F477730
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 727 | 367 | 716 | 114 |
Family's Representative Sequence
| Representative Sequence | 3300005434|Ga0070709_10182129|Ga0070709_101821291 |
| Length | 129 |
| Sequence | MATEGIEAVFMETHNWGRAAKFFQALGYRLDFETDHNSGQLSNGTGPSVFIAEVPADRETDLQLVLKVPDAAACRLDPVVEVVTPFEDTHFGTRIMTVRDPDGRLWSLQAPAAATAGGAAHAGNGAGHE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2506783011 | Frankia datiscae Dg1 | Isolate | Nodule |
| 2 | 2508501039 | Frankia saprophytica CN3 | Isolate | Nodule |
| 3 | 2547132424 | Nocardia nova SH22a | Isolate | Unclassified |
| 4 | 2675902999 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 5 | 2773857921 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 6 | 2866612099 | Amycolatopsis suaedae 8-3EHSu | Isolate | Unclassified |
| 7 | 2870782633 | Pseudonocardia eucalypti DSM 45351 | Isolate | Unclassified |
| 8 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 9 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 10 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 11 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 12 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 13 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 14 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 15 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 16 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 17 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 18 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 19 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 20 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 22 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 49 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 68 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 69 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 70 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 71 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 72 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 73 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 74 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 75 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 76 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 78 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 79 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 80 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 84 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 85 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 86 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 88 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 89 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 90 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 91 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 92 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 93 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 94 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 96 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 97 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 113 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 126 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 127 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 128 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 129 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 130 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 131 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 187 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 188 | 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 189 | 3300030882 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 190 | 3300031043 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 191 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 192 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 193 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 194 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 195 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 196 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 197 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 198 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 199 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 200 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 201 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 202 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 203 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 204 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 205 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 206 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 207 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 208 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 209 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 210 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 211 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 212 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 213 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 214 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 215 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 216 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 217 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 218 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 219 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 220 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 221 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 222 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 223 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 224 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 225 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 226 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 227 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 228 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 229 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 230 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 231 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 232 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 233 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 234 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 235 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 236 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 237 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 238 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 239 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 240 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 241 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 242 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 243 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 244 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 245 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 246 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 247 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 248 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 249 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 250 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 251 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 252 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 253 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 254 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 255 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 256 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 296 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 297 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 298 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 299 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 300 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 301 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 302 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 303 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 304 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 305 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 306 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 307 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 308 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 309 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 310 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 311 