 Bacteria 4142
336 Ga0207711_10515901 3300025941 Bacteria 1114
337 Ga0207711_10810240 3300025941 Bacteria 872
338 Ga0207689_10030701 3300025942 Bacteria 4478
339 Ga0207689_10225905 3300025942 Bacteria 1547
340 Ga0207689_10351523 3300025942 Bacteria 1225
341 Ga0207667_10250564 3300025949 Bacteria 1811
342 Ga0207667_10526029 3300025949 Bacteria 1198
343 Ga0207667_11802116 3300025949 Bacteria 576
344 Ga0207651_10237321 3300025960 Bacteria 1484
345 Ga0207712_10038275 3300025961 Bacteria 3279
346 Ga0207712_10083241 3300025961 Bacteria 2335
347 Ga0207668_10014668 3300025972 Bacteria 4853
348 Ga0207668_10031082 3300025972 Bacteria 3514
349 Ga0207668_10090288 3300025972 Bacteria 2248
350 Ga0207668_10111236 3300025972 Bacteria 2056
351 Ga0207640_10136874 3300025981 Bacteria 1779
352 Ga0207658_10012942 3300025986 Bacteria 5699
353 Ga0207658_10035789 3300025986 Bacteria 3557
354 Ga0207658_10574707 3300025986 Bacteria 1010
355 Ga0207677_10007113 3300026023 Bacteria 6162
356 Ga0207677_10195011 3300026023 Bacteria 1605
357 Ga0207677_10466810 3300026023 Bacteria 1085
358 Ga0207677_11321343 3300026023 Bacteria 663
359 Ga0207703_10014586 3300026035 Bacteria 6131
360 Ga0207703_10048420 3300026035 Bacteria 3431
361 Ga0207703_10216353 3300026035 Bacteria 1711
362 Ga0207703_10688462 3300026035 Bacteria 972
363 Ga0207703_11120950 3300026035 Bacteria 756
364 Ga0207639_10010629 3300026041 Bacteria 6373
365 Ga0207639_10639809 3300026041 Bacteria 983
366 Ga0207678_10016795 3300026067 Bacteria 6429
367 Ga0207708_10006981 3300026075 Bacteria 8349
368 Ga0207708_10032029 3300026075 Bacteria 3992
369 Ga0207702_10411469 3300026078 Bacteria 1306
370 Ga0207641_10056044 3300026088 Bacteria 3348
371 Ga0207641_10089736 3300026088 Bacteria 2687
372 Ga0207641_10337217 3300026088 Bacteria 1434
373 Ga0207641_10711708 3300026088 Bacteria 989
374 Ga0207648_10007938 3300026089 Bacteria 10350
375 Ga0207676_10071437 3300026095 Bacteria 2787
376 Ga0207676_11805136 3300026095 Bacteria 610
377 Ga0207675_100008415 3300026118 Bacteria 9724
378 Ga0207675_101341548 3300026118 Bacteria 736
379 Ga0207683_10002944 3300026121 Bacteria 14853
380 Ga0207698_10400126 3300026142 Bacteria 1312
381 Ga0207698_11327804 3300026142 Bacteria 734
382 Ga0209179_1061636 3300027512 Bacteria 814
383 Ga0268266_10007089 3300028379 Bacteria 10178
384 Ga0268266_10019158 3300028379 Bacteria 5828
385 Ga0268266_10103876 3300028379 Bacteria 2508
386 Ga0268265_10278078 3300028380 Bacteria 1497
387 Ga0268264_10128722 3300028381 Bacteria 2241
388 Ga0307515_10013555 3300028794 Bacteria 15219
389 Ga0307515_10037351 3300028794 Bacteria 7813
390 Ga0307515_10377607 3300028794 Bacteria 1051
391 Ga0307512_10016119 3300030522 Bacteria 6902
392 Ga0265766_1021317 3300030863 Bacteria 535
393 Ga0265764_112221 3300030882 Bacteria 562
394 Ga0265779_111167 3300031043 Bacteria 558
395 Ga0307513_10001447 3300031456 Bacteria 34121
396 Ga0307513_10281069 3300031456 Bacteria 1442
397 Ga0307513_10458326 3300031456 Bacteria 998
398 Ga0307509_10093794 3300031507 Bacteria 3062
399 Ga0307508_10097318 3300031616 Bacteria 2535
400 Ga0307508_10197969 3300031616 Bacteria 1610
401 Ga0307508_10648439 3300031616 Bacteria 661
402 Ga0307516_10002519 3300031730 Bacteria 24386
403 Ga0307516_10604636 3300031730 Bacteria 751
404 Ga0307516_10705757 3300031730 Bacteria 666
405 Ga0307518_10108463 3300031838 Bacteria 1980
406 Ga0307411_10518712 3300032005 Bacteria 1011
407 Ga0307415_100253541 3300032126 Bacteria 1431
408 Ga0307507_10000090 3300033179 Bacteria 142457
409 Ga0307507_10399600 3300033179 Bacteria 782
410 Ga0307510_10294973 3300033180 Bacteria 1086
411 Ga0316214_1045684 3300033545 Bacteria 632
412 Ga0373938_0191575 3300034957 Bacteria 563
413 Ga0373926_0001208 3300035083 Bacteria 7749
414 Ga0373934_0278080 3300035086 Bacteria 693
415 Ga0373944_0010340 3300035089 Bacteria 2542
416 Ga0373936_0000687 3300035113 Bacteria 11808
417 Ga0373936_0005405 3300035113 Bacteria 4815
418 Ga0373941_0044303 3300035115 Bacteria 1388
419 Ga0373945_0000543 3300035116 Bacteria 10765
420 Ga0373953_0039885 3300035117 Bacteria 1863
421 Ga0373954_0066097 3300035118 Bacteria 1712
422 Ga0373957_0208834 3300035120 Bacteria 815
423 Ga0373943_0000294 3300035170 Bacteria 20746
424 Ga0373943_0389543 3300035170 Bacteria 803
425 Ga0373943_0437980 3300035170 Bacteria 758
426 Ga0373946_0000333 3300035171 Bacteria 15276
427 Ga0373924_0244556 3300035410 Bacteria 794
428 Ga0373931_0083708 3300035691 Bacteria 1765
429 Ga0373935_0038129 3300035692 Bacteria 3007
430 Ga0373935_0096349 3300035692 Bacteria 1944
431 Ga0373935_0955298 3300035692 Bacteria 636
432 Ga0373927_0033472 3300035695 Bacteria 3346
433 Ga0373927_0567573 3300035695 Bacteria 750
434 Ga0373933_0206277 3300035724 Bacteria 1258
435 Ga0373947_0000366 3300035725 Bacteria 25508
436 Ga0373947_0187145 3300035725 Bacteria 1350
437 Ga0373947_0410272 3300035725 Bacteria 914
438 Ga0373937_0033012 3300036401 Bacteria 4697
439 Ga0372808_041009 3300036459 Bacteria 664
440 Ga0373925_0004806 3300037068 Bacteria 10176
441 Ga0373925_0255757 3300037068 Bacteria 1406
442 Ga0395900_0130030 3300037418 Bacteria 2581
443 Ga0395898_0000967 3300037466 Bacteria 45516
444 Ga0395905_0383175 3300037471 Bacteria 1300
445 Ga0436364_1448068 3300037853 Bacteria 7997
446 Ga0395901_0050096 3300038443 Bacteria 4340
447 Ga0395901_0866824 3300038443 Bacteria 887
448 Ga0395901_2061833 3300038443 Bacteria 516
449 Ga0436365_1159535 3300039437 Bacteria 904
450 Ga0436365_1258441 3300039437 Bacteria 1047
451 Ga0436365_1483817 3300039437 Bacteria 6760
452 Ga0439439_0011776 3300041406 Bacteria 2109
453 Ga0439461_0013621 3300041410 Bacteria 1537
454 Ga0439465_0044142 3300041413 Bacteria 1447
455 Ga0439465_0081566 3300041413 Bacteria 1097
456 Ga0451797_0572430 3300041453 Bacteria 631
457 Ga0451804_0381060 3300041463 Bacteria 703
458 Ga0451843_0192007 3300041509 Bacteria 509
459 Ga0451853_0321697 3300041512 Bacteria 2170
460 Ga0439431_0022260 3300041997 Bacteria 1527
461 Ga0439433_0004058 3300041999 Bacteria 3146
462 Ga0439442_002820 3300042002 Bacteria 3417
463 Ga0439442_158053 3300042002 Bacteria 506
464 Ga0439449_0001367 3300042007 Bacteria 9546
465 Ga0439457_003638 3300042014 Bacteria 4170
466 Ga0439434_0221897 3300042435 Bacteria 642
467 Ga0466969_0137673 3300044656 Bacteria 1130
468 Ga0466972_0016444 3300044658 Bacteria 3700
469 Ga0466972_0030862 3300044658 Bacteria 2638
470 Ga0466965_0011338 3300044683 Bacteria 4175
471 Ga0466966_0000993 3300044684 Bacteria 18195
472 Ga0466966_0044209 3300044684 Bacteria 2852
473 Ga0466966_0066180 3300044684 Bacteria 2271
474 Ga0466966_0908793 3300044684 Bacteria 531
475 Ga0466961_0002945 3300044693 Bacteria 10572
476 Ga0466961_0006230 3300044693 Bacteria 7580
477 Ga0466961_0220442 3300044693 Bacteria 1169
478 Ga0466963_0004374 3300044694 Bacteria 8206
479 Ga0466963_0062359 3300044694 Bacteria 2494
480 Ga0466963_0253255 3300044694 Bacteria 1236
481 Ga0466963_0395146 3300044694 Bacteria 975
482 Ga0466963_0817024 3300044694 Bacteria 657
483 Ga0466963_1192531 3300044694 Bacteria 535
484 Ga0466964_0005074 3300044706 Bacteria 4870
485 Ga0466964_0016922 3300044706 Bacteria 2788
486 Ga0466964_0799686 3300044706 Bacteria 533
487 Ga0466971_0000363 3300044719 Bacteria 17400
488 Ga0466971_0011002 3300044719 Bacteria 3958
489 Ga0466971_0454048 3300044719 Bacteria 629
490 Ga0466968_0107092 3300044735 Bacteria 1254
491 Ga0466968_0126987 3300044735 Bacteria 1158
492 Ga0466968_0150607 3300044735 Bacteria 1069
493 Ga0466968_0218405 3300044735 Bacteria 897
494 Ga0466968_0287272 3300044735 Bacteria 788
495 Ga0466970_0005079 3300044765 Bacteria 6506
496 Ga0466970_0029299 3300044765 Bacteria 2898
497 Ga0466970_0115568 3300044765 Bacteria 1467
498 Ga0466957_0058405 3300044842 Bacteria 2363
499 Ga0466957_0165703 3300044842 Bacteria 1437
500 Ga0466960_0583835 3300044901 Bacteria 662
501 Ga0466959_0017959 3300045049 Bacteria 5190
502 Ga0466959_0158740 3300045049 Bacteria 1590
503 Ga0466959_0223801 3300045049 Bacteria 1304
504 Ga0466958_0003984 3300045836 Bacteria 7741
505 Ga0466958_0009344 3300045836 Bacteria 5463