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 312 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 313 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 314 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 315 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 316 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 331 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 332 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 333 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 334 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 335 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 336 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 337 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 338 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 341 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 344 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 347 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 350 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 351 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 352 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 353 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 354 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 355 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 356 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 357 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 358 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 359 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 360 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 361 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 362 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 363 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 364 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 365 | 8002784119 | Frankia sp. AgB1.9 | Isolate | Nodule |
| 366 | 8054160619 | Streptomyces rhizoryzae RS10V-4 | Isolate | Rhizosphere |
| 367 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.11 |
| Metatranscriptomes | 1.38 |
| Isolates | 1.51 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.62 |
| Nodule | 0.69 |
| Rhizoplane | 6.74 |
| Rhizosphere | 73.45 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.5 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10029444 | 3300001990 | Bacteria | 1722 |
| 2 | JGI24743J22301_10002724 | 3300001991 | Bacteria | 2706 |
| 3 | JGI24743J22301_10003790 | 3300001991 | Bacteria | 2417 |
| 4 | JGI24750J21931_1030232 | 3300002070 | Bacteria | 792 |
| 5 | JGI24750J21931_1039437 | 3300002070 | Bacteria | 714 |
| 6 | JGI24745J21846_1008600 | 3300002073 | Bacteria | 1152 |
| 7 | JGI24748J21848_1014728 | 3300002074 | Bacteria | 929 |
| 8 | JGI24738J21930_10007081 | 3300002075 | Bacteria | 2604 |
| 9 | JGI24749J21850_1004169 | 3300002076 | Bacteria | 2020 |
| 10 | JGI24744J21845_10000768 | 3300002077 | Bacteria | 5983 |
| 11 | JGI24742J22300_10054849 | 3300002244 | Bacteria | 726 |
| 12 | rootH1_10064519 | 3300003323 | Bacteria | 1138 |
| 13 | JGI25160J50197_1007165 | 3300003354 | Bacteria | 4395 |
| 14 | JGI25160J50197_1055960 | 3300003354 | Bacteria | 810 |
| 15 | Ga0070690_100053684 | 3300005330 | Bacteria | 2578 |
| 16 | Ga0068869_100046073 | 3300005334 | Bacteria | 3143 |
| 17 | Ga0068869_100909791 | 3300005334 | Bacteria | 762 |
| 18 | Ga0068869_101122902 | 3300005334 | Bacteria | 688 |
| 19 | Ga0070666_10446687 | 3300005335 | Bacteria | 933 |
| 20 | Ga0070666_10576461 | 3300005335 | Bacteria | 820 |
| 21 | Ga0070680_100243202 | 3300005336 | Bacteria | 1521 |
| 22 | Ga0070680_101100509 | 3300005336 | Bacteria | 687 |
| 23 | Ga0068868_100085099 | 3300005338 | Bacteria | 2540 |
| 24 | Ga0068868_100120875 | 3300005338 | Bacteria | 2136 |
| 25 | Ga0068868_100459682 | 3300005338 | Bacteria | 1108 |
| 26 | Ga0068868_101014736 | 3300005338 | Bacteria | 760 |
| 27 | Ga0070660_100102747 | 3300005339 | Bacteria | 2266 |
| 28 | Ga0070691_10006144 | 3300005341 | Bacteria | 5480 |
| 29 | Ga0070687_100374472 | 3300005343 | Bacteria | 926 |
| 30 | Ga0070668_100005230 | 3300005347 | Bacteria | 9627 |
| 31 | Ga0070668_100137539 | 3300005347 | Bacteria | 1966 |
| 32 | Ga0070668_100172169 | 3300005347 | Bacteria | 1763 |
| 33 | Ga0070668_100512717 | 3300005347 | Bacteria | 1039 |
| 34 | Ga0070668_100750618 | 3300005347 | Bacteria | 864 |
| 35 | Ga0070669_100010473 | 3300005353 | Bacteria | 6586 |
| 36 | Ga0070675_100153278 | 3300005354 | Bacteria | 1977 |
| 37 | Ga0070671_100001105 | 3300005355 | Bacteria | 20006 |
| 38 | Ga0070671_100056915 | 3300005355 | Bacteria | 3253 |
| 39 | Ga0070671_100515899 | 3300005355 | Bacteria | 1029 |
| 40 | Ga0070674_100002194 | 3300005356 | Bacteria | 10727 |
| 41 | Ga0070674_100484940 | 3300005356 | Bacteria | 1027 |
| 42 | Ga0070688_100002996 | 3300005365 | Bacteria | 8617 |
| 43 | Ga0070688_100034762 | 3300005365 | Bacteria | 3056 |
| 44 | Ga0070659_100160147 | 3300005366 | Bacteria | 1840 |
| 45 | Ga0070667_100004831 | 3300005367 | Bacteria | 11291 |
| 46 | Ga0070667_100019932 | 3300005367 | Bacteria | 5565 |
| 47 | Ga0070667_100057013 | 3300005367 | Bacteria | 3300 |
| 48 | Ga0070709_10101629 | 3300005434 | Bacteria | 1916 |
| 49 | Ga0070709_10182129 | 3300005434 | Bacteria | 1476 |
| 50 | Ga0070709_10579727 | 3300005434 | Bacteria | 861 |
| 51 | Ga0070709_11551455 | 3300005434 | Bacteria | 539 |
| 52 | Ga0070714_100014627 | 3300005435 | Bacteria | 6307 |
| 53 | Ga0070714_100155966 | 3300005435 | Bacteria | 2061 |
| 54 | Ga0070714_100231039 | 3300005435 | Bacteria | 1704 |
| 55 | Ga0070714_100535042 | 3300005435 | Bacteria | 1120 |
| 56 | Ga0070714_101633775 | 3300005435 | Bacteria | 629 |
| 57 | Ga0070713_100024506 | 3300005436 | Bacteria | 4701 |
| 58 | Ga0070713_100356772 | 3300005436 | Bacteria | 1357 |
| 59 | Ga0070713_102400823 | 3300005436 | Bacteria | 510 |
| 60 | Ga0070710_10007509 | 3300005437 | Bacteria | 5281 |
| 61 | Ga0070710_10098735 | 3300005437 | Bacteria | 1735 |
| 62 | Ga0070710_10376908 | 3300005437 | Bacteria | 945 |
| 63 | Ga0070710_10387119 | 3300005437 | Bacteria | 934 |
| 64 | Ga0070710_11239824 | 3300005437 | Bacteria | 552 |
| 65 | Ga0070710_11449794 | 3300005437 | Bacteria | 514 |
| 66 | Ga0070701_10057237 | 3300005438 | Bacteria | 2043 |
| 67 | Ga0070711_100003545 | 3300005439 | Bacteria | 9107 |
| 68 | Ga0070711_101882462 | 3300005439 | Bacteria | 525 |
| 69 | Ga0070705_100007488 | 3300005440 | Bacteria | 5374 |
| 70 | Ga0070705_100131616 | 3300005440 | Bacteria | 1633 |
| 71 | Ga0070700_100011622 | 3300005441 | Bacteria | 4881 |
| 72 | Ga0070700_100021032 | 3300005441 | Bacteria | 3789 |
| 73 | Ga0070708_100013584 | 3300005445 | Bacteria | 6674 |
| 74 | Ga0070663_100226980 | 3300005455 | Bacteria | 1469 |
| 75 | Ga0070678_100002269 | 3300005456 | Bacteria | 10464 |
| 76 | Ga0070678_102151678 | 3300005456 | Bacteria | 529 |
| 77 | Ga0070662_100012535 | 3300005457 | Bacteria | 5623 |
| 78 | Ga0070662_100257661 | 3300005457 | Bacteria | 1404 |
| 79 | Ga0068867_101516052 | 3300005459 | Bacteria | 625 |
| 80 | Ga0070685_10096375 | 3300005466 | Bacteria | 1800 |
| 81 | Ga0070685_10425575 | 3300005466 | Bacteria | 925 |
| 82 | Ga0070706_100583427 | 3300005467 | Bacteria | 1039 |
| 83 | Ga0070707_100353046 | 3300005468 | Bacteria | 1428 |
| 84 | Ga0070679_100192987 | 3300005530 | Bacteria | 2005 |
| 85 | Ga0070697_100307168 | 3300005536 | Bacteria | 1364 |
| 86 | Ga0068853_100006828 | 3300005539 | Bacteria | 9101 |
| 87 | Ga0070672_100153486 | 3300005543 | Bacteria | 1906 |
| 88 | Ga0070686_100121298 | 3300005544 | Bacteria | 1795 |
| 89 | Ga0070686_100130176 | 3300005544 | Bacteria | 1739 |
| 90 | Ga0070696_100004005 | 3300005546 | Bacteria | 9820 |
| 91 | Ga0070696_100246816 | 3300005546 | Bacteria | 1349 |
| 92 | Ga0070693_100012471 | 3300005547 | Bacteria | 4301 |
| 93 | Ga0070693_100856860 | 3300005547 | Bacteria | 678 |
| 94 | Ga0070665_100002727 | 3300005548 | Bacteria | 19143 |
| 95 | Ga0070665_100053329 | 3300005548 | Bacteria | 4055 |
| 96 | Ga0070665_100117553 | 3300005548 | Bacteria | 2661 |
| 97 | Ga0070704_100000296 | 3300005549 | Bacteria | 21955 |
| 98 | Ga0068855_100047853 | 3300005563 | Bacteria | 5051 |
| 99 | Ga0068855_100285905 | 3300005563 | Bacteria | 1830 |
| 100 | Ga0068855_101562486 | 3300005563 | Bacteria | 676 |
| 101 | Ga0068854_100006482 | 3300005578 | Bacteria | 7448 |
| 102 | Ga0068856_100970156 | 3300005614 | Bacteria | 868 |
| 103 | Ga0070702_100000597 | 3300005615 | Bacteria | 13239 |
| 104 | Ga0068859_100000044 | 3300005617 | Bacteria | 144391 |