506 Ga0466958_0011624 3300045836 Bacteria 4962
507 Ga0466958_0060390 3300045836 Bacteria 2308
508 Ga0466958_0315504 3300045836 Bacteria 1004
509 Ga0466967_0034819 3300045976 Bacteria 4279
510 Ga0466967_0161463 3300045976 Bacteria 2104
511 Ga0466967_0221669 3300045976 Bacteria 1797
512 Ga0466967_0626896 3300045976 Bacteria 1062
513 Ga0495592_0000338 3300046454 Bacteria 38538
514 Ga0495592_0373894 3300046454 Bacteria 908
515 Ga0495629_0080691 3300046459 Bacteria 2271
516 Ga0495629_0497543 3300046459 Bacteria 822
517 Ga0495629_0545982 3300046459 Bacteria 778
518 Ga0495638_0001977 3300046460 Bacteria 17520
519 Ga0495638_0162577 3300046460 Bacteria 1287
520 Ga0495641_0123460 3300046461 Bacteria 1155
521 Ga0495641_0280929 3300046461 Bacteria 749
522 Ga0495651_0000436 3300046462 Bacteria 32184
523 Ga0495651_0056166 3300046462 Bacteria 3024
524 Ga0495651_0223143 3300046462 Bacteria 1303
525 Ga0495653_0014057 3300046463 Bacteria 6528
526 Ga0495653_0022636 3300046463 Bacteria 5082
527 Ga0495653_0022668 3300046463 Bacteria 5079
528 Ga0495639_0063782 3300046475 Bacteria 1692
529 Ga0495662_0177879 3300046476 Bacteria 1048
530 Ga0495662_0396988 3300046476 Bacteria 677
531 Ga0495664_0028227 3300046477 Bacteria 3277
532 Ga0495594_0261908 3300046499 Bacteria 985
533 Ga0495608_0061454 3300046511 Bacteria 2470
534 Ga0495608_0094074 3300046511 Bacteria 1936
535 Ga0495618_0064466 3300046514 Bacteria 2328
536 Ga0495628_0834969 3300046516 Bacteria 643
537 Ga0495630_0000359 3300046517 Bacteria 36192
538 Ga0495630_0375039 3300046517 Bacteria 1089
539 Ga0495630_0728973 3300046517 Bacteria 758
540 Ga0495652_0055768 3300046529 Bacteria 3359
541 Ga0495652_0399966 3300046529 Bacteria 973
542 Ga0495665_0009674 3300046531 Bacteria 5220
543 Ga0495587_0092851 3300046536 Bacteria 1743
544 Ga0495587_0519307 3300046536 Bacteria 658
545 Ga0495645_0259752 3300046543 Bacteria 1151
546 Ga0495667_0025134 3300046559 Bacteria 4015
547 Ga0495667_0042022 3300046559 Bacteria 3031
548 Ga0495634_0019164 3300046642 Bacteria 4863
549 Ga0495634_0039098 3300046642 Bacteria 3232
550 Ga0495625_0094759 3300046660 Bacteria 2059
551 Ga0495635_0014225 3300046663 Bacteria 5569
552 Ga0495635_0035888 3300046663 Bacteria 3438
553 Ga0495657_0041857 3300046675 Bacteria 3132
554 Ga0495657_0105985 3300046675 Bacteria 1785
555 Ga0495599_0744449 3300046678 Bacteria 563
556 Ga0495623_0094568 3300046679 Bacteria 1827
557 Ga0495623_0539413 3300046679 Bacteria 612
558 Ga0495646_0000169 3300046680 Bacteria 32603
559 Ga0495613_1015008 3300046689 Bacteria 532
560 Ga0495624_0000781 3300046690 Bacteria 25096
561 Ga0495649_0258442 3300046694 Bacteria 893
562 Ga0495600_0031605 3300046809 Bacteria 3431
563 Ga0495600_0587786 3300046809 Bacteria 677
564 Ga0495581_0007309 3300047315 Bacteria 6390
565 Ga0495604_0440415 3300047317 Bacteria 853
566 Ga0495674_0000657 3300047319 Bacteria 32403
567 Ga0495674_0185098 3300047319 Bacteria 1733
568 Ga0495672_0077211 3300047320 Bacteria 1868
569 Ga0495672_0341290 3300047320 Bacteria 698
570 Ga0495676_0067255 3300047321 Bacteria 2773
571 Ga0495680_0006292 3300047322 Bacteria 11059
572 Ga0495680_0738060 3300047322 Bacteria 647
573 Ga0495673_0361340 3300047469 Bacteria 511
574 Ga0495684_0230562 3300047471 Bacteria 1354
575 Ga0495602_0260374 3300048088 Bacteria 1287
576 Ga0495602_0524714 3300048088 Bacteria 824
577 Ga0496100_0002078 3300048903 Bacteria 10075
578 Ga0496100_0003101 3300048903 Bacteria 8598
579 Ga0496100_0798004 3300048903 Bacteria 740
580 Ga0496101_0004725 3300048904 Bacteria 8630
581 Ga0496101_0799603 3300048904 Bacteria 744
582 Ga0496101_0809812 3300048904 Bacteria 739
583 Ga0496102_0013469 3300048905 Bacteria 7084
584 Ga0496102_0032674 3300048905 Bacteria 4675
585 Ga0496102_0070790 3300048905 Bacteria 3202
586 Ga0496102_0415608 3300048905 Bacteria 1263
587 Ga0496103_0000638 3300048906 Bacteria 26745
588 Ga0496103_0068655 3300048906 Bacteria 2215
589 Ga0496104_0444230 3300048907 Bacteria 1209
590 Ga0496105_0069444 3300048908 Bacteria 2911
591 Ga0496105_0169666 3300048908 Bacteria 1789
592 Ga0496105_0609144 3300048908 Bacteria 847
593 Ga0496105_0695843 3300048908 Bacteria 781
594 Ga0496106_0000851 3300048909 Bacteria 22136
595 Ga0496106_0020856 3300048909 Bacteria 4862
596 Ga0496106_0268147 3300048909 Bacteria 1367
597 Ga0496107_0027339 3300048910 Bacteria 4050
598 Ga0496107_0483784 3300048910 Bacteria 918
599 Ga0496107_0615483 3300048910 Bacteria 802
600 Ga0496108_0001502 3300048911 Bacteria 18462
601 Ga0496108_0173882 3300048911 Bacteria 1864
602 Ga0496108_0337619 3300048911 Bacteria 1314
603 Ga0496109_0006002 3300048912 Bacteria 10203
604 Ga0496109_0061463 3300048912 Bacteria 3434
605 Ga0496109_0506164 3300048912 Bacteria 1140
606 Ga0496110_0072539 3300048913 Bacteria 3055
607 Ga0496110_0084620 3300048913 Bacteria 2831
608 Ga0496110_0365545 3300048913 Bacteria 1314
609 Ga0496110_1501552 3300048913 Bacteria 584
610 Ga0496111_0011268 3300048914 Bacteria 6019
611 Ga0496111_0640985 3300048914 Bacteria 776
612 Ga0496112_0003000 3300048915 Bacteria 13795
613 Ga0496112_0100483 3300048915 Bacteria 2862
614 Ga0496112_0212603 3300048915 Bacteria 1891
615 Ga0496112_0538557 3300048915 Bacteria 1102
616 Ga0496113_0081102 3300048916 Bacteria 2486
617 Ga0496113_0108705 3300048916 Bacteria 2156
618 Ga0496113_0324320 3300048916 Bacteria 1235
619 Ga0496113_1582407 3300048916 Bacteria 505
620 Ga0496114_0005066 3300048917 Bacteria 10272
621 Ga0496114_0780602 3300048917 Bacteria 834
622 Ga0496115_0007280 3300048918 Bacteria 8137
623 Ga0496115_0799962 3300048918 Bacteria 734
624 Ga0496119_0001496 3300048922 Bacteria 27975
625 Ga0496119_0207558 3300048922 Bacteria 1010
626 Ga0496120_0006904 3300048923 Bacteria 8568
627 Ga0496121_0032589 3300048924 Bacteria 4733
628 Ga0496124_0030346 3300048927 Bacteria 4800
629 Ga0496126_0073912 3300048929 Bacteria 3029
630 Ga0496126_0364197 3300048929 Bacteria 1180
631 Ga0501031_0096461 3300049568 Bacteria 1930
632 Ga0501032_0204739 3300049569 Bacteria 1287
633 Ga0501033_0039523 3300049570 Bacteria 3523
634 Ga0501034_0085696 3300049571 Bacteria 3151
635 Ga0501034_0759007 3300049571 Bacteria 865
636 Ga0501036_0073697 3300049572 Bacteria 2886
637 Ga0501037_0288738 3300049573 Bacteria 1141
638 Ga0501038_0025400 3300049574 Bacteria 5281
639 Ga0501039_0952650 3300049575 Bacteria 667
640 Ga0501043_0163212 3300049579 Bacteria 1740
641 Ga0501043_1178781 3300049579 Bacteria 539
642 Ga0501070_0068608 3300049586 Bacteria 2935
643 Ga0501072_1464448 3300049588 Bacteria 527
644 Ga0501035_0174123 3300049822 Bacteria 1857
645 Ga0501035_0727618 3300049822 Bacteria 798
646 Ga0501044_0145020 3300049823 Bacteria 2360
647 Ga0501044_0283239 3300049823 Bacteria 1590
648 Ga0501045_0186590 3300049824 Bacteria 1545
649 nmdc:mga03683_61232_c1 3300050489 Bacteria 1591
650 nmdc:mga03683_67430_c1 3300050489 Bacteria 1523
651 nmdc:mga03n38_251340_c1 3300050490 Bacteria 934
652 nmdc:mga03n38_43772_c1 3300050490 Bacteria 1963
653 nmdc:mga03n38_53227_c1 3300050490 Bacteria 1814
654 nmdc:mga03n38_58577_c1 3300050490 Bacteria 1746
655 nmdc:mga00v17_115348_c1 3300050491 Bacteria 1707
656 nmdc:mga00v17_1723_c1 3300050491 Bacteria 11354
657 nmdc:mga00v17_34982_c2 3300050491 Bacteria 2495
658 nmdc:mga00v17_83170_c1 3300050491 Bacteria 2002
659 nmdc:mga00v17_8482_c1 3300050491 Bacteria 5530
660 nmdc:mga00v17_935541_c1 3300050491 Bacteria 548
661 nmdc:mga0yw44_17450_c1 3300050492 Bacteria 3905
662 nmdc:mga0yw44_269178_c1 3300050492 Bacteria 1137
663 nmdc:mga0yw44_513203_c1 3300050492 Bacteria 813
664 nmdc:mga0yw44_551439_c1 3300050492 Bacteria 783
665 nmdc:mga0yw44_647906_c1 3300050492 Bacteria 718
666 nmdc:mga0yw44_69467_c1 3300050492 Bacteria 2182
667 nmdc:mga0k408_434063_c1 3300050493 Bacteria 780
668 nmdc:mga06z11_229110_c1 3300050494 Bacteria 1088
669 nmdc:mga06z11_393054_c1 3300050494 Bacteria 834
670 nmdc:mga06z11_437005_c1 3300050494 Bacteria 790
671 nmdc:mga06z11_790076_c1 3300050494 Bacteria 578
672 nmdc:mga06z11_907036_c1 3300050494 Bacteria 537
673 nmdc:mga06z11_931858_c1 3300050494 Bacteria 529
674 nmdc:mga04h51_162848_c1 3300050495 Bacteria 859
675 nmdc:mga07m45_194435_c1 3300050496 Bacteria 1180
676 nmdc:mga07m45_3342_c1 3300050496 Bacteria 7732
677 nmdc:mga05p37_228275_c1 3300050507 Bacteria 2244
678 nmdc:mga0qj67_136182_c1 3300050509 Bacteria 1990
679 nmdc:mga0qj67_58338_c1 3300050509 Bacteria 3060
680 nmdc:mga0n895_1042456_c1 3300050512 Bacteria 797
681 nmdc:mga0rr50_396358_c1 3300050513 Bacteria 1165
682 nmdc:mga0a205_446637_c1 3300050515 Bacteria 1153
683 nmdc:mga0sz30_12989_c1 3300050516 Bacteria 3252
684 nmdc:mga0sz30_25693_c1 3300050516 Bacteria 2409
685 nmdc:mga0sz30_4145_c1 3300050516 Bacteria 5223
686 nmdc:mga0sz30_4369_c1 3300050516 Bacteria 4293
687 nmdc:mga0sz30_68842_c1 3300050516 Bacteria 1521
688 Ga0495601_0042212 3300053077 Bacteria 2861
689 Ga0495612_0009997 3300053078 Bacteria 3841
690 Ga0500610_0004115 3300053079 Bacteria 5715
691 Ga0495595_0345181 3300053084 Bacteria 751
692 Ga0495619_0055007 3300053085 Bacteria 2635
693 Ga0495619_0518370 3300053085 Bacteria 819
694 Ga0500644_0012178 3300053088 Bacteria 2372
695 Ga0500646_0095653 3300053090 Bacteria 926
696 Ga0500646_0329660 3300053090 Bacteria 553
697 Ga0500566_0005968 3300053094 Bacteria 7242
698 Ga0500650_0214146 3300053098 Bacteria 874
699 Ga0500556_0066795 3300053104 Bacteria 1336
700 Ga0500556_0188818 3300053104 Bacteria 814
701 Ga0500652_061681 3300053131 Bacteria 1544
702 Ga0500652_230697 3300053131 Bacteria 741
703 Ga0500568_0283605 3300053139 Bacteria 602
704 Ga0500577_0360270 3300053142 Bacteria 636
705 Ga0500604_0067083 3300053151 Bacteria 1138
706 Ga0500616_0003087 3300053153 Bacteria 13073
707 Ga0500616_0050977 3300053153 Bacteria 2183
708 Ga0500616_0116274 3300053153 Bacteria 1284
709 Ga0500627_0260124 3300053158 Bacteria 766
710 Ga0500611_037074 3300053727 Bacteria 1048
711 Ga0587093_105030 3300059478 Bacteria 514
712 Ga0587073_0246022 3300059492 Bacteria 559
713 Ga0587072_188349 3300059643 Bacteria 518
714 Ga0466962_0004991 3300061719 Bacteria 6381
715 Ga0466962_0010842 3300061719 Bacteria 4381
716 Ga0466962_0128654 3300061719 Bacteria 1223

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025942 Ga0207689_10351523 Ga0207689_103515232 97
2 3300031616 Ga0307508_10097318 Ga0307508_100973184 100
3 3300044683 Ga0466965_0011338 Ga0466965_0011338_2921_3265 100
4 3300044684 Ga0466966_0000993 Ga0466966_0000993_13365_13709 100
5 3300044693 Ga0466961_0002945 Ga0466961_0002945_5702_6046 100
6 3300044694 Ga0466963_0004374 Ga0466963_0004374_1899_2243 100
7 3300044706 Ga0466964_0005074 Ga0466964_0005074_4135_4479 100
8 3300044719 Ga0466971_0011002 Ga0466971_0011002_3001_3345 100
9 3300044735 Ga0466968_0126987 Ga0466968_0126987_671_1015 100
10 3300044765 Ga0466970_0005079 Ga0466970_0005079_4270_4614 100
11 3300044842 Ga0466957_0058405 Ga0466957_0058405_913_1257 100
12 3300045049 Ga0466959_0158740 Ga0466959_0158740_898_1242 100
13 3300045836 Ga0466958_0009344 Ga0466958_0009344_4263_4607 100
14 3300045976 Ga0466967_0034819 Ga0466967_0034819_2296_2640 100
15 3300061719 Ga0466962_0010842 Ga0466962_0010842_2771_3115 100
16 3300046499 Ga0495594_0261908 Ga0495594_0261908_431_775 101
17 3300003354 JGI25160J50197_1007165 JGI25160J50197_10071653 106
18 3300025302 Ga0207426_1002141 Ga0207426_100214115 106
19 3300049579 Ga0501043_1178781 Ga0501043_1178781_58_381 106
20 3300049822 Ga0501035_0727618 Ga0501035_0727618_462_782 106
21 3300049823 Ga0501044_0283239 Ga0501044_0283239_760_1083 106
22 iso_pu_bacteria 2866612099 2866613898 107
23 3300005334 Ga0068869_101122902 Ga0068869_1011229022 108
24 3300005347 Ga0070668_100172169 Ga0070668_1001721692 109
25 3300014968 Ga0157379_11366494 Ga0157379_113664942 109
26 3300024225 Ga0224572_1068525 Ga0224572_10685252 109
27 3300025972 Ga0207668_10031082 Ga0207668_100310823 109
28 3300033545 Ga0316214_1045684 Ga0316214_10456842 109
29 3300047317 Ga0495604_0440415 Ga0495604_0440415_295_639 109
30 3300048903 Ga0496100_0002078 Ga0496100_0002078_8709_9071 109
31 3300048904 Ga0496101_0809812 Ga0496101_0809812_156_518 109
32 3300048908 Ga0496105_0069444 Ga0496105_0069444_2210_2572 109
33 3300048909 Ga0496106_0268147 Ga0496106_0268147_96_458 109
34 3300048910 Ga0496107_0483784 Ga0496107_0483784_471_833 109
35 3300048913 Ga0496110_0072539 Ga0496110_0072539_728_1090 109
36 3300048922 Ga0496119_0001496 Ga0496119_0001496_7389_7751 109
37 3300048923 Ga0496120_0006904 Ga0496120_0006904_2655_3017 109
38 3300048924 Ga0496121_0032589 Ga0496121_0032589_2549_2911 109
39 3300048927 Ga0496124_0030346 Ga0496124_0030346_1328_1690 109
40 3300048929 Ga0496126_0073912 Ga0496126_0073912_2204_2566 109
41 3300005355 Ga0070671_100001105 Ga0070671_10000110520 110
42 3300005842 Ga0068858_100002423 Ga0068858_10000242310 110
43 3300014968 Ga0157379_10151639 Ga0157379_101516394 110
44 3300024225 Ga0224572_1026858 Ga0224572_10268581 110
45 3300025931 Ga0207644_10004961 Ga0207644_100049613 110
46 3300026035 Ga0207703_10216353 Ga0207703_102163533 110
47 iso_pu_bacteria 2506783011 2506865112 110
48 iso_pu_bacteria 2508501039 2508677985 110
49 iso_pu_bacteria 2675902999 2676204330 110
50 iso_pu_bacteria 2773857921 2774848906 110
51 iso_pu_bacteria 2947224130 2947231757 110
52 iso_pu_bacteria 8002784119 8002786056 110
53 iso_pu_bacteria 8054160619 8054161562 110
54 iso_pu_bacteria 8056829672 8056834118 110
55 iso_pu_bacteria 2547132424 2548694333 111
56 iso_pu_bacteria 2870782633 2870788314 111
57 3300003323 rootH1_10064519 rootH1_100645193 112
58 3300005338 Ga0068868_101014736 Ga0068868_1010147362 112
59 3300005937 Ga0081455_10016844 Ga0081455_100168447 112
60 3300006038 Ga0075365_10023875 Ga0075365_100238752 112
61 3300006048 Ga0075363_100014560 Ga0075363_1000145602 112
62 3300006051 Ga0075364_10001374 Ga0075364_100013746 112
63 3300006177 Ga0075362_10108632 Ga0075362_101086323 112
64 3300006186 Ga0075369_10003527 Ga0075369_100035275 112
65 3300006846 Ga0075430_100080156 Ga0075430_1000801563 112
66 3300010375 Ga0105239_11178402 Ga0105239_111784022 112
67 3300013306 Ga0163162_10073949 Ga0163162_100739494 112
68 3300017792 Ga0163161_10163246 Ga0163161_101632462 112
69 3300026023 Ga0207677_11321343 Ga0207677_113213432 112
70 3300041410 Ga0439461_0013621 Ga0439461_0013621_499_837 112
71 3300041413 Ga0439465_0044142 Ga0439465_0044142_485_823 112
72 3300041413 Ga0439465_0081566 Ga0439465_0081566_295_633 112
73 3300041997 Ga0439431_0022260 Ga0439431_0022260_1093_1431 112
74 3300042002 Ga0439442_002820 Ga0439442_002820_1343_1681 112
75 3300042002 Ga0439442_158053 Ga0439442_158053_132_470 112
76 3300042435 Ga0439434_0221897 Ga0439434_0221897_90_428 112
77 3300044706 Ga0466964_0016922 Ga0466964_0016922_1028_1366 112
78 3300044735 Ga0466968_0287272 Ga0466968_0287272_239_577 112
79 3300046460 Ga0495638_0001977 Ga0495638_0001977_3302_3640 112
80 3300046660 Ga0495625_0094759 Ga0495625_0094759_1682_2020 112
81 3300046694 Ga0495649_0258442 Ga0495649_0258442_402_740 112
82 3300047320 Ga0495672_0077211 Ga0495672_0077211_439_777 112
83 3300047320 Ga0495672_0341290 Ga0495672_0341290_329_667 112
84 3300047469 Ga0495673_0361340 Ga0495673_0361340_153_491 112
85 3300050489 nmdc:mga03683_67430_c1 nmdc:mga03683_67430_c1_847_1185 112
86 3300050490 nmdc:mga03n38_43772_c1 nmdc:mga03n38_43772_c1_631_969 112
87 3300050491 nmdc:mga00v17_1723_c1 nmdc:mga00v17_1723_c1_7262_7600 112
88 3300050492 nmdc:mga0yw44_17450_c1 nmdc:mga0yw44_17450_c1_874_1212 112
89 3300050509 nmdc:mga0qj67_58338_c1 nmdc:mga0qj67_58338_c1_1780_2118 112
90 3300050516 nmdc:mga0sz30_4145_c1 nmdc:mga0sz30_4145_c1_2662_3000 112
91 3300053079 Ga0500610_0004115 Ga0500610_0004115_2331_2669 112
92 3300053104 Ga0500556_0066795 Ga0500556_0066795_313_651 112
93 3300053131 Ga0500652_230697 Ga0500652_230697_306_644 112
94 3300053139 Ga0500568_0283605 Ga0500568_0283605_195_533 112
95 3300053142 Ga0500577_0360270 Ga0500577_0360270_125_463 112
96 3300053151 Ga0500604_0067083 Ga0500604_0067083_463_801 112
97 3300053153 Ga0500616_0050977 Ga0500616_0050977_452_790 112
98 3300053158 Ga0500627_0260124 Ga0500627_0260124_127_465 112
99 3300002070 JGI24750J21931_1030232 JGI24750J21931_10302322 113