| 105 | Ga0068859_100019721 | 3300005617 | Bacteria | 6771 |
| 106 | Ga0068859_100338393 | 3300005617 | Bacteria | 1599 |
| 107 | Ga0068859_102231760 | 3300005617 | Bacteria | 604 |
| 108 | Ga0068864_100131730 | 3300005618 | Bacteria | 2247 |
| 109 | Ga0068864_100212487 | 3300005618 | Bacteria | 1782 |
| 110 | Ga0068866_10001105 | 3300005718 | Bacteria | 11859 |
| 111 | Ga0068861_100029994 | 3300005719 | Bacteria | 3983 |
| 112 | Ga0068861_101654380 | 3300005719 | Bacteria | 632 |
| 113 | Ga0068870_10530848 | 3300005840 | Bacteria | 789 |
| 114 | Ga0068863_100015528 | 3300005841 | Bacteria | 7316 |
| 115 | Ga0068863_100089808 | 3300005841 | Bacteria | 2913 |
| 116 | Ga0068863_100236891 | 3300005841 | Bacteria | 1761 |
| 117 | Ga0068858_100002423 | 3300005842 | Bacteria | 18892 |
| 118 | Ga0068858_100015624 | 3300005842 | Bacteria | 7139 |
| 119 | Ga0068858_100054705 | 3300005842 | Bacteria | 3690 |
| 120 | Ga0068860_100009137 | 3300005843 | Bacteria | 9859 |
| 121 | Ga0068860_100201639 | 3300005843 | Bacteria | 1928 |
| 122 | Ga0068860_100364393 | 3300005843 | Bacteria | 1424 |
| 123 | Ga0068862_100005455 | 3300005844 | Bacteria | 10627 |
| 124 | Ga0068862_100187437 | 3300005844 | Bacteria | 1860 |
| 125 | Ga0068862_100481815 | 3300005844 | Bacteria | 1174 |
| 126 | Ga0081455_10016844 | 3300005937 | Bacteria | 7029 |
| 127 | Ga0081455_10202779 | 3300005937 | Bacteria | 1484 |
| 128 | Ga0081455_10372578 | 3300005937 | Bacteria | 1000 |
| 129 | Ga0081538_10111883 | 3300005981 | Bacteria | 1338 |
| 130 | Ga0070717_10533832 | 3300006028 | Bacteria | 1062 |
| 131 | Ga0070717_10911773 | 3300006028 | Bacteria | 800 |
| 132 | Ga0075365_10021101 | 3300006038 | Bacteria | 4056 |
| 133 | Ga0075365_10023404 | 3300006038 | Bacteria | 3885 |
| 134 | Ga0075365_10023875 | 3300006038 | Bacteria | 3851 |
| 135 | Ga0075365_10084632 | 3300006038 | Bacteria | 2153 |
| 136 | Ga0075365_10089239 | 3300006038 | Bacteria | 2098 |
| 137 | Ga0075365_10249753 | 3300006038 | Bacteria | 1246 |
| 138 | Ga0075365_10303906 | 3300006038 | Bacteria | 1123 |
| 139 | Ga0075365_11026785 | 3300006038 | Bacteria | 581 |
| 140 | Ga0075363_100002334 | 3300006048 | Bacteria | 7714 |
| 141 | Ga0075363_100006020 | 3300006048 | Bacteria | 5467 |
| 142 | Ga0075363_100014560 | 3300006048 | Bacteria | 3847 |
| 143 | Ga0075363_100051731 | 3300006048 | Bacteria | 2191 |
| 144 | Ga0075363_100079221 | 3300006048 | Bacteria | 1795 |
| 145 | Ga0075363_100300448 | 3300006048 | Bacteria | 931 |
| 146 | Ga0075364_10001374 | 3300006051 | Bacteria | 13133 |
| 147 | Ga0075364_10006662 | 3300006051 | Bacteria | 6808 |
| 148 | Ga0075364_10039979 | 3300006051 | Bacteria | 3041 |
| 149 | Ga0075364_10053475 | 3300006051 | Bacteria | 2640 |
| 150 | Ga0075364_10055840 | 3300006051 | Bacteria | 2584 |
| 151 | Ga0075364_10128648 | 3300006051 | Bacteria | 1699 |
| 152 | Ga0075364_10330236 | 3300006051 | Bacteria | 1039 |
| 153 | Ga0075364_10413250 | 3300006051 | Bacteria | 921 |
| 154 | Ga0075364_10449365 | 3300006051 | Bacteria | 880 |
| 155 | Ga0070715_10002818 | 3300006163 | Bacteria | 5415 |
| 156 | Ga0070715_10004177 | 3300006163 | Bacteria | 4701 |
| 157 | Ga0070716_100001631 | 3300006173 | Bacteria | 10115 |
| 158 | Ga0070716_100025500 | 3300006173 | Bacteria | 3155 |
| 159 | Ga0070716_101719316 | 3300006173 | Bacteria | 518 |
| 160 | Ga0070716_101827781 | 3300006173 | Bacteria | 503 |
| 161 | Ga0070712_100007150 | 3300006175 | Bacteria | 6960 |
| 162 | Ga0070712_100211110 | 3300006175 | Bacteria | 1531 |
| 163 | Ga0070712_100277263 | 3300006175 | Bacteria | 1349 |
| 164 | Ga0070712_100777633 | 3300006175 | Bacteria | 820 |
| 165 | Ga0070712_101871470 | 3300006175 | Bacteria | 525 |
| 166 | Ga0075362_10108632 | 3300006177 | Bacteria | 1304 |
| 167 | Ga0075362_10356194 | 3300006177 | Bacteria | 733 |
| 168 | Ga0075367_10124073 | 3300006178 | Bacteria | 1593 |
| 169 | Ga0075367_10129597 | 3300006178 | Bacteria | 1559 |
| 170 | Ga0075367_10180546 | 3300006178 | Bacteria | 1316 |
| 171 | Ga0075367_10297985 | 3300006178 | Bacteria | 1015 |
| 172 | Ga0075367_10354657 | 3300006178 | Bacteria | 926 |
| 173 | Ga0075367_10410360 | 3300006178 | Bacteria | 857 |
| 174 | Ga0075367_10901688 | 3300006178 | Bacteria | 564 |
| 175 | Ga0075367_11034599 | 3300006178 | Bacteria | 525 |
| 176 | Ga0075369_10003527 | 3300006186 | Bacteria | 5695 |
| 177 | Ga0075369_10004452 | 3300006186 | Bacteria | 5176 |
| 178 | Ga0075369_10012578 | 3300006186 | Bacteria | 3344 |
| 179 | Ga0075369_10026816 | 3300006186 | Bacteria | 2404 |
| 180 | Ga0075369_10385118 | 3300006186 | Bacteria | 660 |
| 181 | Ga0075369_10424872 | 3300006186 | Bacteria | 628 |
| 182 | Ga0097621_100507887 | 3300006237 | Bacteria | 1092 |
| 183 | Ga0097621_100580725 | 3300006237 | Bacteria | 1023 |
| 184 | Ga0075370_10007156 | 3300006353 | Bacteria | 5666 |
| 185 | Ga0075370_10029291 | 3300006353 | Bacteria | 3066 |
| 186 | Ga0075370_10152694 | 3300006353 | Bacteria | 1353 |
| 187 | Ga0075370_10223618 | 3300006353 | Bacteria | 1113 |
| 188 | Ga0075370_10794959 | 3300006353 | Bacteria | 577 |
| 189 | Ga0075428_100014553 | 3300006844 | Bacteria | 8738 |
| 190 | Ga0075430_100080156 | 3300006846 | Bacteria | 2735 |
| 191 | Ga0075430_100098198 | 3300006846 | Bacteria | 2447 |
| 192 | Ga0075431_100089968 | 3300006847 | Bacteria | 3168 |
| 193 | Ga0075433_10505741 | 3300006852 | Bacteria | 1063 |
| 194 | Ga0075434_101628895 | 3300006871 | Bacteria | 654 |
| 195 | Ga0068865_100002240 | 3300006881 | Bacteria | 11380 |
| 196 | Ga0097620_100000044 | 3300006931 | Bacteria | 144391 |
| 197 | Ga0097620_100019721 | 3300006931 | Bacteria | 6771 |
| 198 | Ga0097620_100338445 | 3300006931 | Bacteria | 1599 |
| 199 | Ga0097620_102231981 | 3300006931 | Bacteria | 604 |
| 200 | Ga0075435_100578607 | 3300007076 | Bacteria | 973 |
| 201 | Ga0099795_10229402 | 3300007788 | Bacteria | 793 |
| 202 | Ga0105244_10213707 | 3300009036 | Bacteria | 906 |
| 203 | Ga0105250_10168412 | 3300009092 | Bacteria | 916 |
| 204 | Ga0105240_11046854 | 3300009093 | Bacteria | 871 |
| 205 | Ga0105240_12511821 | 3300009093 | Bacteria | 533 |
| 206 | Ga0105245_10003298 | 3300009098 | Bacteria | 14490 |
| 207 | Ga0105245_10707297 | 3300009098 | Bacteria | 1041 |
| 208 | Ga0105245_10722784 | 3300009098 | Bacteria | 1030 |
| 209 | Ga0105247_10001904 | 3300009101 | Bacteria | 14569 |
| 210 | Ga0105247_10015654 | 3300009101 | Bacteria | 4540 |
| 211 | Ga0114129_10617852 | 3300009147 | Bacteria | 1402 |
| 212 | Ga0105243_10001353 | 3300009148 | Bacteria | 21797 |
| 213 | Ga0105241_10048185 | 3300009174 | Bacteria | 3242 |
| 214 | Ga0105241_11526043 | 3300009174 | Bacteria | 644 |
| 215 | Ga0105242_10012280 | 3300009176 | Bacteria | 6593 |
| 216 | Ga0105248_10006452 | 3300009177 | Bacteria | 12873 |
| 217 | Ga0105248_10944609 | 3300009177 | Bacteria | 974 |
| 218 | Ga0105248_11119138 | 3300009177 | Bacteria | 890 |
| 219 | Ga0105248_12294114 | 3300009177 | Bacteria | 614 |
| 220 | Ga0105237_10028982 | 3300009545 | Bacteria | 5631 |
| 221 | Ga0105237_10630005 | 3300009545 | Bacteria | 1079 |
| 222 | Ga0105237_10795809 | 3300009545 | Bacteria | 952 |
| 223 | Ga0105237_11243367 | 3300009545 | Bacteria | 751 |
| 224 | Ga0105237_11255355 | 3300009545 | Bacteria | 747 |
| 225 | Ga0105238_10092685 | 3300009551 | Bacteria | 3009 |
| 226 | Ga0105238_10841928 | 3300009551 | Bacteria | 934 |
| 227 | Ga0105249_10006656 | 3300009553 | Bacteria | 10059 |
| 228 | Ga0105249_10033047 | 3300009553 | Bacteria | 4683 |
| 229 | Ga0105249_10341596 | 3300009553 | Bacteria | 1514 |
| 230 | Ga0105239_10008146 | 3300010375 | Bacteria | 11960 |
| 231 | Ga0105239_10411845 | 3300010375 | Bacteria | 1531 |
| 232 | Ga0105239_10655611 | 3300010375 | Bacteria | 1199 |
| 233 | Ga0105239_10707093 | 3300010375 | Bacteria | 1152 |
| 234 | Ga0105239_11178402 | 3300010375 | Bacteria | 883 |
| 235 | Ga0105246_10476442 | 3300011119 | Bacteria | 1055 |
| 236 | Ga0157345_1059555 | 3300012498 | Bacteria | 505 |
| 237 | Ga0157373_10283325 | 3300013100 | Bacteria | 1175 |
| 238 | Ga0157369_10725168 | 3300013105 | Bacteria | 1023 |
| 239 | Ga0157374_10018933 | 3300013296 | Bacteria | 6088 |
| 240 | Ga0157374_10771817 | 3300013296 | Bacteria | 976 |
| 241 | Ga0157378_10029837 | 3300013297 | Bacteria | 4816 |
| 242 | Ga0157378_10522278 | 3300013297 | Bacteria | 1189 |
| 243 | Ga0163162_10015988 | 3300013306 | Bacteria | 7334 |
| 244 | Ga0163162_10073949 | 3300013306 | Bacteria | 3466 |
| 245 | Ga0163162_10998113 | 3300013306 | Bacteria | 946 |