100 3300002070 JGI24750J21931_1039437 JGI24750J21931_10394372 113
101 3300002075 JGI24738J21930_10007081 JGI24738J21930_100070813 113
102 3300002076 JGI24749J21850_1004169 JGI24749J21850_10041692 113
103 3300002077 JGI24744J21845_10000768 JGI24744J21845_100007687 113
104 3300005330 Ga0070690_100053684 Ga0070690_1000536841 113
105 3300005334 Ga0068869_100046073 Ga0068869_1000460733 113
106 3300005335 Ga0070666_10576461 Ga0070666_105764612 113
107 3300005336 Ga0070680_100243202 Ga0070680_1002432023 113
108 3300005338 Ga0068868_100085099 Ga0068868_1000850993 113
109 3300005339 Ga0070660_100102747 Ga0070660_1001027472 113
110 3300005341 Ga0070691_10006144 Ga0070691_100061448 113
111 3300005347 Ga0070668_100005230 Ga0070668_1000052308 113
112 3300005347 Ga0070668_100137539 Ga0070668_1001375392 113
113 3300005347 Ga0070668_100750618 Ga0070668_1007506182 113
114 3300005353 Ga0070669_100010473 Ga0070669_1000104738 113
115 3300005354 Ga0070675_100153278 Ga0070675_1001532784 113
116 3300005355 Ga0070671_100056915 Ga0070671_1000569154 113
117 3300005356 Ga0070674_100002194 Ga0070674_1000021948 113
118 3300005365 Ga0070688_100002996 Ga0070688_1000029964 113
119 3300005366 Ga0070659_100160147 Ga0070659_1001601472 113
120 3300005367 Ga0070667_100004831 Ga0070667_1000048319 113
121 3300005367 Ga0070667_100019932 Ga0070667_1000199326 113
122 3300005367 Ga0070667_100057013 Ga0070667_1000570133 113
123 3300005435 Ga0070714_100231039 Ga0070714_1002310392 113
124 3300005437 Ga0070710_10007509 Ga0070710_100075092 113
125 3300005439 Ga0070711_100003545 Ga0070711_1000035458 113
126 3300005440 Ga0070705_100007488 Ga0070705_1000074882 113
127 3300005441 Ga0070700_100011622 Ga0070700_1000116225 113
128 3300005455 Ga0070663_100226980 Ga0070663_1002269803 113
129 3300005456 Ga0070678_100002269 Ga0070678_1000022698 113
130 3300005456 Ga0070678_102151678 Ga0070678_1021516781 113
131 3300005457 Ga0070662_100012535 Ga0070662_1000125359 113
132 3300005457 Ga0070662_100257661 Ga0070662_1002576612 113
133 3300005459 Ga0068867_101516052 Ga0068867_1015160521 113
134 3300005466 Ga0070685_10096375 Ga0070685_100963752 113
135 3300005466 Ga0070685_10425575 Ga0070685_104255752 113
136 3300005530 Ga0070679_100192987 Ga0070679_1001929871 113
137 3300005536 Ga0070697_100307168 Ga0070697_1003071682 113
138 3300005539 Ga0068853_100006828 Ga0068853_1000068288 113
139 3300005543 Ga0070672_100153486 Ga0070672_1001534862 113
140 3300005544 Ga0070686_100121298 Ga0070686_1001212982 113
141 3300005544 Ga0070686_100130176 Ga0070686_1001301762 113
142 3300005546 Ga0070696_100004005 Ga0070696_1000040052 113
143 3300005547 Ga0070693_100012471 Ga0070693_1000124711 113
144 3300005548 Ga0070665_100002727 Ga0070665_10000272719 113
145 3300005548 Ga0070665_100053329 Ga0070665_1000533294 113
146 3300005549 Ga0070704_100000296 Ga0070704_10000029618 113
147 3300005563 Ga0068855_100047853 Ga0068855_1000478537 113
148 3300005578 Ga0068854_100006482 Ga0068854_10000648210 113
149 3300005615 Ga0070702_100000597 Ga0070702_10000059713 113
150 3300005617 Ga0068859_100019721 Ga0068859_10001972111 113
151 3300005617 Ga0068859_100338393 Ga0068859_1003383932 113
152 3300005617 Ga0068859_102231760 Ga0068859_1022317602 113
153 3300005618 Ga0068864_100212487 Ga0068864_1002124873 113
154 3300005718 Ga0068866_10001105 Ga0068866_100011058 113
155 3300005719 Ga0068861_100029994 Ga0068861_1000299947 113
156 3300005841 Ga0068863_100015528 Ga0068863_1000155283 113
157 3300005842 Ga0068858_100015624 Ga0068858_1000156243 113
158 3300005843 Ga0068860_100009137 Ga0068860_1000091376 113
159 3300005843 Ga0068860_100201639 Ga0068860_1002016393 113
160 3300005844 Ga0068862_100005455 Ga0068862_1000054559 113
161 3300005844 Ga0068862_100187437 Ga0068862_1001874373 113
162 3300005937 Ga0081455_10202779 Ga0081455_102027792 113
163 3300005937 Ga0081455_10372578 Ga0081455_103725782 113
164 3300006038 Ga0075365_10023404 Ga0075365_100234045 113
165 3300006038 Ga0075365_10303906 Ga0075365_103039062 113
166 3300006048 Ga0075363_100002334 Ga0075363_1000023345 113
167 3300006048 Ga0075363_100006020 Ga0075363_1000060204 113
168 3300006048 Ga0075363_100300448 Ga0075363_1003004481 113
169 3300006051 Ga0075364_10053475 Ga0075364_100534755 113
170 3300006051 Ga0075364_10330236 Ga0075364_103302362 113
171 3300006051 Ga0075364_10413250 Ga0075364_104132502 113
172 3300006163 Ga0070715_10002818 Ga0070715_100028185 113
173 3300006173 Ga0070716_100001631 Ga0070716_1000016318 113
174 3300006173 Ga0070716_101827781 Ga0070716_1018277811 113
175 3300006175 Ga0070712_100007150 Ga0070712_1000071502 113
176 3300006178 Ga0075367_10297985 Ga0075367_102979852 113
177 3300006178 Ga0075367_10354657 Ga0075367_103546571 113
178 3300006178 Ga0075367_11034599 Ga0075367_110345992 113
179 3300006186 Ga0075369_10004452 Ga0075369_100044524 113
180 3300006186 Ga0075369_10012578 Ga0075369_100125783 113
181 3300006186 Ga0075369_10026816 Ga0075369_100268164 113
182 3300006186 Ga0075369_10385118 Ga0075369_103851182 113
183 3300006353 Ga0075370_10029291 Ga0075370_100292915 113
184 3300006353 Ga0075370_10152694 Ga0075370_101526942 113
185 3300006353 Ga0075370_10794959 Ga0075370_107949592 113
186 3300006844 Ga0075428_100014553 Ga0075428_1000145538 113
187 3300006846 Ga0075430_100098198 Ga0075430_1000981981 113
188 3300006847 Ga0075431_100089968 Ga0075431_1000899685 113
189 3300006871 Ga0075434_101628895 Ga0075434_1016288952 113
190 3300006881 Ga0068865_100002240 Ga0068865_10000224012 113
191 3300006931 Ga0097620_100019721 Ga0097620_1000197213 113
192 3300006931 Ga0097620_100338445 Ga0097620_1003384452 113
193 3300006931 Ga0097620_102231981 Ga0097620_1022319812 113
194 3300007788 Ga0099795_10229402 Ga0099795_102294021 113
195 3300009092 Ga0105250_10168412 Ga0105250_101684122 113
196 3300009093 Ga0105240_11046854 Ga0105240_110468541 113
197 3300009098 Ga0105245_10003298 Ga0105245_1000329810 113
198 3300009101 Ga0105247_10001904 Ga0105247_100019049 113
199 3300009147 Ga0114129_10617852 Ga0114129_106178522 113
200 3300009148 Ga0105243_10001353 Ga0105243_1000135313 113
201 3300009174 Ga0105241_10048185 Ga0105241_100481854 113
202 3300009176 Ga0105242_10012280 Ga0105242_100122809 113
203 3300009177 Ga0105248_10006452 Ga0105248_1000645217 113
204 3300009177 Ga0105248_10944609 Ga0105248_109446091 113
205 3300009177 Ga0105248_11119138 Ga0105248_111191381 113
206 3300009545 Ga0105237_10028982 Ga0105237_100289822 113
207 3300009545 Ga0105237_11255355 Ga0105237_112553551 113
208 3300009551 Ga0105238_10092685 Ga0105238_100926854 113
209 3300009553 Ga0105249_10006656 Ga0105249_1000665613 113
210 3300009553 Ga0105249_10033047 Ga0105249_100330474 113
211 3300010375 Ga0105239_10008146 Ga0105239_1000814610 113
212 3300010375 Ga0105239_10707093 Ga0105239_107070931 113
213 3300011119 Ga0105246_10476442 Ga0105246_104764423 113
214 3300013100 Ga0157373_10283325 Ga0157373_102833252 113
215 3300013296 Ga0157374_10771817 Ga0157374_107718173 113
216 3300013297 Ga0157378_10029837 Ga0157378_100298376 113
217 3300013306 Ga0163162_10015988 Ga0163162_100159887 113
218 3300013308 Ga0157375_10004140 Ga0157375_1000414014 113
219 3300014325 Ga0163163_10055612 Ga0163163_100556123 113
220 3300014326 Ga0157380_10042950 Ga0157380_100429506 113
221 3300014745 Ga0157377_10023445 Ga0157377_100234453 113
222 3300014968 Ga0157379_10007492 Ga0157379_1000749212 113
223 3300017792 Ga0163161_10002596 Ga0163161_1000259610 113
224 3300021384 Ga0213876_10349311 Ga0213876_103493113 113
225 3300025885 Ga0207653_10043880 Ga0207653_100438802 113
226 3300025898 Ga0207692_10007036 Ga0207692_100070362 113
227 3300025900 Ga0207710_10275425 Ga0207710_102754252 113
228 3300025900 Ga0207710_10336090 Ga0207710_103360902 113
229 3300025901 Ga0207688_10002256 Ga0207688_100022569 113
230 3300025903 Ga0207680_10014155 Ga0207680_100141552 113
231 3300025903 Ga0207680_10739000 Ga0207680_107390002 113
232 3300025905 Ga0207685_10002905 Ga0207685_100029052 113
233 3300025906 Ga0207699_10426806 Ga0207699_104268063 113
234 3300025911 Ga0207654_10063027 Ga0207654_100630272 113
235 3300025914 Ga0207671_10070883 Ga0207671_100708834 113
236 3300025915 Ga0207693_10002138 Ga0207693_100021389 113
237 3300025916 Ga0207663_10066729 Ga0207663_100667294 113
238 3300025917 Ga0207660_10141829 Ga0207660_101418293 113
239 3300025919 Ga0207657_10426828 Ga0207657_104268282 113
240 3300025923 Ga0207681_10118932 Ga0207681_101189321 113
241 3300025924 Ga0207694_10193712 Ga0207694_101937123 113
242 3300025925 Ga0207650_10325086 Ga0207650_103250863 113
243 3300025926 Ga0207659_10100404 Ga0207659_101004044 113
244 3300025927 Ga0207687_10008447 Ga0207687_100084475 113
245 3300025929 Ga0207664_10224082 Ga0207664_102240822 113
246 3300025931 Ga0207644_10001385 Ga0207644_100013854 113
247 3300025931 Ga0207644_10229309 Ga0207644_102293093 113
248 3300025932 Ga0207690_10739842 Ga0207690_107398422 113
249 3300025933 Ga0207706_10001778 Ga0207706_1000177817 113
250 3300025934 Ga0207686_10085692 Ga0207686_100856922 113
251 3300025935 Ga0207709_10007635 Ga0207709_100076354 113
252 3300025938 Ga0207704_10005156 Ga0207704_1000515611 113
253 3300025939 Ga0207665_10003399 Ga0207665_100033998 113
254 3300025940 Ga0207691_10570953 Ga0207691_105709531 113
255 3300025941 Ga0207711_10036998 Ga0207711_100369983 113
256 3300025941 Ga0207711_10810240 Ga0207711_108102402 113
257 3300025942 Ga0207689_10225905 Ga0207689_102259053 113
258 3300025949 Ga0207667_10250564 Ga0207667_102505642 113
259 3300025961 Ga0207712_10038275 Ga0207712_100382754 113
260 3300025972 Ga0207668_10014668 Ga0207668_100146684 113
261 3300025972 Ga0207668_10090288 Ga0207668_100902882 113
262 3300025981 Ga0207640_10136874 Ga0207640_101368743 113
263 3300025986 Ga0207658_10012942 Ga0207658_100129426 113
264 3300025986 Ga0207658_10035789 Ga0207658_100357894 113
265 3300025986 Ga0207658_10574707 Ga0207658_105747072 113
266 3300026023 Ga0207677_10007113 Ga0207677_100071135 113
267 3300026035 Ga0207703_10014586 Ga0207703_100145865 113
268 3300026035 Ga0207703_11120950 Ga0207703_111209502 113
269 3300026041 Ga0207639_10010629 Ga0207639_100106296 113
270 3300026067 Ga0207678_10016795 Ga0207678_100167955 113
271 3300026075 Ga0207708_10006981 Ga0207708_100069813 113
272 3300026088 Ga0207641_10056044 Ga0207641_100560442 113
273 3300026088 Ga0207641_10711708 Ga0207641_107117082 113
274 3300026089 Ga0207648_10007938 Ga0207648_1000793818 113
275 3300026095 Ga0207676_11805136 Ga0207676_118051362 113
276 3300026118 Ga0207675_100008415 Ga0207675_1000084157 113
277 3300026118 Ga0207675_101341548 Ga0207675_1013415482 113
278 3300026121 Ga0207683_10002944 Ga0207683_1000294418 113
279 3300027512 Ga0209179_1061636 Ga0209179_10616362 113
280 3300028379 Ga0268266_10007089 Ga0268266_100070897 113
281 3300028379 Ga0268266_10103876 Ga0268266_101038763 113
282 3300028380 Ga0268265_10278078 Ga0268265_102780783 113
283 3300028381 Ga0268264_10128722 Ga0268264_101287222 113
284 3300032005 Ga0307411_10518712 Ga0307411_105187122 113
285 3300032126 Ga0307415_100253541 Ga0307415_1002535413 113
286 3300034957 Ga0373938_0191575 Ga0373938_0191575_95_436 113
287 3300035691 Ga0373931_0083708 Ga0373931_0083708_24_365 113
288 3300036459 Ga0372808_041009 Ga0372808_041009_65_415 113
289 3300038443 Ga0395901_2061833 Ga0395901_2061833_145_486 113
290 3300039437 Ga0436365_1159535 Ga0436365_1159535_142_483 113
291 3300044658 Ga0466972_0016444 Ga0466972_0016444_631_972 113
292 3300044694 Ga0466963_0253255 Ga0466963_0253255_691_1032 113
293 3300044735 Ga0466968_0218405 Ga0466968_0218405_410_751 113
294 3300044765 Ga0466970_0115568 Ga0466970_0115568_345_686 113
295 3300044901 Ga0466960_0583835 Ga0466960_0583835_184_525 113
296 3300045836 Ga0466958_0315504 Ga0466958_0315504_386_742 113
297 3300048903 Ga0496100_0003101 Ga0496100_0003101_2654_2995 113
298 3300048904 Ga0496101_0004725 Ga0496101_0004725_8203_8544 113
299 3300048904 Ga0496101_0799603 Ga0496101_0799603_277_618 113
300 3300048905 Ga0496102_0013469 Ga0496102_0013469_1791_2132 113
301 3300048905 Ga0496102_0070790 Ga0496102_0070790_2679_3020 113
302 3300048906 Ga0496103_0000638 Ga0496103_0000638_8114_8455 113
303 3300048906 Ga0496103_0068655 Ga0496103_0068655_251_592 113
304 3300048908 Ga0496105_0169666 Ga0496105_0169666_703_1044 113
305 3300048908 Ga0496105_0695843 Ga0496105_0695843_305_646 113
306 3300048909 Ga0496106_0000851 Ga0496106_0000851_14578_14919 113
307 3300048910 Ga0496107_0027339 Ga0496107_0027339_2047_2388 113
308 3300048911 Ga0496108_0337619 Ga0496108_0337619_856_1197 113
309 3300048912 Ga0496109_0061463 Ga0496109_0061463_1887_2228 113
310 3300048913 Ga0496110_0084620 Ga0496110_0084620_1560_1901 113
311 3300048914 Ga0496111_0011268 Ga0496111_0011268_2084_2425 113
312 3300048915 Ga0496112_0003000 Ga0496112_0003000_8725_9066 113
313 3300048915 Ga0496112_0538557 Ga0496112_0538557_681_1022 113
314 3300048916 Ga0496113_0081102 Ga0496113_0081102_793_1134 113
315 3300048916 Ga0496113_0108705 Ga0496113_0108705_446_793 113
316 3300048916 Ga0496113_1582407 Ga0496113_1582407_14_355 113
317 3300048917 Ga0496114_0005066 Ga0496114_0005066_4952_5293 113
318 3300048917 Ga0496114_0780602 Ga0496114_0780602_13_354 113
319 3300048918 Ga0496115_0007280 Ga0496115_0007280_5211_5552 113
320 3300050490 nmdc:mga03n38_251340_c1 nmdc:mga03n38_251340_c1_215_556 113
321 3300050490 nmdc:mga03n38_58577_c1 nmdc:mga03n38_58577_c1_1105_1446 113
322 3300050491 nmdc:mga00v17_115348_c1 nmdc:mga00v17_115348_c1_1001_1342 113
323 3300050492 nmdc:mga0yw44_69467_c1 nmdc:mga0yw44_69467_c1_937_1278 113
324 3300050494 nmdc:mga06z11_229110_c1 nmdc:mga06z11_229110_c1_134_475 113
325 3300050494 nmdc:mga06z11_790076_c1 nmdc:mga06z11_790076_c1_98_439 113
326 3300050494 nmdc:mga06z11_907036_c1 nmdc:mga06z11_907036_c1_38_379 113
327 3300050496 nmdc:mga07m45_194435_c1 nmdc:mga07m45_194435_c1_88_429 113
328 3300050507 nmdc:mga05p37_228275_c1 nmdc:mga05p37_228275_c1_1693_2034 113
329 3300050509 nmdc:mga0qj67_136182_c1 nmdc:mga0qj67_136182_c1_309_650 113
330 3300050516 nmdc:mga0sz30_12989_c1 nmdc:mga0sz30_12989_c1_2737_3078 113
331 3300050516 nmdc:mga0sz30_25693_c1 nmdc:mga0sz30_25693_c1_1819_2160 113
332 3300050516 nmdc:mga0sz30_4369_c1 nmdc:mga0sz30_4369_c1_3001_3342 113
333 3300053153 Ga0500616_0003087 Ga0500616_0003087_3487_3828 113
334 3300059478 Ga0587093_105030 Ga0587093_105030_152_493 113
335 3300059643 Ga0587072_188349 Ga0587072_188349_155_496 113
336 3300003354 JGI25160J50197_1055960 JGI25160J50197_10559601 114
337 3300005355 Ga0070671_100515899 Ga0070671_1005158992 114
338 3300005434 Ga0070709_10101629 Ga0070709_101016293 114
339 3300005434 Ga0070709_10579727 Ga0070709_105797271 114
340 3300005434 Ga0070709_11551455 Ga0070709_115514551 114
341 3300005435 Ga0070714_100014627 Ga0070714_1000146274 114
342 3300005435 Ga0070714_100535042 Ga0070714_1005350421 114
343 3300005435 Ga0070714_101633775 Ga0070714_1016337752 114
344 3300005436 Ga0070713_100356772 Ga0070713_1003567722 114
345 3300005436 Ga0070713_102400823 Ga0070713_1024008231 114
346 3300005437 Ga0070710_10098735 Ga0070710_100987354 114
347 3300005437 Ga0070710_10376908 Ga0070710_103769083 114
348 3300005437 Ga0070710_10387119 Ga0070710_103871192 114
349 3300005437 Ga0070710_11239824 Ga0070710_112398241 114
350 3300005437 Ga0070710_11449794 Ga0070710_114497941 114
351 3300005439 Ga0070711_101882462 Ga0070711_1018824621 114
352 3300005445 Ga0070708_100013584 Ga0070708_10001358411 114
353 3300005467 Ga0070706_100583427 Ga0070706_1005834272 114
354 3300005468 Ga0070707_100353046 Ga0070707_1003530462 114
355 3300005614 Ga0068856_100970156 Ga0068856_1009701563 114
356 3300005719 Ga0068861_101654380 Ga0068861_1016543802 114
357 3300005841 Ga0068863_100236891 Ga0068863_1002368913 114
358 3300006028 Ga0070717_10911773 Ga0070717_109117732 114
359 3300006038 Ga0075365_10021101 Ga0075365_100211014 114
360 3300006038 Ga0075365_10084632 Ga0075365_100846322 114
361 3300006038 Ga0075365_10089239 Ga0075365_100892393 114
362 3300006038 Ga0075365_10249753 Ga0075365_102497531 114
363 3300006038 Ga0075365_11026785 Ga0075365_110267851 114
364 3300006048 Ga0075363_100051731 Ga0075363_1000517313 114
365 3300006048 Ga0075363_100079221 Ga0075363_1000792213 114