| 246 | Ga0157372_11231789 | 3300013307 | Bacteria | 864 |
| 247 | Ga0157375_10004140 | 3300013308 | Bacteria | 12585 |
| 248 | Ga0157375_10006206 | 3300013308 | Bacteria | 10407 |
| 249 | Ga0163163_10055612 | 3300014325 | Bacteria | 3911 |
| 250 | Ga0157380_10042950 | 3300014326 | Bacteria | 3536 |
| 251 | Ga0157380_10240074 | 3300014326 | Bacteria | 1633 |
| 252 | Ga0157380_10793598 | 3300014326 | Bacteria | 963 |
| 253 | Ga0157377_10023445 | 3300014745 | Bacteria | 3271 |
| 254 | Ga0157377_10052736 | 3300014745 | Bacteria | 2297 |
| 255 | Ga0157379_10007492 | 3300014968 | Bacteria | 9446 |
| 256 | Ga0157379_10151639 | 3300014968 | Bacteria | 2091 |
| 257 | Ga0157379_11366494 | 3300014968 | Bacteria | 686 |
| 258 | Ga0163161_10002596 | 3300017792 | Bacteria | 12877 |
| 259 | Ga0163161_10163246 | 3300017792 | Bacteria | 1700 |
| 260 | Ga0163161_10174330 | 3300017792 | Bacteria | 1646 |
| 261 | Ga0163161_10726265 | 3300017792 | Bacteria | 829 |
| 262 | Ga0206355_1651516 | 3300020076 | Bacteria | 527 |
| 263 | Ga0206354_11416303 | 3300020081 | Bacteria | 1537 |
| 264 | Ga0206353_10179585 | 3300020082 | Bacteria | 1247 |
| 265 | Ga0213876_10001772 | 3300021384 | Bacteria | 13079 |
| 266 | Ga0213876_10349311 | 3300021384 | Bacteria | 787 |
| 267 | Ga0213875_10046442 | 3300021388 | Bacteria | 2038 |
| 268 | Ga0224572_1026858 | 3300024225 | Bacteria | 1103 |
| 269 | Ga0224572_1068525 | 3300024225 | Bacteria | 656 |
| 270 | Ga0207426_1002141 | 3300025302 | Bacteria | 13481 |
| 271 | Ga0207426_1014742 | 3300025302 | Bacteria | 2857 |
| 272 | Ga0207653_10043880 | 3300025885 | Bacteria | 1473 |
| 273 | Ga0207692_10007036 | 3300025898 | Bacteria | 4593 |
| 274 | Ga0207692_10207298 | 3300025898 | Bacteria | 1156 |
| 275 | Ga0207692_10552026 | 3300025898 | Bacteria | 736 |
| 276 | Ga0207710_10275425 | 3300025900 | Bacteria | 846 |
| 277 | Ga0207710_10336090 | 3300025900 | Bacteria | 768 |
| 278 | Ga0207710_10665116 | 3300025900 | Bacteria | 546 |
| 279 | Ga0207688_10002256 | 3300025901 | Bacteria | 10373 |
| 280 | Ga0207688_10015760 | 3300025901 | Bacteria | 4099 |
| 281 | Ga0207680_10014155 | 3300025903 | Bacteria | 4119 |
| 282 | Ga0207680_10439242 | 3300025903 | Bacteria | 926 |
| 283 | Ga0207680_10739000 | 3300025903 | Bacteria | 705 |
| 284 | Ga0207685_10002905 | 3300025905 | Bacteria | 4045 |
| 285 | Ga0207685_10026638 | 3300025905 | Bacteria | 2013 |
| 286 | Ga0207699_10030008 | 3300025906 | Bacteria | 3039 |
| 287 | Ga0207699_10034493 | 3300025906 | Bacteria | 2871 |
| 288 | Ga0207699_10426806 | 3300025906 | Bacteria | 948 |
| 289 | Ga0207699_10551351 | 3300025906 | Bacteria | 836 |
| 290 | Ga0207699_11098280 | 3300025906 | Bacteria | 589 |
| 291 | Ga0207654_10063027 | 3300025911 | Bacteria | 2174 |
| 292 | Ga0207695_11496840 | 3300025913 | Bacteria | 555 |
| 293 | Ga0207671_10070883 | 3300025914 | Bacteria | 2599 |
| 294 | Ga0207671_10558867 | 3300025914 | Bacteria | 912 |
| 295 | Ga0207693_10002138 | 3300025915 | Bacteria | 17228 |
| 296 | Ga0207693_10067573 | 3300025915 | Bacteria | 2799 |
| 297 | Ga0207693_10243901 | 3300025915 | Bacteria | 1410 |
| 298 | Ga0207693_10271285 | 3300025915 | Bacteria | 1329 |
| 299 | Ga0207663_10066729 | 3300025916 | Bacteria | 2304 |
| 300 | Ga0207663_10473316 | 3300025916 | Bacteria | 969 |
| 301 | Ga0207663_11328073 | 3300025916 | Bacteria | 579 |
| 302 | Ga0207660_10141829 | 3300025917 | Bacteria | 1838 |
| 303 | Ga0207660_10853807 | 3300025917 | Bacteria | 743 |
| 304 | Ga0207657_10426828 | 3300025919 | Bacteria | 1041 |
| 305 | Ga0207646_10118711 | 3300025922 | Bacteria | 2376 |
| 306 | Ga0207681_10118932 | 3300025923 | Bacteria | 1934 |
| 307 | Ga0207694_10193712 | 3300025924 | Bacteria | 1652 |
| 308 | Ga0207650_10325086 | 3300025925 | Bacteria | 1260 |
| 309 | Ga0207659_10100404 | 3300025926 | Bacteria | 2180 |
| 310 | Ga0207687_10008447 | 3300025927 | Bacteria | 6736 |
| 311 | Ga0207687_11956603 | 3300025927 | Bacteria | 501 |
| 312 | Ga0207700_10091706 | 3300025928 | Bacteria | 2400 |
| 313 | Ga0207700_10718081 | 3300025928 | Bacteria | 892 |
| 314 | Ga0207700_10720099 | 3300025928 | Bacteria | 891 |
| 315 | Ga0207664_10033835 | 3300025929 | Bacteria | 3932 |
| 316 | Ga0207664_10039077 | 3300025929 | Bacteria | 3682 |
| 317 | Ga0207664_10062491 | 3300025929 | Bacteria | 2974 |
| 318 | Ga0207664_10102470 | 3300025929 | Bacteria | 2367 |
| 319 | Ga0207664_10224082 | 3300025929 | Bacteria | 1632 |
| 320 | Ga0207644_10001385 | 3300025931 | Bacteria | 15631 |
| 321 | Ga0207644_10004961 | 3300025931 | Bacteria | 8681 |
| 322 | Ga0207644_10229309 | 3300025931 | Bacteria | 1475 |
| 323 | Ga0207644_11540861 | 3300025931 | Bacteria | 558 |
| 324 | Ga0207690_10739842 | 3300025932 | Bacteria | 810 |
| 325 | Ga0207706_10001778 | 3300025933 | Bacteria | 21172 |
| 326 | Ga0207686_10085692 | 3300025934 | Bacteria | 2067 |
| 327 | Ga0207709_10007635 | 3300025935 | Bacteria | 6001 |
| 328 | Ga0207704_10005156 | 3300025938 | Bacteria | 6017 |
| 329 | Ga0207665_10003399 | 3300025939 | Bacteria | 10654 |
| 330 | Ga0207665_10072021 | 3300025939 | Bacteria | 2360 |
| 331 | Ga0207665_11563964 | 3300025939 | Bacteria | 523 |
| 332 | Ga0207691_10024897 | 3300025940 | Bacteria | 5624 |
| 333 | Ga0207691_10570953 | 3300025940 | Bacteria | 958 |
| 334 | Ga0207691_11123783 | 3300025940 | Bacteria | 653 |
| 335 | Ga0207711_10036998 | 3300025941 | Bacteria | 4142 |
| 336 | Ga0207711_10515901 | 3300025941 | Bacteria | 1114 |
| 337 | Ga0207711_10810240 | 3300025941 | Bacteria | 872 |
| 338 | Ga0207689_10030701 | 3300025942 | Bacteria | 4478 |
| 339 | Ga0207689_10225905 | 3300025942 | Bacteria | 1547 |
| 340 | Ga0207689_10351523 | 3300025942 | Bacteria | 1225 |
| 341 | Ga0207667_10250564 | 3300025949 | Bacteria | 1811 |
| 342 | Ga0207667_10526029 | 3300025949 | Bacteria | 1198 |
| 343 | Ga0207667_11802116 | 3300025949 | Bacteria | 576 |
| 344 | Ga0207651_10237321 | 3300025960 | Bacteria | 1484 |
| 345 | Ga0207712_10038275 | 3300025961 | Bacteria | 3279 |
| 346 | Ga0207712_10083241 | 3300025961 | Bacteria | 2335 |
| 347 | Ga0207668_10014668 | 3300025972 | Bacteria | 4853 |
| 348 | Ga0207668_10031082 | 3300025972 | Bacteria | 3514 |
| 349 | Ga0207668_10090288 | 3300025972 | Bacteria | 2248 |
| 350 | Ga0207668_10111236 | 3300025972 | Bacteria | 2056 |
| 351 | Ga0207640_10136874 | 3300025981 | Bacteria | 1779 |
| 352 | Ga0207658_10012942 | 3300025986 | Bacteria | 5699 |
| 353 | Ga0207658_10035789 | 3300025986 | Bacteria | 3557 |
| 354 | Ga0207658_10574707 | 3300025986 | Bacteria | 1010 |
| 355 | Ga0207677_10007113 | 3300026023 | Bacteria | 6162 |
| 356 | Ga0207677_10195011 | 3300026023 | Bacteria | 1605 |
| 357 | Ga0207677_10466810 | 3300026023 | Bacteria | 1085 |
| 358 | Ga0207677_11321343 | 3300026023 | Bacteria | 663 |
| 359 | Ga0207703_10014586 | 3300026035 | Bacteria | 6131 |
| 360 | Ga0207703_10048420 | 3300026035 | Bacteria | 3431 |
| 361 | Ga0207703_10216353 | 3300026035 | Bacteria | 1711 |
| 362 | Ga0207703_10688462 | 3300026035 | Bacteria | 972 |
| 363 | Ga0207703_11120950 | 3300026035 | Bacteria | 756 |
| 364 | Ga0207639_10010629 | 3300026041 | Bacteria | 6373 |
| 365 | Ga0207639_10639809 | 3300026041 | Bacteria | 983 |
| 366 | Ga0207678_10016795 | 3300026067 | Bacteria | 6429 |
| 367 | Ga0207708_10006981 | 3300026075 | Bacteria | 8349 |
| 368 | Ga0207708_10032029 | 3300026075 | Bacteria | 3992 |
| 369 | Ga0207702_10411469 | 3300026078 | Bacteria | 1306 |
| 370 | Ga0207641_10056044 | 3300026088 | Bacteria | 3348 |
| 371 | Ga0207641_10089736 | 3300026088 | Bacteria | 2687 |
| 372 | Ga0207641_10337217 | 3300026088 | Bacteria | 1434 |
| 373 | Ga0207641_10711708 | 3300026088 | Bacteria | 989 |
| 374 | Ga0207648_10007938 | 3300026089 | Bacteria | 10350 |
| 375 | Ga0207676_10071437 | 3300026095 | Bacteria | 2787 |
| 376 | Ga0207676_11805136 | 3300026095 | Bacteria | 610 |
| 377 | Ga0207675_100008415 | 3300026118 | Bacteria | 9724 |
| 378 | Ga0207675_101341548 | 3300026118 | Bacteria | 736 |
| 379 | Ga0207683_10002944 | 3300026121 | Bacteria | 14853 |
| 380 | Ga0207698_10400126 | 3300026142 | Bacteria | 1312 |
| 381 | Ga0207698_11327804 | 3300026142 | Bacteria | 734 |
| 382 | Ga0209179_1061636 | 3300027512 | Bacteria | 814 |
| 383 | Ga0268266_10007089 | 3300028379 | Bacteria | 10178 |
| 384 | Ga0268266_10019158 | 3300028379 | Bacteria | 5828 |
| 385 | Ga0268266_10103876 | 3300028379 | Bacteria | 2508 |
| 386 | Ga0268265_10278078 | 3300028380 | Bacteria | 1497 |
| 387 | Ga0268264_10128722 | 3300028381 | Bacteria | 2241 |
| 388 | Ga0307515_10013555 | 3300028794 | Bacteria | 15219 |
| 389 | Ga0307515_10037351 | 3300028794 | Bacteria | 7813 |
| 390 | Ga0307515_10377607 | 3300028794 | Bacteria | 1051 |
| 391 | Ga0307512_10016119 | 3300030522 | Bacteria | 6902 |
| 392 | Ga0265766_1021317 | 3300030863 | Bacteria | 535 |
| 393 | Ga0265764_112221 | 3300030882 | Bacteria | 562 |
| 394 | Ga0265779_111167 | 3300031043 | Bacteria | 558 |
| 395 | Ga0307513_10001447 | 3300031456 | Bacteria | 34121 |
| 396 | Ga0307513_10281069 | 3300031456 | Bacteria | 1442 |
| 397 | Ga0307513_10458326 | 3300031456 | Bacteria | 998 |
| 398 | Ga0307509_10093794 | 3300031507 | Bacteria | 3062 |
| 399 | Ga0307508_10097318 | 3300031616 | Bacteria | 2535 |
| 400 | Ga0307508_10197969 | 3300031616 | Bacteria | 1610 |
| 401 | Ga0307508_10648439 | 3300031616 | Bacteria | 661 |
| 402 | Ga0307516_10002519 | 3300031730 | Bacteria | 24386 |
| 403 | Ga0307516_10604636 | 3300031730 | Bacteria | 751 |
| 404 | Ga0307516_10705757 | 3300031730 | Bacteria | 666 |
| 405 | Ga0307518_10108463 | 3300031838 | Bacteria | 1980 |
| 406 | Ga0307411_10518712 | 3300032005 | Bacteria | 1011 |
| 407 | Ga0307415_100253541 | 3300032126 | Bacteria | 1431 |
| 408 | Ga0307507_10000090 | 3300033179 | Bacteria | 142457 |
| 409 | Ga0307507_10399600 | 3300033179 | Bacteria | 782 |
| 410 | Ga0307510_10294973 | 3300033180 | Bacteria | 1086 |
| 411 | Ga0316214_1045684 | 3300033545 | Bacteria | 632 |
| 412 | Ga0373938_0191575 | 3300034957 | Bacteria | 563 |
| 413 | Ga0373926_0001208 | 3300035083 | Bacteria | 7749 |
| 414 | Ga0373934_0278080 | 3300035086 | Bacteria | 693 |
| 415 | Ga0373944_0010340 | 3300035089 | Bacteria | 2542 |
| 416 | Ga0373936_0000687 | 3300035113 | Bacteria | 11808 |
| 417 | Ga0373936_0005405 | 3300035113 | Bacteria | 4815 |
| 418 | Ga0373941_0044303 | 3300035115 | Bacteria | 1388 |
| 419 | Ga0373945_0000543 | 3300035116 | Bacteria | 10765 |
| 420 | Ga0373953_0039885 | 3300035117 | Bacteria | 1863 |
| 421 | Ga0373954_0066097 | 3300035118 | Bacteria | 1712 |
| 422 | Ga0373957_0208834 | 3300035120 | Bacteria | 815 |
| 423 | Ga0373943_0000294 | 3300035170 | Bacteria | 20746 |
| 424 | Ga0373943_0389543 | 3300035170 | Bacteria | 803 |
| 425 | Ga0373943_0437980 | 3300035170 | Bacteria | 758 |
| 426 | Ga0373946_0000333 | 3300035171 | Bacteria | 15276 |
| 427 | Ga0373924_0244556 | 3300035410 | Bacteria | 794 |
| 428 | Ga0373931_0083708 | 3300035691 | Bacteria | 1765 |
| 429 | Ga0373935_0038129 | 3300035692 | Bacteria | 3007 |
| 430 | Ga0373935_0096349 | 3300035692 | Bacteria | 1944 |
| 431 | Ga0373935_0955298 | 3300035692 | Bacteria | 636 |
| 432 | Ga0373927_0033472 | 3300035695 | Bacteria | 3346 |
| 433 | Ga0373927_0567573 | 3300035695 | Bacteria | 750 |
| 434 | Ga0373933_0206277 | 3300035724 | Bacteria | 1258 |
| 435 | Ga0373947_0000366 | 3300035725 | Bacteria | 25508 |
| 436 | Ga0373947_0187145 | 3300035725 | Bacteria | 1350 |
| 437 | Ga0373947_0410272 | 3300035725 | Bacteria | 914 |
| 438 | Ga0373937_0033012 | 3300036401 | Bacteria | 4697 |
| 439 | Ga0372808_041009 | 3300036459 | Bacteria | 664 |
| 440 | Ga0373925_0004806 | 3300037068 | Bacteria | 10176 |
| 441 | Ga0373925_0255757 | 3300037068 | Bacteria | 1406 |
| 442 | Ga0395900_0130030 | 3300037418 | Bacteria | 2581 |
| 443 | Ga0395898_0000967 | 3300037466 | Bacteria | 45516 |
| 444 | Ga0395905_0383175 | 3300037471 | Bacteria | 1300 |
| 445 | Ga0436364_1448068 | 3300037853 | Bacteria | 7997 |
| 446 | Ga0395901_0050096 | 3300038443 | Bacteria | 4340 |
| 447 | Ga0395901_0866824 | 3300038443 | Bacteria | 887 |
| 448 | Ga0395901_2061833 | 3300038443 | Bacteria | 516 |
| 449 | Ga0436365_1159535 | 3300039437 | Bacteria | 904 |
| 450 | Ga0436365_1258441 | 3300039437 | Bacteria | 1047 |
| 451 | Ga0436365_1483817 | 3300039437 | Bacteria | 6760 |
| 452 | Ga0439439_0011776 | 3300041406 | Bacteria | 2109 |
| 453 | Ga0439461_0013621 | 3300041410 | Bacteria | 1537 |
| 454 | Ga0439465_0044142 | 3300041413 | Bacteria | 1447 |
| 455 | Ga0439465_0081566 | 3300041413 | Bacteria | 1097 |
| 456 | Ga0451797_0572430 | 3300041453 | Bacteria | 631 |
| 457 | Ga0451804_0381060 | 3300041463 | Bacteria | 703 |
| 458 | Ga0451843_0192007 | 3300041509 | Bacteria | 509 |
| 459 | Ga0451853_0321697 | 3300041512 | Bacteria | 2170 |
| 460 | Ga0439431_0022260 | 3300041997 | Bacteria | 1527 |
| 461 | Ga0439433_0004058 | 3300041999 | Bacteria | 3146 |
| 462 | Ga0439442_002820 | 3300042002 | Bacteria | 3417 |
| 463 | Ga0439442_158053 | 3300042002 | Bacteria | 506 |
| 464 | Ga0439449_0001367 | 3300042007 | Bacteria | 9546 |
| 465 | Ga0439457_003638 | 3300042014 | Bacteria | 4170 |
| 466 | Ga0439434_0221897 | 3300042435 | Bacteria | 642 |
| 467 | Ga0466969_0137673 | 3300044656 | Bacteria | 1130 |
| 468 | Ga0466972_0016444 | 3300044658 | Bacteria | 3700 |
| 469 | Ga0466972_0030862 | 3300044658 | Bacteria | 2638 |
| 470 | Ga0466965_0011338 | 3300044683 | Bacteria | 4175 |
| 471 | Ga0466966_0000993 | 3300044684 | Bacteria | 18195 |
| 472 | Ga0466966_0044209 | 3300044684 | Bacteria | 2852 |
| 473 | Ga0466966_0066180 | 3300044684 | Bacteria | 2271 |
| 474 | Ga0466966_0908793 | 3300044684 | Bacteria | 531 |
| 475 | Ga0466961_0002945 | 3300044693 | Bacteria | 10572 |
| 476 | Ga0466961_0006230 | 3300044693 | Bacteria | 7580 |
| 477 | Ga0466961_0220442 | 3300044693 | Bacteria | 1169 |
| 478 | Ga0466963_0004374 | 3300044694 | Bacteria | 8206 |
| 479 | Ga0466963_0062359 | 3300044694 | Bacteria | 2494 |
| 480 | Ga0466963_0253255 | 3300044694 | Bacteria | 1236 |
| 481 | Ga0466963_0395146 | 3300044694 | Bacteria | 975 |
| 482 | Ga0466963_0817024 | 3300044694 | Bacteria | 657 |
| 483 | Ga0466963_1192531 | 3300044694 | Bacteria | 535 |
| 484 | Ga0466964_0005074 | 3300044706 | Bacteria | 4870 |
| 485 | Ga0466964_0016922 | 3300044706 | Bacteria | 2788 |
| 486 | Ga0466964_0799686 | 3300044706 | Bacteria | 533 |
| 487 | Ga0466971_0000363 | 3300044719 | Bacteria | 17400 |
| 488 | Ga0466971_0011002 | 3300044719 | Bacteria | 3958 |
| 489 | Ga0466971_0454048 | 3300044719 | Bacteria | 629 |
| 490 | Ga0466968_0107092 | 3300044735 | Bacteria | 1254 |
| 491 | Ga0466968_0126987 | 3300044735 | Bacteria | 1158 |
| 492 | Ga0466968_0150607 | 3300044735 | Bacteria | 1069 |
| 493 | Ga0466968_0218405 | 3300044735 | Bacteria | 897 |
| 494 | Ga0466968_0287272 | 3300044735 | Bacteria | 788 |
| 495 | Ga0466970_0005079 | 3300044765 | Bacteria | 6506 |
| 496 | Ga0466970_0029299 | 3300044765 | Bacteria | 2898 |
| 497 | Ga0466970_0115568 | 3300044765 | Bacteria | 1467 |
| 498 | Ga0466957_0058405 | 3300044842 | Bacteria | 2363 |
| 499 | Ga0466957_0165703 | 3300044842 | Bacteria | 1437 |
| 500 | Ga0466960_0583835 | 3300044901 | Bacteria | 662 |
| 501 | Ga0466959_0017959 | 3300045049 | Bacteria | 5190 |
| 502 | Ga0466959_0158740 | 3300045049 | Bacteria | 1590 |
| 503 | Ga0466959_0223801 | 3300045049 | Bacteria | 1304 |
| 504 | Ga0466958_0003984 | 3300045836 | Bacteria | 7741 |
| 505 | Ga0466958_0009344 | 3300045836 | Bacteria | 5463 |
| 506 | Ga0466958_0011624 | 3300045836 | Bacteria | 4962 |
| 507 | Ga0466958_0060390 | 3300045836 | Bacteria | 2308 |
| 508 | Ga0466958_0315504 | 3300045836 | Bacteria | 1004 |
| 509 | Ga0466967_0034819 | 3300045976 | Bacteria | 4279 |
| 510 | Ga0466967_0161463 | 3300045976 | Bacteria | 2104 |
| 511 | Ga0466967_0221669 | 3300045976 | Bacteria | 1797 |
| 512 | Ga0466967_0626896 | 3300045976 | Bacteria | 1062 |
| 513 | Ga0495592_0000338 | 3300046454 | Bacteria | 38538 |
| 514 | Ga0495592_0373894 | 3300046454 | Bacteria | 908 |
| 515 | Ga0495629_0080691 | 3300046459 | Bacteria | 2271 |
| 516 | Ga0495629_0497543 | 3300046459 | Bacteria | 822 |
| 517 | Ga0495629_0545982 | 3300046459 | Bacteria | 778 |
| 518 | Ga0495638_0001977 | 3300046460 | Bacteria | 17520 |
| 519 | Ga0495638_0162577 | 3300046460 | Bacteria | 1287 |
| 520 | Ga0495641_0123460 | 3300046461 | Bacteria | 1155 |
| 521 | Ga0495641_0280929 | 3300046461 | Bacteria | 749 |
| 522 | Ga0495651_0000436 | 3300046462 | Bacteria | 32184 |
| 523 | Ga0495651_0056166 | 3300046462 | Bacteria | 3024 |
| 524 | Ga0495651_0223143 | 3300046462 | Bacteria | 1303 |
| 525 | Ga0495653_0014057 | 3300046463 | Bacteria | 6528 |
| 526 | Ga0495653_0022636 | 3300046463 | Bacteria | 5082 |
| 527 | Ga0495653_0022668 | 3300046463 | Bacteria | 5079 |
| 528 | Ga0495639_0063782 | 3300046475 | Bacteria | 1692 |
| 529 | Ga0495662_0177879 | 3300046476 | Bacteria | 1048 |
| 530 | Ga0495662_0396988 | 3300046476 | Bacteria | 677 |
| 531 | Ga0495664_0028227 | 3300046477 | Bacteria | 3277 |