366 3300006051 Ga0075364_10006662 Ga0075364_100066623 114
367 3300006051 Ga0075364_10039979 Ga0075364_100399794 114
368 3300006051 Ga0075364_10055840 Ga0075364_100558404 114
369 3300006051 Ga0075364_10128648 Ga0075364_101286484 114
370 3300006051 Ga0075364_10449365 Ga0075364_104493653 114
371 3300006163 Ga0070715_10004177 Ga0070715_100041773 114
372 3300006173 Ga0070716_100025500 Ga0070716_1000255005 114
373 3300006175 Ga0070712_100211110 Ga0070712_1002111102 114
374 3300006175 Ga0070712_100777633 Ga0070712_1007776332 114
375 3300006175 Ga0070712_101871470 Ga0070712_1018714701 114
376 3300006177 Ga0075362_10356194 Ga0075362_103561942 114
377 3300006178 Ga0075367_10129597 Ga0075367_101295973 114
378 3300006178 Ga0075367_10180546 Ga0075367_101805461 114
379 3300006178 Ga0075367_10410360 Ga0075367_104103602 114
380 3300006178 Ga0075367_10901688 Ga0075367_109016882 114
381 3300006186 Ga0075369_10424872 Ga0075369_104248722 114
382 3300006237 Ga0097621_100507887 Ga0097621_1005078872 114
383 3300006353 Ga0075370_10223618 Ga0075370_102236182 114
384 3300007076 Ga0075435_100578607 Ga0075435_1005786072 114
385 3300009174 Ga0105241_11526043 Ga0105241_115260431 114
386 3300009545 Ga0105237_11243367 Ga0105237_112433672 114
387 3300009551 Ga0105238_10841928 Ga0105238_108419281 114
388 3300010375 Ga0105239_10655611 Ga0105239_106556112 114
389 3300012498 Ga0157345_1059555 Ga0157345_10595551 114
390 3300013105 Ga0157369_10725168 Ga0157369_107251682 114
391 3300013307 Ga0157372_11231789 Ga0157372_112317892 114
392 3300021388 Ga0213875_10046442 Ga0213875_100464422 114
393 3300025302 Ga0207426_1014742 Ga0207426_10147422 114
394 3300025898 Ga0207692_10207298 Ga0207692_102072982 114
395 3300025898 Ga0207692_10552026 Ga0207692_105520262 114
396 3300025905 Ga0207685_10026638 Ga0207685_100266383 114
397 3300025906 Ga0207699_10030008 Ga0207699_100300084 114
398 3300025906 Ga0207699_10034493 Ga0207699_100344933 114
399 3300025915 Ga0207693_10067573 Ga0207693_100675733 114
400 3300025915 Ga0207693_10271285 Ga0207693_102712853 114
401 3300025916 Ga0207663_10473316 Ga0207663_104733162 114
402 3300025916 Ga0207663_11328073 Ga0207663_113280731 114
403 3300025922 Ga0207646_10118711 Ga0207646_101187112 114
404 3300025928 Ga0207700_10091706 Ga0207700_100917063 114
405 3300025928 Ga0207700_10720099 Ga0207700_107200993 114
406 3300025929 Ga0207664_10033835 Ga0207664_100338353 114
407 3300025929 Ga0207664_10039077 Ga0207664_100390772 114
408 3300025929 Ga0207664_10062491 Ga0207664_100624915 114
409 3300025931 Ga0207644_11540861 Ga0207644_115408611 114
410 3300025939 Ga0207665_10072021 Ga0207665_100720213 114
411 3300026023 Ga0207677_10466810 Ga0207677_104668102 114
412 3300026078 Ga0207702_10411469 Ga0207702_104114693 114
413 3300026088 Ga0207641_10337217 Ga0207641_103372174 114
414 3300026142 Ga0207698_11327804 Ga0207698_113278042 114
415 3300028794 Ga0307515_10013555 Ga0307515_1001355511 114
416 3300028794 Ga0307515_10037351 Ga0307515_100373519 114
417 3300030522 Ga0307512_10016119 Ga0307512_100161197 114
418 3300030863 Ga0265766_1021317 Ga0265766_10213172 114
419 3300030882 Ga0265764_112221 Ga0265764_1122212 114
420 3300031043 Ga0265779_111167 Ga0265779_1111672 114
421 3300031456 Ga0307513_10001447 Ga0307513_1000144713 114
422 3300031456 Ga0307513_10281069 Ga0307513_102810692 114
423 3300031507 Ga0307509_10093794 Ga0307509_100937944 114
424 3300031616 Ga0307508_10197969 Ga0307508_101979693 114
425 3300031616 Ga0307508_10648439 Ga0307508_106484392 114
426 3300031730 Ga0307516_10002519 Ga0307516_100025193 114
427 3300031730 Ga0307516_10604636 Ga0307516_106046362 114
428 3300031730 Ga0307516_10705757 Ga0307516_107057572 114
429 3300031838 Ga0307518_10108463 Ga0307518_101084632 114
430 3300033179 Ga0307507_10000090 Ga0307507_1000009032 114
431 3300033179 Ga0307507_10399600 Ga0307507_103996001 114
432 3300033180 Ga0307510_10294973 Ga0307510_102949733 114
433 3300035083 Ga0373926_0001208 Ga0373926_0001208_6507_6851 114
434 3300035089 Ga0373944_0010340 Ga0373944_0010340_1652_1996 114
435 3300035113 Ga0373936_0000687 Ga0373936_0000687_6197_6541 114
436 3300035116 Ga0373945_0000543 Ga0373945_0000543_6329_6673 114
437 3300035120 Ga0373957_0208834 Ga0373957_0208834_306_650 114
438 3300035170 Ga0373943_0000294 Ga0373943_0000294_17616_17960 114
439 3300035170 Ga0373943_0389543 Ga0373943_0389543_154_498 114
440 3300035170 Ga0373943_0437980 Ga0373943_0437980_183_527 114
441 3300035171 Ga0373946_0000333 Ga0373946_0000333_753_1097 114
442 3300035410 Ga0373924_0244556 Ga0373924_0244556_385_729 114
443 3300035692 Ga0373935_0038129 Ga0373935_0038129_2563_2907 114
444 3300035692 Ga0373935_0096349 Ga0373935_0096349_1450_1794 114
445 3300035695 Ga0373927_0033472 Ga0373927_0033472_2801_3145 114
446 3300035695 Ga0373927_0567573 Ga0373927_0567573_266_610 114
447 3300035725 Ga0373947_0000366 Ga0373947_0000366_19028_19372 114
448 3300035725 Ga0373947_0187145 Ga0373947_0187145_63_407 114
449 3300035725 Ga0373947_0410272 Ga0373947_0410272_416_760 114
450 3300037068 Ga0373925_0004806 Ga0373925_0004806_517_861 114
451 3300037418 Ga0395900_0130030 Ga0395900_0130030_462_806 114
452 3300037466 Ga0395898_0000967 Ga0395898_0000967_214_558 114
453 3300037471 Ga0395905_0383175 Ga0395905_0383175_268_612 114
454 3300037853 Ga0436364_1448068 Ga0436364_1448068_6523_6867 114
455 3300038443 Ga0395901_0050096 Ga0395901_0050096_2291_2635 114
456 3300041406 Ga0439439_0011776 Ga0439439_0011776_269_613 114
457 3300041453 Ga0451797_0572430 Ga0451797_0572430_184_528 114
458 3300041463 Ga0451804_0381060 Ga0451804_0381060_238_582 114
459 3300041509 Ga0451843_0192007 Ga0451843_0192007_131_475 114
460 3300041512 Ga0451853_0321697 Ga0451853_0321697_100_456 114
461 3300041999 Ga0439433_0004058 Ga0439433_0004058_1652_1996 114
462 3300042007 Ga0439449_0001367 Ga0439449_0001367_5519_5863 114
463 3300042014 Ga0439457_003638 Ga0439457_003638_1392_1736 114
464 3300044656 Ga0466969_0137673 Ga0466969_0137673_471_815 114
465 3300044684 Ga0466966_0044209 Ga0466966_0044209_2415_2759 114
466 3300044684 Ga0466966_0908793 Ga0466966_0908793_30_374 114
467 3300044693 Ga0466961_0220442 Ga0466961_0220442_516_860 114
468 3300044694 Ga0466963_0395146 Ga0466963_0395146_551_913 114
469 3300044694 Ga0466963_0817024 Ga0466963_0817024_164_508 114
470 3300044719 Ga0466971_0454048 Ga0466971_0454048_110_454 114
471 3300044735 Ga0466968_0107092 Ga0466968_0107092_845_1189 114
472 3300044735 Ga0466968_0150607 Ga0466968_0150607_222_566 114
473 3300044842 Ga0466957_0165703 Ga0466957_0165703_203_547 114
474 3300045049 Ga0466959_0223801 Ga0466959_0223801_734_1078 114
475 3300045836 Ga0466958_0060390 Ga0466958_0060390_1759_2103 114
476 3300045976 Ga0466967_0221669 Ga0466967_0221669_319_663 114
477 3300045976 Ga0466967_0626896 Ga0466967_0626896_561_905 114
478 3300046454 Ga0495592_0000338 Ga0495592_0000338_37646_37993 114
479 3300046459 Ga0495629_0497543 Ga0495629_0497543_204_551 114
480 3300046460 Ga0495638_0162577 Ga0495638_0162577_787_1131 114
481 3300046461 Ga0495641_0123460 Ga0495641_0123460_747_1091 114
482 3300046462 Ga0495651_0000436 Ga0495651_0000436_318_665 114
483 3300046462 Ga0495651_0223143 Ga0495651_0223143_802_1146 114
484 3300046463 Ga0495653_0014057 Ga0495653_0014057_3723_4070 114
485 3300046463 Ga0495653_0022636 Ga0495653_0022636_705_1049 114
486 3300046475 Ga0495639_0063782 Ga0495639_0063782_241_585 114
487 3300046476 Ga0495662_0177879 Ga0495662_0177879_672_1019 114
488 3300046476 Ga0495662_0396988 Ga0495662_0396988_312_656 114
489 3300046477 Ga0495664_0028227 Ga0495664_0028227_144_488 114
490 3300046511 Ga0495608_0061454 Ga0495608_0061454_1381_1725 114
491 3300046514 Ga0495618_0064466 Ga0495618_0064466_976_1320 114
492 3300046517 Ga0495630_0000359 Ga0495630_0000359_32073_32420 114
493 3300046517 Ga0495630_0375039 Ga0495630_0375039_540_884 114
494 3300046529 Ga0495652_0055768 Ga0495652_0055768_125_469 114
495 3300046531 Ga0495665_0009674 Ga0495665_0009674_213_560 114
496 3300046536 Ga0495587_0092851 Ga0495587_0092851_918_1262 114
497 3300046543 Ga0495645_0259752 Ga0495645_0259752_613_957 114