| 532 | Ga0495594_0261908 | 3300046499 | Bacteria | 985 |
| 533 | Ga0495608_0061454 | 3300046511 | Bacteria | 2470 |
| 534 | Ga0495608_0094074 | 3300046511 | Bacteria | 1936 |
| 535 | Ga0495618_0064466 | 3300046514 | Bacteria | 2328 |
| 536 | Ga0495628_0834969 | 3300046516 | Bacteria | 643 |
| 537 | Ga0495630_0000359 | 3300046517 | Bacteria | 36192 |
| 538 | Ga0495630_0375039 | 3300046517 | Bacteria | 1089 |
| 539 | Ga0495630_0728973 | 3300046517 | Bacteria | 758 |
| 540 | Ga0495652_0055768 | 3300046529 | Bacteria | 3359 |
| 541 | Ga0495652_0399966 | 3300046529 | Bacteria | 973 |
| 542 | Ga0495665_0009674 | 3300046531 | Bacteria | 5220 |
| 543 | Ga0495587_0092851 | 3300046536 | Bacteria | 1743 |
| 544 | Ga0495587_0519307 | 3300046536 | Bacteria | 658 |
| 545 | Ga0495645_0259752 | 3300046543 | Bacteria | 1151 |
| 546 | Ga0495667_0025134 | 3300046559 | Bacteria | 4015 |
| 547 | Ga0495667_0042022 | 3300046559 | Bacteria | 3031 |
| 548 | Ga0495634_0019164 | 3300046642 | Bacteria | 4863 |
| 549 | Ga0495634_0039098 | 3300046642 | Bacteria | 3232 |
| 550 | Ga0495625_0094759 | 3300046660 | Bacteria | 2059 |
| 551 | Ga0495635_0014225 | 3300046663 | Bacteria | 5569 |
| 552 | Ga0495635_0035888 | 3300046663 | Bacteria | 3438 |
| 553 | Ga0495657_0041857 | 3300046675 | Bacteria | 3132 |
| 554 | Ga0495657_0105985 | 3300046675 | Bacteria | 1785 |
| 555 | Ga0495599_0744449 | 3300046678 | Bacteria | 563 |
| 556 | Ga0495623_0094568 | 3300046679 | Bacteria | 1827 |
| 557 | Ga0495623_0539413 | 3300046679 | Bacteria | 612 |
| 558 | Ga0495646_0000169 | 3300046680 | Bacteria | 32603 |
| 559 | Ga0495613_1015008 | 3300046689 | Bacteria | 532 |
| 560 | Ga0495624_0000781 | 3300046690 | Bacteria | 25096 |
| 561 | Ga0495649_0258442 | 3300046694 | Bacteria | 893 |
| 562 | Ga0495600_0031605 | 3300046809 | Bacteria | 3431 |
| 563 | Ga0495600_0587786 | 3300046809 | Bacteria | 677 |
| 564 | Ga0495581_0007309 | 3300047315 | Bacteria | 6390 |
| 565 | Ga0495604_0440415 | 3300047317 | Bacteria | 853 |
| 566 | Ga0495674_0000657 | 3300047319 | Bacteria | 32403 |
| 567 | Ga0495674_0185098 | 3300047319 | Bacteria | 1733 |
| 568 | Ga0495672_0077211 | 3300047320 | Bacteria | 1868 |
| 569 | Ga0495672_0341290 | 3300047320 | Bacteria | 698 |
| 570 | Ga0495676_0067255 | 3300047321 | Bacteria | 2773 |
| 571 | Ga0495680_0006292 | 3300047322 | Bacteria | 11059 |
| 572 | Ga0495680_0738060 | 3300047322 | Bacteria | 647 |
| 573 | Ga0495673_0361340 | 3300047469 | Bacteria | 511 |
| 574 | Ga0495684_0230562 | 3300047471 | Bacteria | 1354 |
| 575 | Ga0495602_0260374 | 3300048088 | Bacteria | 1287 |
| 576 | Ga0495602_0524714 | 3300048088 | Bacteria | 824 |
| 577 | Ga0496100_0002078 | 3300048903 | Bacteria | 10075 |
| 578 | Ga0496100_0003101 | 3300048903 | Bacteria | 8598 |
| 579 | Ga0496100_0798004 | 3300048903 | Bacteria | 740 |
| 580 | Ga0496101_0004725 | 3300048904 | Bacteria | 8630 |
| 581 | Ga0496101_0799603 | 3300048904 | Bacteria | 744 |
| 582 | Ga0496101_0809812 | 3300048904 | Bacteria | 739 |
| 583 | Ga0496102_0013469 | 3300048905 | Bacteria | 7084 |
| 584 | Ga0496102_0032674 | 3300048905 | Bacteria | 4675 |
| 585 | Ga0496102_0070790 | 3300048905 | Bacteria | 3202 |
| 586 | Ga0496102_0415608 | 3300048905 | Bacteria | 1263 |
| 587 | Ga0496103_0000638 | 3300048906 | Bacteria | 26745 |
| 588 | Ga0496103_0068655 | 3300048906 | Bacteria | 2215 |
| 589 | Ga0496104_0444230 | 3300048907 | Bacteria | 1209 |
| 590 | Ga0496105_0069444 | 3300048908 | Bacteria | 2911 |
| 591 | Ga0496105_0169666 | 3300048908 | Bacteria | 1789 |
| 592 | Ga0496105_0609144 | 3300048908 | Bacteria | 847 |
| 593 | Ga0496105_0695843 | 3300048908 | Bacteria | 781 |
| 594 | Ga0496106_0000851 | 3300048909 | Bacteria | 22136 |
| 595 | Ga0496106_0020856 | 3300048909 | Bacteria | 4862 |
| 596 | Ga0496106_0268147 | 3300048909 | Bacteria | 1367 |
| 597 | Ga0496107_0027339 | 3300048910 | Bacteria | 4050 |
| 598 | Ga0496107_0483784 | 3300048910 | Bacteria | 918 |
| 599 | Ga0496107_0615483 | 3300048910 | Bacteria | 802 |
| 600 | Ga0496108_0001502 | 3300048911 | Bacteria | 18462 |
| 601 | Ga0496108_0173882 | 3300048911 | Bacteria | 1864 |
| 602 | Ga0496108_0337619 | 3300048911 | Bacteria | 1314 |
| 603 | Ga0496109_0006002 | 3300048912 | Bacteria | 10203 |
| 604 | Ga0496109_0061463 | 3300048912 | Bacteria | 3434 |
| 605 | Ga0496109_0506164 | 3300048912 | Bacteria | 1140 |
| 606 | Ga0496110_0072539 | 3300048913 | Bacteria | 3055 |
| 607 | Ga0496110_0084620 | 3300048913 | Bacteria | 2831 |
| 608 | Ga0496110_0365545 | 3300048913 | Bacteria | 1314 |
| 609 | Ga0496110_1501552 | 3300048913 | Bacteria | 584 |
| 610 | Ga0496111_0011268 | 3300048914 | Bacteria | 6019 |
| 611 | Ga0496111_0640985 | 3300048914 | Bacteria | 776 |
| 612 | Ga0496112_0003000 | 3300048915 | Bacteria | 13795 |
| 613 | Ga0496112_0100483 | 3300048915 | Bacteria | 2862 |
| 614 | Ga0496112_0212603 | 3300048915 | Bacteria | 1891 |
| 615 | Ga0496112_0538557 | 3300048915 | Bacteria | 1102 |
| 616 | Ga0496113_0081102 | 3300048916 | Bacteria | 2486 |
| 617 | Ga0496113_0108705 | 3300048916 | Bacteria | 2156 |
| 618 | Ga0496113_0324320 | 3300048916 | Bacteria | 1235 |
| 619 | Ga0496113_1582407 | 3300048916 | Bacteria | 505 |
| 620 | Ga0496114_0005066 | 3300048917 | Bacteria | 10272 |
| 621 | Ga0496114_0780602 | 3300048917 | Bacteria | 834 |
| 622 | Ga0496115_0007280 | 3300048918 | Bacteria | 8137 |
| 623 | Ga0496115_0799962 | 3300048918 | Bacteria | 734 |
| 624 | Ga0496119_0001496 | 3300048922 | Bacteria | 27975 |
| 625 | Ga0496119_0207558 | 3300048922 | Bacteria | 1010 |
| 626 | Ga0496120_0006904 | 3300048923 | Bacteria | 8568 |
| 627 | Ga0496121_0032589 | 3300048924 | Bacteria | 4733 |
| 628 | Ga0496124_0030346 | 3300048927 | Bacteria | 4800 |
| 629 | Ga0496126_0073912 | 3300048929 | Bacteria | 3029 |
| 630 | Ga0496126_0364197 | 3300048929 | Bacteria | 1180 |
| 631 | Ga0501031_0096461 | 3300049568 | Bacteria | 1930 |
| 632 | Ga0501032_0204739 | 3300049569 | Bacteria | 1287 |
| 633 | Ga0501033_0039523 | 3300049570 | Bacteria | 3523 |
| 634 | Ga0501034_0085696 | 3300049571 | Bacteria | 3151 |
| 635 | Ga0501034_0759007 | 3300049571 | Bacteria | 865 |
| 636 | Ga0501036_0073697 | 3300049572 | Bacteria | 2886 |
| 637 | Ga0501037_0288738 | 3300049573 | Bacteria | 1141 |
| 638 | Ga0501038_0025400 | 3300049574 | Bacteria | 5281 |
| 639 | Ga0501039_0952650 | 3300049575 | Bacteria | 667 |
| 640 | Ga0501043_0163212 | 3300049579 | Bacteria | 1740 |
| 641 | Ga0501043_1178781 | 3300049579 | Bacteria | 539 |
| 642 | Ga0501070_0068608 | 3300049586 | Bacteria | 2935 |
| 643 | Ga0501072_1464448 | 3300049588 | Bacteria | 527 |
| 644 | Ga0501035_0174123 | 3300049822 | Bacteria | 1857 |
| 645 | Ga0501035_0727618 | 3300049822 | Bacteria | 798 |
| 646 | Ga0501044_0145020 | 3300049823 | Bacteria | 2360 |
| 647 | Ga0501044_0283239 | 3300049823 | Bacteria | 1590 |
| 648 | Ga0501045_0186590 | 3300049824 | Bacteria | 1545 |
| 649 | nmdc:mga03683_61232_c1 | 3300050489 | Bacteria | 1591 |
| 650 | nmdc:mga03683_67430_c1 | 3300050489 | Bacteria | 1523 |
| 651 | nmdc:mga03n38_251340_c1 | 3300050490 | Bacteria | 934 |
| 652 | nmdc:mga03n38_43772_c1 | 3300050490 | Bacteria | 1963 |
| 653 | nmdc:mga03n38_53227_c1 | 3300050490 | Bacteria | 1814 |
| 654 | nmdc:mga03n38_58577_c1 | 3300050490 | Bacteria | 1746 |
| 655 | nmdc:mga00v17_115348_c1 | 3300050491 | Bacteria | 1707 |
| 656 | nmdc:mga00v17_1723_c1 | 3300050491 | Bacteria | 11354 |
| 657 | nmdc:mga00v17_34982_c2 | 3300050491 | Bacteria | 2495 |
| 658 | nmdc:mga00v17_83170_c1 | 3300050491 | Bacteria | 2002 |
| 659 | nmdc:mga00v17_8482_c1 | 3300050491 | Bacteria | 5530 |
| 660 | nmdc:mga00v17_935541_c1 | 3300050491 | Bacteria | 548 |
| 661 | nmdc:mga0yw44_17450_c1 | 3300050492 | Bacteria | 3905 |
| 662 | nmdc:mga0yw44_269178_c1 | 3300050492 | Bacteria | 1137 |
| 663 | nmdc:mga0yw44_513203_c1 | 3300050492 | Bacteria | 813 |
| 664 | nmdc:mga0yw44_551439_c1 | 3300050492 | Bacteria | 783 |
| 665 | nmdc:mga0yw44_647906_c1 | 3300050492 | Bacteria | 718 |
| 666 | nmdc:mga0yw44_69467_c1 | 3300050492 | Bacteria | 2182 |
| 667 | nmdc:mga0k408_434063_c1 | 3300050493 | Bacteria | 780 |
| 668 | nmdc:mga06z11_229110_c1 | 3300050494 | Bacteria | 1088 |
| 669 | nmdc:mga06z11_393054_c1 | 3300050494 | Bacteria | 834 |
| 670 | nmdc:mga06z11_437005_c1 | 3300050494 | Bacteria | 790 |
| 671 | nmdc:mga06z11_790076_c1 | 3300050494 | Bacteria | 578 |
| 672 | nmdc:mga06z11_907036_c1 | 3300050494 | Bacteria | 537 |
| 673 | nmdc:mga06z11_931858_c1 | 3300050494 | Bacteria | 529 |
| 674 | nmdc:mga04h51_162848_c1 | 3300050495 | Bacteria | 859 |
| 675 | nmdc:mga07m45_194435_c1 | 3300050496 | Bacteria | 1180 |
| 676 | nmdc:mga07m45_3342_c1 | 3300050496 | Bacteria | 7732 |
| 677 | nmdc:mga05p37_228275_c1 | 3300050507 | Bacteria | 2244 |
| 678 | nmdc:mga0qj67_136182_c1 | 3300050509 | Bacteria | 1990 |
| 679 | nmdc:mga0qj67_58338_c1 | 3300050509 | Bacteria | 3060 |
| 680 | nmdc:mga0n895_1042456_c1 | 3300050512 | Bacteria | 797 |
| 681 | nmdc:mga0rr50_396358_c1 | 3300050513 | Bacteria | 1165 |
| 682 | nmdc:mga0a205_446637_c1 | 3300050515 | Bacteria | 1153 |
| 683 | nmdc:mga0sz30_12989_c1 | 3300050516 | Bacteria | 3252 |
| 684 | nmdc:mga0sz30_25693_c1 | 3300050516 | Bacteria | 2409 |
| 685 | nmdc:mga0sz30_4145_c1 | 3300050516 | Bacteria | 5223 |
| 686 | nmdc:mga0sz30_4369_c1 | 3300050516 | Bacteria | 4293 |
| 687 | nmdc:mga0sz30_68842_c1 | 3300050516 | Bacteria | 1521 |
| 688 | Ga0495601_0042212 | 3300053077 | Bacteria | 2861 |
| 689 | Ga0495612_0009997 | 3300053078 | Bacteria | 3841 |
| 690 | Ga0500610_0004115 | 3300053079 | Bacteria | 5715 |
| 691 | Ga0495595_0345181 | 3300053084 | Bacteria | 751 |
| 692 | Ga0495619_0055007 | 3300053085 | Bacteria | 2635 |
| 693 | Ga0495619_0518370 | 3300053085 | Bacteria | 819 |
| 694 | Ga0500644_0012178 | 3300053088 | Bacteria | 2372 |
| 695 | Ga0500646_0095653 | 3300053090 | Bacteria | 926 |
| 696 | Ga0500646_0329660 | 3300053090 | Bacteria | 553 |
| 697 | Ga0500566_0005968 | 3300053094 | Bacteria | 7242 |
| 698 | Ga0500650_0214146 | 3300053098 | Bacteria | 874 |
| 699 | Ga0500556_0066795 | 3300053104 | Bacteria | 1336 |
| 700 | Ga0500556_0188818 | 3300053104 | Bacteria | 814 |
| 701 | Ga0500652_061681 | 3300053131 | Bacteria | 1544 |
| 702 | Ga0500652_230697 | 3300053131 | Bacteria | 741 |
| 703 | Ga0500568_0283605 | 3300053139 | Bacteria | 602 |
| 704 | Ga0500577_0360270 | 3300053142 | Bacteria | 636 |
| 705 | Ga0500604_0067083 | 3300053151 | Bacteria | 1138 |
| 706 | Ga0500616_0003087 | 3300053153 | Bacteria | 13073 |
| 707 | Ga0500616_0050977 | 3300053153 | Bacteria | 2183 |
| 708 | Ga0500616_0116274 | 3300053153 | Bacteria | 1284 |
| 709 | Ga0500627_0260124 | 3300053158 | Bacteria | 766 |
| 710 | Ga0500611_037074 | 3300053727 | Bacteria | 1048 |
| 711 | Ga0587093_105030 | 3300059478 | Bacteria | 514 |
| 712 | Ga0587073_0246022 | 3300059492 | Bacteria | 559 |
| 713 | Ga0587072_188349 | 3300059643 | Bacteria | 518 |
| 714 | Ga0466962_0004991 | 3300061719 | Bacteria | 6381 |
| 715 | Ga0466962_0010842 | 3300061719 | Bacteria | 4381 |
| 716 | Ga0466962_0128654 | 3300061719 | Bacteria | 1223 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025942 | Ga0207689_10351523 | Ga0207689_103515232 | 97 |
| 2 | 3300031616 | Ga0307508_10097318 | Ga0307508_100973184 | 100 |
| 3 | 3300044683 | Ga0466965_0011338 | Ga0466965_0011338_2921_3265 | 100 |
| 4 | 3300044684 | Ga0466966_0000993 | Ga0466966_0000993_13365_13709 | 100 |
| 5 | 3300044693 | Ga0466961_0002945 | Ga0466961_0002945_5702_6046 | 100 |
| 6 | 3300044694 | Ga0466963_0004374 | Ga0466963_0004374_1899_2243 | 100 |
| 7 | 3300044706 | Ga0466964_0005074 | Ga0466964_0005074_4135_4479 | 100 |
| 8 | 3300044719 | Ga0466971_0011002 | Ga0466971_0011002_3001_3345 | 100 |
| 9 | 3300044735 | Ga0466968_0126987 | Ga0466968_0126987_671_1015 | 100 |
| 10 | 3300044765 | Ga0466970_0005079 | Ga0466970_0005079_4270_4614 | 100 |
| 11 | 3300044842 | Ga0466957_0058405 | Ga0466957_0058405_913_1257 | 100 |
| 12 | 3300045049 | Ga0466959_0158740 | Ga0466959_0158740_898_1242 | 100 |
| 13 | 3300045836 | Ga0466958_0009344 | Ga0466958_0009344_4263_4607 | 100 |
| 14 | 3300045976 | Ga0466967_0034819 | Ga0466967_0034819_2296_2640 | 100 |
| 15 | 3300061719 | Ga0466962_0010842 | Ga0466962_0010842_2771_3115 | 100 |
| 16 | 3300046499 | Ga0495594_0261908 | Ga0495594_0261908_431_775 | 101 |
| 17 | 3300003354 | JGI25160J50197_1007165 | JGI25160J50197_10071653 | 106 |
| 18 | 3300025302 | Ga0207426_1002141 | Ga0207426_100214115 | 106 |
| 19 | 3300049579 | Ga0501043_1178781 | Ga0501043_1178781_58_381 | 106 |
| 20 | 3300049822 | Ga0501035_0727618 | Ga0501035_0727618_462_782 | 106 |
| 21 | 3300049823 | Ga0501044_0283239 | Ga0501044_0283239_760_1083 | 106 |
| 22 | iso_pu_bacteria | 2866612099 | 2866613898 | 107 |
| 23 | 3300005334 | Ga0068869_101122902 | Ga0068869_1011229022 | 108 |
| 24 | 3300005347 | Ga0070668_100172169 | Ga0070668_1001721692 | 109 |
| 25 | 3300014968 | Ga0157379_11366494 | Ga0157379_113664942 | 109 |
| 26 | 3300024225 | Ga0224572_1068525 | Ga0224572_10685252 | 109 |
| 27 | 3300025972 | Ga0207668_10031082 | Ga0207668_100310823 | 109 |
| 28 | 3300033545 | Ga0316214_1045684 | Ga0316214_10456842 | 109 |
| 29 | 3300047317 | Ga0495604_0440415 | Ga0495604_0440415_295_639 | 109 |
| 30 | 3300048903 | Ga0496100_0002078 | Ga0496100_0002078_8709_9071 | 109 |
| 31 | 3300048904 | Ga0496101_0809812 | Ga0496101_0809812_156_518 | 109 |
| 32 | 3300048908 | Ga0496105_0069444 | Ga0496105_0069444_2210_2572 | 109 |
| 33 | 3300048909 | Ga0496106_0268147 | Ga0496106_0268147_96_458 | 109 |
| 34 | 3300048910 | Ga0496107_0483784 | Ga0496107_0483784_471_833 | 109 |
| 35 | 3300048913 | Ga0496110_0072539 | Ga0496110_0072539_728_1090 | 109 |
| 36 | 3300048922 | Ga0496119_0001496 | Ga0496119_0001496_7389_7751 | 109 |
| 37 | 3300048923 | Ga0496120_0006904 | Ga0496120_0006904_2655_3017 | 109 |
| 38 | 3300048924 | Ga0496121_0032589 | Ga0496121_0032589_2549_2911 | 109 |
| 39 | 3300048927 | Ga0496124_0030346 | Ga0496124_0030346_1328_1690 | 109 |
| 40 | 3300048929 | Ga0496126_0073912 | Ga0496126_0073912_2204_2566 | 109 |
| 41 | 3300005355 | Ga0070671_100001105 | Ga0070671_10000110520 | 110 |
| 42 | 3300005842 | Ga0068858_100002423 | Ga0068858_10000242310 | 110 |
| 43 | 3300014968 | Ga0157379_10151639 | Ga0157379_101516394 | 110 |
| 44 | 3300024225 | Ga0224572_1026858 | Ga0224572_10268581 | 110 |
| 45 | 3300025931 | Ga0207644_10004961 | Ga0207644_100049613 | 110 |
| 46 | 3300026035 | Ga0207703_10216353 | Ga0207703_102163533 | 110 |
| 47 | iso_pu_bacteria | 2506783011 | 2506865112 | 110 |
| 48 | iso_pu_bacteria | 2508501039 | 2508677985 | 110 |
| 49 | iso_pu_bacteria | 2675902999 | 2676204330 | 110 |
| 50 | iso_pu_bacteria | 2773857921 | 2774848906 | 110 |
| 51 | iso_pu_bacteria | 2947224130 | 2947231757 | 110 |
| 52 | iso_pu_bacteria | 8002784119 | 8002786056 | 110 |
| 53 | iso_pu_bacteria | 8054160619 | 8054161562 | 110 |
| 54 | iso_pu_bacteria | 8056829672 | 8056834118 | 110 |
| 55 | iso_pu_bacteria | 2547132424 | 2548694333 | 111 |
| 56 | iso_pu_bacteria | 2870782633 | 2870788314 | 111 |
| 57 | 3300003323 | rootH1_10064519 | rootH1_100645193 | 112 |
| 58 | 3300005338 | Ga0068868_101014736 | Ga0068868_1010147362 | 112 |
| 59 | 3300005937 | Ga0081455_10016844 | Ga0081455_100168447 | 112 |
| 60 | 3300006038 | Ga0075365_10023875 | Ga0075365_100238752 | 112 |
| 61 | 3300006048 | Ga0075363_100014560 | Ga0075363_1000145602 | 112 |
| 62 | 3300006051 | Ga0075364_10001374 | Ga0075364_100013746 | 112 |
| 63 | 3300006177 | Ga0075362_10108632 | Ga0075362_101086323 | 112 |
| 64 | 3300006186 | Ga0075369_10003527 | Ga0075369_100035275 | 112 |
| 65 | 3300006846 | Ga0075430_100080156 | Ga0075430_1000801563 | 112 |
| 66 | 3300010375 | Ga0105239_11178402 | Ga0105239_111784022 | 112 |
| 67 | 3300013306 | Ga0163162_10073949 | Ga0163162_100739494 | 112 |
| 68 | 3300017792 | Ga0163161_10163246 | Ga0163161_101632462 | 112 |
| 69 | 3300026023 | Ga0207677_11321343 | Ga0207677_113213432 | 112 |
| 70 | 3300041410 | Ga0439461_0013621 | Ga0439461_0013621_499_837 | 112 |
| 71 | 3300041413 | Ga0439465_0044142 | Ga0439465_0044142_485_823 | 112 |
| 72 | 3300041413 | Ga0439465_0081566 | Ga0439465_0081566_295_633 | 112 |
| 73 | 3300041997 | Ga0439431_0022260 | Ga0439431_0022260_1093_1431 | 112 |
| 74 | 3300042002 | Ga0439442_002820 | Ga0439442_002820_1343_1681 | 112 |
| 75 | 3300042002 | Ga0439442_158053 | Ga0439442_158053_132_470 | 112 |
| 76 | 3300042435 | Ga0439434_0221897 | Ga0439434_0221897_90_428 | 112 |
| 77 | 3300044706 | Ga0466964_0016922 | Ga0466964_0016922_1028_1366 | 112 |
| 78 | 3300044735 | Ga0466968_0287272 | Ga0466968_0287272_239_577 | 112 |
| 79 | 3300046460 | Ga0495638_0001977 | Ga0495638_0001977_3302_3640 | 112 |
| 80 | 3300046660 | Ga0495625_0094759 | Ga0495625_0094759_1682_2020 | 112 |
| 81 | 3300046694 | Ga0495649_0258442 | Ga0495649_0258442_402_740 | 112 |
| 82 | 3300047320 | Ga0495672_0077211 | Ga0495672_0077211_439_777 | 112 |
| 83 | 3300047320 | Ga0495672_0341290 | Ga0495672_0341290_329_667 | 112 |
| 84 | 3300047469 | Ga0495673_0361340 | Ga0495673_0361340_153_491 | 112 |