498 3300046559 Ga0495667_0025134 Ga0495667_0025134_2191_2535 114
499 3300046642 Ga0495634_0019164 Ga0495634_0019164_3998_4342 114
500 3300046642 Ga0495634_0039098 Ga0495634_0039098_2792_3154 114
501 3300046663 Ga0495635_0035888 Ga0495635_0035888_2776_3120 114
502 3300046675 Ga0495657_0041857 Ga0495657_0041857_2343_2687 114
503 3300046678 Ga0495599_0744449 Ga0495599_0744449_186_530 114
504 3300046679 Ga0495623_0094568 Ga0495623_0094568_1183_1530 114
505 3300046680 Ga0495646_0000169 Ga0495646_0000169_32237_32584 114
506 3300046689 Ga0495613_1015008 Ga0495613_1015008_162_506 114
507 3300046690 Ga0495624_0000781 Ga0495624_0000781_6015_6359 114
508 3300046809 Ga0495600_0031605 Ga0495600_0031605_1186_1548 114
509 3300046809 Ga0495600_0587786 Ga0495600_0587786_42_386 114
510 3300047315 Ga0495581_0007309 Ga0495581_0007309_457_801 114
511 3300047319 Ga0495674_0000657 Ga0495674_0000657_25881_26225 114
512 3300047321 Ga0495676_0067255 Ga0495676_0067255_1275_1619 114
513 3300047322 Ga0495680_0006292 Ga0495680_0006292_8704_9048 114
514 3300047471 Ga0495684_0230562 Ga0495684_0230562_856_1200 114
515 3300048088 Ga0495602_0260374 Ga0495602_0260374_196_540 114
516 3300048903 Ga0496100_0798004 Ga0496100_0798004_133_477 114
517 3300048905 Ga0496102_0032674 Ga0496102_0032674_787_1134 114
518 3300048907 Ga0496104_0444230 Ga0496104_0444230_233_577 114
519 3300048908 Ga0496105_0609144 Ga0496105_0609144_446_790 114
520 3300048911 Ga0496108_0173882 Ga0496108_0173882_1315_1659 114
521 3300048912 Ga0496109_0506164 Ga0496109_0506164_219_563 114
522 3300048913 Ga0496110_1501552 Ga0496110_1501552_95_439 114
523 3300048914 Ga0496111_0640985 Ga0496111_0640985_159_503 114
524 3300048915 Ga0496112_0212603 Ga0496112_0212603_1514_1858 114
525 3300048929 Ga0496126_0364197 Ga0496126_0364197_120_464 114
526 3300049571 Ga0501034_0759007 Ga0501034_0759007_332_676 114
527 3300050489 nmdc:mga03683_61232_c1 nmdc:mga03683_61232_c1_1197_1541 114
528 3300050490 nmdc:mga03n38_53227_c1 nmdc:mga03n38_53227_c1_715_1059 114
529 3300050491 nmdc:mga00v17_34982_c2 nmdc:mga00v17_34982_c2_1159_1503 114
530 3300050491 nmdc:mga00v17_83170_c1 nmdc:mga00v17_83170_c1_1365_1709 114
531 3300050491 nmdc:mga00v17_8482_c1 nmdc:mga00v17_8482_c1_4070_4414 114
532 3300050491 nmdc:mga00v17_935541_c1 nmdc:mga00v17_935541_c1_50_394 114
533 3300050492 nmdc:mga0yw44_269178_c1 nmdc:mga0yw44_269178_c1_54_398 114
534 3300050492 nmdc:mga0yw44_513203_c1 nmdc:mga0yw44_513203_c1_42_386 114
535 3300050492 nmdc:mga0yw44_551439_c1 nmdc:mga0yw44_551439_c1_295_639 114
536 3300050492 nmdc:mga0yw44_647906_c1 nmdc:mga0yw44_647906_c1_169_513 114
537 3300050494 nmdc:mga06z11_393054_c1 nmdc:mga06z11_393054_c1_310_654 114
538 3300050494 nmdc:mga06z11_437005_c1 nmdc:mga06z11_437005_c1_264_608 114
539 3300050494 nmdc:mga06z11_931858_c1 nmdc:mga06z11_931858_c1_37_381 114
540 3300050512 nmdc:mga0n895_1042456_c1 nmdc:mga0n895_1042456_c1_412_756 114
541 3300050513 nmdc:mga0rr50_396358_c1 nmdc:mga0rr50_396358_c1_808_1152 114
542 3300053077 Ga0495601_0042212 Ga0495601_0042212_2293_2655 114
543 3300053078 Ga0495612_0009997 Ga0495612_0009997_2184_2546 114
544 3300053084 Ga0495595_0345181 Ga0495595_0345181_27_371 114
545 3300053085 Ga0495619_0055007 Ga0495619_0055007_1959_2306 114
546 3300053085 Ga0495619_0518370 Ga0495619_0518370_252_596 114
547 3300053088 Ga0500644_0012178 Ga0500644_0012178_1004_1348 114
548 3300053090 Ga0500646_0095653 Ga0500646_0095653_492_836 114
549 3300053090 Ga0500646_0329660 Ga0500646_0329660_152_496 114
550 3300053094 Ga0500566_0005968 Ga0500566_0005968_664_1008 114
551 3300053098 Ga0500650_0214146 Ga0500650_0214146_165_509 114
552 3300053104 Ga0500556_0188818 Ga0500556_0188818_149_493 114
553 3300053131 Ga0500652_061681 Ga0500652_061681_1047_1391 114
554 3300053153 Ga0500616_0116274 Ga0500616_0116274_243_587 114
555 3300053727 Ga0500611_037074 Ga0500611_037074_119_463 114
556 3300059492 Ga0587073_0246022 Ga0587073_0246022_76_420 114
557 3300048922 Ga0496119_0207558 Ga0496119_0207558_34_381 115
558 3300001990 JGI24737J22298_10029444 JGI24737J22298_100294443 116
559 3300001991 JGI24743J22301_10002724 JGI24743J22301_100027243 116
560 3300001991 JGI24743J22301_10003790 JGI24743J22301_100037905 116
561 3300002073 JGI24745J21846_1008600 JGI24745J21846_10086002 116
562 3300002074 JGI24748J21848_1014728 JGI24748J21848_10147282 116
563 3300002244 JGI24742J22300_10054849 JGI24742J22300_100548493 116
564 3300005334 Ga0068869_100909791 Ga0068869_1009097912 116
565 3300005335 Ga0070666_10446687 Ga0070666_104466872 116
566 3300005336 Ga0070680_101100509 Ga0070680_1011005092 116
567 3300005338 Ga0068868_100120875 Ga0068868_1001208753 116
568 3300005338 Ga0068868_100459682 Ga0068868_1004596821 116
569 3300005343 Ga0070687_100374472 Ga0070687_1003744722 116
570 3300005347 Ga0070668_100512717 Ga0070668_1005127172 116
571 3300005356 Ga0070674_100484940 Ga0070674_1004849401 116
572 3300005365 Ga0070688_100034762 Ga0070688_1000347622 116
573 3300005434 Ga0070709_10182129 Ga0070709_101821291 116
574 3300005435 Ga0070714_100155966 Ga0070714_1001559662 116
575 3300005436 Ga0070713_100024506 Ga0070713_1000245062 116
576 3300005438 Ga0070701_10057237 Ga0070701_100572373 116
577 3300005440 Ga0070705_100131616 Ga0070705_1001316162 116
578 3300005441 Ga0070700_100021032 Ga0070700_1000210323 116
579 3300005546 Ga0070696_100246816 Ga0070696_1002468163 116
580 3300005547 Ga0070693_100856860 Ga0070693_1008568602 116
581 3300005548 Ga0070665_100117553 Ga0070665_1001175532 116
582 3300005563 Ga0068855_100285905 Ga0068855_1002859052 116
583 3300005563 Ga0068855_101562486 Ga0068855_1015624861 116
584 3300005617 Ga0068859_100000044 Ga0068859_100000044141 116
585 3300005618 Ga0068864_100131730 Ga0068864_1001317303 116
586 3300005840 Ga0068870_10530848 Ga0068870_105308482 116
587 3300005841 Ga0068863_100089808 Ga0068863_1000898082 116
588 3300005842 Ga0068858_100054705 Ga0068858_1000547053 116
589 3300005843 Ga0068860_100364393 Ga0068860_1003643933 116
590 3300005844 Ga0068862_100481815 Ga0068862_1004818152 116
591 3300005981 Ga0081538_10111883 Ga0081538_101118833 116
592 3300006028 Ga0070717_10533832 Ga0070717_105338322 116
593 3300006173 Ga0070716_101719316 Ga0070716_1017193162 116
594 3300006175 Ga0070712_100277263 Ga0070712_1002772631 116
595 3300006178 Ga0075367_10124073 Ga0075367_101240732 116
596 3300006237 Ga0097621_100580725 Ga0097621_1005807252 116
597 3300006353 Ga0075370_10007156 Ga0075370_100071562 116
598 3300006852 Ga0075433_10505741 Ga0075433_105057413 116
599 3300006931 Ga0097620_100000044 Ga0097620_100000044141 116
600 3300009036 Ga0105244_10213707 Ga0105244_102137072 116
601 3300009093 Ga0105240_12511821 Ga0105240_125118211 116
602 3300009098 Ga0105245_10707297 Ga0105245_107072972 116
603 3300009098 Ga0105245_10722784 Ga0105245_107227842 116
604 3300009101 Ga0105247_10015654 Ga0105247_100156545 116
605 3300009177 Ga0105248_12294114 Ga0105248_122941141 116
606 3300009545 Ga0105237_10630005 Ga0105237_106300052 116
607 3300009545 Ga0105237_10795809 Ga0105237_107958092 116
608 3300009553 Ga0105249_10341596 Ga0105249_103415962 116
609 3300010375 Ga0105239_10411845 Ga0105239_104118454 116
610 3300013296 Ga0157374_10018933 Ga0157374_100189332 116
611 3300013297 Ga0157378_10522278 Ga0157378_105222783 116
612 3300013306 Ga0163162_10998113 Ga0163162_109981132 116
613 3300013308 Ga0157375_10006206 Ga0157375_100062064 116
614 3300014326 Ga0157380_10240074 Ga0157380_102400743 116
615 3300014326 Ga0157380_10793598 Ga0157380_107935982 116
616 3300014745 Ga0157377_10052736 Ga0157377_100527362 116
617 3300017792 Ga0163161_10174330 Ga0163161_101743302 116
618 3300017792 Ga0163161_10726265 Ga0163161_107262652 116
619 3300020076 Ga0206355_1651516 Ga0206355_16515162 116
620 3300020081 Ga0206354_11416303 Ga0206354_114163034 116
621 3300020082 Ga0206353_10179585 Ga0206353_101795854 116
622 3300021384 Ga0213876_10001772 Ga0213876_100017724 116
623 3300025900 Ga0207710_10665116 Ga0207710_106651162 116
624 3300025901 Ga0207688_10015760 Ga0207688_100157604 116
625 3300025903 Ga0207680_10439242 Ga0207680_104392422 116
626 3300025906 Ga0207699_10551351 Ga0207699_105513512 116
627 3300025906 Ga0207699_11098280 Ga0207699_110982801 116
628 3300025913 Ga0207695_11496840 Ga0207695_114968402 116
629 3300025914 Ga0207671_10558867 Ga0207671_105588673 116
630 3300025915 Ga0207693_10243901 Ga0207693_102439011 116
631 3300025917 Ga0207660_10853807 Ga0207660_108538072 116
632 3300025927 Ga0207687_11956603 Ga0207687_119566032 116
633 3300025928 Ga0207700_10718081 Ga0207700_107180812 116
634 3300025929 Ga0207664_10102470 Ga0207664_101024703 116
635 3300025939 Ga0207665_11563964 Ga0207665_115639642 116
636 3300025940 Ga0207691_10024897 Ga0207691_100248975 116
637 3300025940 Ga0207691_11123783 Ga0207691_111237832 116
638 3300025941 Ga0207711_10515901 Ga0207711_105159012 116
639 3300025942 Ga0207689_10030701 Ga0207689_100307015 116
640 3300025949 Ga0207667_10526029 Ga0207667_105260292 116
641 3300025949 Ga0207667_11802116 Ga0207667_118021161 116
642 3300025960 Ga0207651_10237321 Ga0207651_102373212 116
643 3300025961 Ga0207712_10083241 Ga0207712_100832412 116
644 3300025972 Ga0207668_10111236 Ga0207668_101112364 116
645 3300026023 Ga0207677_10195011 Ga0207677_101950113 116
646 3300026035 Ga0207703_10048420 Ga0207703_100484201 116
647 3300026035 Ga0207703_10688462 Ga0207703_106884622 116
648 3300026041 Ga0207639_10639809 Ga0207639_106398091 116
649 3300026075 Ga0207708_10032029 Ga0207708_100320292 116
650 3300026088 Ga0207641_10089736 Ga0207641_100897363 116
651 3300026095 Ga0207676_10071437 Ga0207676_100714372 116
652 3300026142 Ga0207698_10400126 Ga0207698_104001262 116
653 3300028379 Ga0268266_10019158 Ga0268266_100191585 116
654 3300028794 Ga0307515_10377607 Ga0307515_103776071 116
655 3300031456 Ga0307513_10458326 Ga0307513_104583262 116
656 3300035086 Ga0373934_0278080 Ga0373934_0278080_216_566 116
657 3300035113 Ga0373936_0005405 Ga0373936_0005405_1681_2031 116
658 3300035115 Ga0373941_0044303 Ga0373941_0044303_845_1195 116
659 3300035117 Ga0373953_0039885 Ga0373953_0039885_244_594 116
660 3300035118 Ga0373954_0066097 Ga0373954_0066097_269_619 116
661 3300035692 Ga0373935_0955298 Ga0373935_0955298_161_511 116
662 3300035724 Ga0373933_0206277 Ga0373933_0206277_286_636 116
663 3300036401 Ga0373937_0033012 Ga0373937_0033012_2493_2843 116
664 3300037068 Ga0373925_0255757 Ga0373925_0255757_810_1160 116
665 3300038443 Ga0395901_0866824 Ga0395901_0866824_242_592 116
666 3300039437 Ga0436365_1258441 Ga0436365_1258441_169_546 116
667 3300039437 Ga0436365_1483817 Ga0436365_1483817_2132_2509 116
668 3300044658 Ga0466972_0030862 Ga0466972_0030862_1874_2224 116
669 3300044684 Ga0466966_0066180 Ga0466966_0066180_333_716 116
670 3300044693 Ga0466961_0006230 Ga0466961_0006230_5616_5999 116
671 3300044694 Ga0466963_0062359 Ga0466963_0062359_613_963 116
672 3300044694 Ga0466963_1192531 Ga0466963_1192531_65_415 116
673 3300044706 Ga0466964_0799686 Ga0466964_0799686_22_405 116
674 3300044719 Ga0466971_0000363 Ga0466971_0000363_1473_1856 116
675 3300044765 Ga0466970_0029299 Ga0466970_0029299_2108_2458 116
676 3300045049 Ga0466959_0017959 Ga0466959_0017959_2850_3200 116
677 3300045836 Ga0466958_0003984 Ga0466958_0003984_2838_3188 116
678 3300045836 Ga0466958_0011624 Ga0466958_0011624_4088_4471 116
679 3300045976 Ga0466967_0161463 Ga0466967_0161463_1621_1971 116
680 3300046454 Ga0495592_0373894 Ga0495592_0373894_233_583 116
681 3300046459 Ga0495629_0080691 Ga0495629_0080691_306_692 116
682 3300046459 Ga0495629_0545982 Ga0495629_0545982_234_584 116
683 3300046461 Ga0495641_0280929 Ga0495641_0280929_177_527 116
684 3300046462 Ga0495651_0056166 Ga0495651_0056166_239_589 116
685 3300046463 Ga0495653_0022668 Ga0495653_0022668_3378_3728 116
686 3300046511 Ga0495608_0094074 Ga0495608_0094074_1335_1685 116
687 3300046516 Ga0495628_0834969 Ga0495628_0834969_49_399 116
688 3300046517 Ga0495630_0728973 Ga0495630_0728973_148_498 116
689 3300046529 Ga0495652_0399966 Ga0495652_0399966_412_762 116
690 3300046536 Ga0495587_0519307 Ga0495587_0519307_276_626 116
691 3300046559 Ga0495667_0042022 Ga0495667_0042022_2424_2774 116
692 3300046663 Ga0495635_0014225 Ga0495635_0014225_4867_5217 116
693 3300046675 Ga0495657_0105985 Ga0495657_0105985_1380_1730 116
694 3300046679 Ga0495623_0539413 Ga0495623_0539413_18_368 116
695 3300047319 Ga0495674_0185098 Ga0495674_0185098_969_1319 116
696 3300047322 Ga0495680_0738060 Ga0495680_0738060_144_494 116
697 3300048088 Ga0495602_0524714 Ga0495602_0524714_294_644 116
698 3300048905 Ga0496102_0415608 Ga0496102_0415608_855_1205 116
699 3300048909 Ga0496106_0020856 Ga0496106_0020856_219_569 116
700 3300048910 Ga0496107_0615483 Ga0496107_0615483_246_596 116
701 3300048911 Ga0496108_0001502 Ga0496108_0001502_5549_5899 116
702 3300048912 Ga0496109_0006002 Ga0496109_0006002_7310_7660 116
703 3300048913 Ga0496110_0365545 Ga0496110_0365545_319_669 116
704 3300048915 Ga0496112_0100483 Ga0496112_0100483_2364_2714 116
705 3300048916 Ga0496113_0324320 Ga0496113_0324320_706_1056 116
706 3300048918 Ga0496115_0799962 Ga0496115_0799962_323_685 116
707 3300049568 Ga0501031_0096461 Ga0501031_0096461_1524_1886 116
708 3300049569 Ga0501032_0204739 Ga0501032_0204739_799_1161 116
709 3300049570 Ga0501033_0039523 Ga0501033_0039523_2714_3076 116
710 3300049571 Ga0501034_0085696 Ga0501034_0085696_1552_1914 116
711 3300049572 Ga0501036_0073697 Ga0501036_0073697_1151_1513 116
712 3300049573 Ga0501037_0288738 Ga0501037_0288738_428_790 116
713 3300049574 Ga0501038_0025400 Ga0501038_0025400_2606_2968 116
714 3300049575 Ga0501039_0952650 Ga0501039_0952650_73_435 116
715 3300049579 Ga0501043_0163212 Ga0501043_0163212_1228_1590 116
716 3300049586 Ga0501070_0068608 Ga0501070_0068608_1263_1625 116
717 3300049588 Ga0501072_1464448 Ga0501072_1464448_131_493 116
718 3300049822 Ga0501035_0174123 Ga0501035_0174123_1112_1474 116
719 3300049823 Ga0501044_0145020 Ga0501044_0145020_1551_1913 116
720 3300049824 Ga0501045_0186590 Ga0501045_0186590_852_1214 116
721 3300050493 nmdc:mga0k408_434063_c1 nmdc:mga0k408_434063_c1_364_714 116
722 3300050495 nmdc:mga04h51_162848_c1 nmdc:mga04h51_162848_c1_257_607 116
723 3300050496 nmdc:mga07m45_3342_c1 nmdc:mga07m45_3342_c1_818_1168 116
724 3300050515 nmdc:mga0a205_446637_c1 nmdc:mga0a205_446637_c1_557_907 116
725 3300050516 nmdc:mga0sz30_68842_c1 nmdc:mga0sz30_68842_c1_223_573 116
726 3300061719 Ga0466962_0004991 Ga0466962_0004991_1578_1961 116
727 3300061719 Ga0466962_0128654 Ga0466962_0128654_450_800 116

Structural Annotation

Top 5 Hits

ID Description Score Start End
7a76-assembly1.cif.gz_C bacillithiol disulfide reductase bdr (ypda) from bacillus cereus 0.7842 79 108
3s5w-assembly1.cif.gz_A ornithine hydroxylase (pvda) from pseudomonas aeruginosa 0.78 78 108
3s61-assembly1.cif.gz_A reduced form of ornithine hydroxylase (pvda) from pseudomonas aeruginosa 0.7766 78 108
3oxh-assembly1.cif.gz_A mycobacterium tuberculosis kinase inhibitor homolog rv0577 0.7546 3 110
5j5z-assembly1.cif.gz_B crystal structure of the d444v disease-causing mutant of the human dihydrolipoamide dehydrogenase 0.7463 78 107
ID Description Score Start End Superfamily
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.7957 77 110 3.30.720.110
2kjzB01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.7904 1 53 3.30.720.120
af_Q8IMG8_32_291_3.40.850.10 Alpha Beta;3-Layer(aba) Sandwich;Kinesin;Kinesin motor domain 0.7881 91 108 3.40.850.10
af_Q2FVD9_38_137_3.10.450.130 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,;folded 79 residue fragment of lin0334 like domains 0.7774 78 107 3.10.450.130
3oxhA01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7624 2 110 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A1E7N0R6-F1-model_v4 Glyoxalase 0.9702 1 114
AF-A0A1T4S1E5-F1-model_v4 Ribbon-helix-helix protein, copG family 0.97 1 110 GO:0006355
AF-A0A370HE07-F1-model_v4 Glyoxalase 0.9624 1 111
AF-A0A1E7N0R6-F1-model_v4 Glyoxalase 0.9618 1 114
AF-Q0RTL6-F1-model_v4 Glyoxalase-like domain-containing protein 0.9603 12 112

Feature Viewer

pLDDT pTM Quality
93.99 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map