| 85 | 3300050489 | nmdc:mga03683_67430_c1 | nmdc:mga03683_67430_c1_847_1185 | 112 |
| 86 | 3300050490 | nmdc:mga03n38_43772_c1 | nmdc:mga03n38_43772_c1_631_969 | 112 |
| 87 | 3300050491 | nmdc:mga00v17_1723_c1 | nmdc:mga00v17_1723_c1_7262_7600 | 112 |
| 88 | 3300050492 | nmdc:mga0yw44_17450_c1 | nmdc:mga0yw44_17450_c1_874_1212 | 112 |
| 89 | 3300050509 | nmdc:mga0qj67_58338_c1 | nmdc:mga0qj67_58338_c1_1780_2118 | 112 |
| 90 | 3300050516 | nmdc:mga0sz30_4145_c1 | nmdc:mga0sz30_4145_c1_2662_3000 | 112 |
| 91 | 3300053079 | Ga0500610_0004115 | Ga0500610_0004115_2331_2669 | 112 |
| 92 | 3300053104 | Ga0500556_0066795 | Ga0500556_0066795_313_651 | 112 |
| 93 | 3300053131 | Ga0500652_230697 | Ga0500652_230697_306_644 | 112 |
| 94 | 3300053139 | Ga0500568_0283605 | Ga0500568_0283605_195_533 | 112 |
| 95 | 3300053142 | Ga0500577_0360270 | Ga0500577_0360270_125_463 | 112 |
| 96 | 3300053151 | Ga0500604_0067083 | Ga0500604_0067083_463_801 | 112 |
| 97 | 3300053153 | Ga0500616_0050977 | Ga0500616_0050977_452_790 | 112 |
| 98 | 3300053158 | Ga0500627_0260124 | Ga0500627_0260124_127_465 | 112 |
| 99 | 3300002070 | JGI24750J21931_1030232 | JGI24750J21931_10302322 | 113 |
| 100 | 3300002070 | JGI24750J21931_1039437 | JGI24750J21931_10394372 | 113 |
| 101 | 3300002075 | JGI24738J21930_10007081 | JGI24738J21930_100070813 | 113 |
| 102 | 3300002076 | JGI24749J21850_1004169 | JGI24749J21850_10041692 | 113 |
| 103 | 3300002077 | JGI24744J21845_10000768 | JGI24744J21845_100007687 | 113 |
| 104 | 3300005330 | Ga0070690_100053684 | Ga0070690_1000536841 | 113 |
| 105 | 3300005334 | Ga0068869_100046073 | Ga0068869_1000460733 | 113 |
| 106 | 3300005335 | Ga0070666_10576461 | Ga0070666_105764612 | 113 |
| 107 | 3300005336 | Ga0070680_100243202 | Ga0070680_1002432023 | 113 |
| 108 | 3300005338 | Ga0068868_100085099 | Ga0068868_1000850993 | 113 |
| 109 | 3300005339 | Ga0070660_100102747 | Ga0070660_1001027472 | 113 |
| 110 | 3300005341 | Ga0070691_10006144 | Ga0070691_100061448 | 113 |
| 111 | 3300005347 | Ga0070668_100005230 | Ga0070668_1000052308 | 113 |
| 112 | 3300005347 | Ga0070668_100137539 | Ga0070668_1001375392 | 113 |
| 113 | 3300005347 | Ga0070668_100750618 | Ga0070668_1007506182 | 113 |
| 114 | 3300005353 | Ga0070669_100010473 | Ga0070669_1000104738 | 113 |
| 115 | 3300005354 | Ga0070675_100153278 | Ga0070675_1001532784 | 113 |
| 116 | 3300005355 | Ga0070671_100056915 | Ga0070671_1000569154 | 113 |
| 117 | 3300005356 | Ga0070674_100002194 | Ga0070674_1000021948 | 113 |
| 118 | 3300005365 | Ga0070688_100002996 | Ga0070688_1000029964 | 113 |
| 119 | 3300005366 | Ga0070659_100160147 | Ga0070659_1001601472 | 113 |
| 120 | 3300005367 | Ga0070667_100004831 | Ga0070667_1000048319 | 113 |
| 121 | 3300005367 | Ga0070667_100019932 | Ga0070667_1000199326 | 113 |
| 122 | 3300005367 | Ga0070667_100057013 | Ga0070667_1000570133 | 113 |
| 123 | 3300005435 | Ga0070714_100231039 | Ga0070714_1002310392 | 113 |
| 124 | 3300005437 | Ga0070710_10007509 | Ga0070710_100075092 | 113 |
| 125 | 3300005439 | Ga0070711_100003545 | Ga0070711_1000035458 | 113 |
| 126 | 3300005440 | Ga0070705_100007488 | Ga0070705_1000074882 | 113 |
| 127 | 3300005441 | Ga0070700_100011622 | Ga0070700_1000116225 | 113 |
| 128 | 3300005455 | Ga0070663_100226980 | Ga0070663_1002269803 | 113 |
| 129 | 3300005456 | Ga0070678_100002269 | Ga0070678_1000022698 | 113 |
| 130 | 3300005456 | Ga0070678_102151678 | Ga0070678_1021516781 | 113 |
| 131 | 3300005457 | Ga0070662_100012535 | Ga0070662_1000125359 | 113 |
| 132 | 3300005457 | Ga0070662_100257661 | Ga0070662_1002576612 | 113 |
| 133 | 3300005459 | Ga0068867_101516052 | Ga0068867_1015160521 | 113 |
| 134 | 3300005466 | Ga0070685_10096375 | Ga0070685_100963752 | 113 |
| 135 | 3300005466 | Ga0070685_10425575 | Ga0070685_104255752 | 113 |
| 136 | 3300005530 | Ga0070679_100192987 | Ga0070679_1001929871 | 113 |
| 137 | 3300005536 | Ga0070697_100307168 | Ga0070697_1003071682 | 113 |
| 138 | 3300005539 | Ga0068853_100006828 | Ga0068853_1000068288 | 113 |
| 139 | 3300005543 | Ga0070672_100153486 | Ga0070672_1001534862 | 113 |
| 140 | 3300005544 | Ga0070686_100121298 | Ga0070686_1001212982 | 113 |
| 141 | 3300005544 | Ga0070686_100130176 | Ga0070686_1001301762 | 113 |
| 142 | 3300005546 | Ga0070696_100004005 | Ga0070696_1000040052 | 113 |
| 143 | 3300005547 | Ga0070693_100012471 | Ga0070693_1000124711 | 113 |
| 144 | 3300005548 | Ga0070665_100002727 | Ga0070665_10000272719 | 113 |
| 145 | 3300005548 | Ga0070665_100053329 | Ga0070665_1000533294 | 113 |
| 146 | 3300005549 | Ga0070704_100000296 | Ga0070704_10000029618 | 113 |
| 147 | 3300005563 | Ga0068855_100047853 | Ga0068855_1000478537 | 113 |
| 148 | 3300005578 | Ga0068854_100006482 | Ga0068854_10000648210 | 113 |
| 149 | 3300005615 | Ga0070702_100000597 | Ga0070702_10000059713 | 113 |
| 150 | 3300005617 | Ga0068859_100019721 | Ga0068859_10001972111 | 113 |
| 151 | 3300005617 | Ga0068859_100338393 | Ga0068859_1003383932 | 113 |
| 152 | 3300005617 | Ga0068859_102231760 | Ga0068859_1022317602 | 113 |
| 153 | 3300005618 | Ga0068864_100212487 | Ga0068864_1002124873 | 113 |
| 154 | 3300005718 | Ga0068866_10001105 | Ga0068866_100011058 | 113 |
| 155 | 3300005719 | Ga0068861_100029994 | Ga0068861_1000299947 | 113 |
| 156 | 3300005841 | Ga0068863_100015528 | Ga0068863_1000155283 | 113 |
| 157 | 3300005842 | Ga0068858_100015624 | Ga0068858_1000156243 | 113 |
| 158 | 3300005843 | Ga0068860_100009137 | Ga0068860_1000091376 | 113 |
| 159 | 3300005843 | Ga0068860_100201639 | Ga0068860_1002016393 | 113 |
| 160 | 3300005844 | Ga0068862_100005455 | Ga0068862_1000054559 | 113 |
| 161 | 3300005844 | Ga0068862_100187437 | Ga0068862_1001874373 | 113 |
| 162 | 3300005937 | Ga0081455_10202779 | Ga0081455_102027792 | 113 |
| 163 | 3300005937 | Ga0081455_10372578 | Ga0081455_103725782 | 113 |
| 164 | 3300006038 | Ga0075365_10023404 | Ga0075365_100234045 | 113 |
| 165 | 3300006038 | Ga0075365_10303906 | Ga0075365_103039062 | 113 |
| 166 | 3300006048 | Ga0075363_100002334 | Ga0075363_1000023345 | 113 |
| 167 | 3300006048 | Ga0075363_100006020 | Ga0075363_1000060204 | 113 |
| 168 | 3300006048 | Ga0075363_100300448 | Ga0075363_1003004481 | 113 |
| 169 | 3300006051 | Ga0075364_10053475 | Ga0075364_100534755 | 113 |
| 170 | 3300006051 | Ga0075364_10330236 | Ga0075364_103302362 | 113 |
| 171 | 3300006051 | Ga0075364_10413250 | Ga0075364_104132502 | 113 |
| 172 | 3300006163 | Ga0070715_10002818 | Ga0070715_100028185 | 113 |
| 173 | 3300006173 | Ga0070716_100001631 | Ga0070716_1000016318 | 113 |
| 174 | 3300006173 | Ga0070716_101827781 | Ga0070716_1018277811 | 113 |
| 175 | 3300006175 | Ga0070712_100007150 | Ga0070712_1000071502 | 113 |
| 176 | 3300006178 | Ga0075367_10297985 | Ga0075367_102979852 | 113 |
| 177 | 3300006178 | Ga0075367_10354657 | Ga0075367_103546571 | 113 |
| 178 | 3300006178 | Ga0075367_11034599 | Ga0075367_110345992 | 113 |
| 179 | 3300006186 | Ga0075369_10004452 | Ga0075369_100044524 | 113 |
| 180 | 3300006186 | Ga0075369_10012578 | Ga0075369_100125783 | 113 |
| 181 | 3300006186 | Ga0075369_10026816 | Ga0075369_100268164 | 113 |
| 182 | 3300006186 | Ga0075369_10385118 | Ga0075369_103851182 | 113 |
| 183 | 3300006353 | Ga0075370_10029291 | Ga0075370_100292915 | 113 |
| 184 | 3300006353 | Ga0075370_10152694 | Ga0075370_101526942 | 113 |
| 185 | 3300006353 | Ga0075370_10794959 | Ga0075370_107949592 | 113 |
| 186 | 3300006844 | Ga0075428_100014553 | Ga0075428_1000145538 | 113 |
| 187 | 3300006846 | Ga0075430_100098198 | Ga0075430_1000981981 | 113 |
| 188 | 3300006847 | Ga0075431_100089968 | Ga0075431_1000899685 | 113 |
| 189 | 3300006871 | Ga0075434_101628895 | Ga0075434_1016288952 | 113 |
| 190 | 3300006881 | Ga0068865_100002240 | Ga0068865_10000224012 | 113 |
| 191 | 3300006931 | Ga0097620_100019721 | Ga0097620_1000197213 | 113 |
| 192 | 3300006931 | Ga0097620_100338445 | Ga0097620_1003384452 | 113 |
| 193 | 3300006931 | Ga0097620_102231981 | Ga0097620_1022319812 | 113 |
| 194 | 3300007788 | Ga0099795_10229402 | Ga0099795_102294021 | 113 |
| 195 | 3300009092 | Ga0105250_10168412 | Ga0105250_101684122 | 113 |
| 196 | 3300009093 | Ga0105240_11046854 | Ga0105240_110468541 | 113 |
| 197 | 3300009098 | Ga0105245_10003298 | Ga0105245_1000329810 | 113 |
| 198 | 3300009101 | Ga0105247_10001904 | Ga0105247_100019049 | 113 |
| 199 | 3300009147 | Ga0114129_10617852 | Ga0114129_106178522 | 113 |
| 200 | 3300009148 | Ga0105243_10001353 | Ga0105243_1000135313 | 113 |
| 201 | 3300009174 | Ga0105241_10048185 | Ga0105241_100481854 | 113 |
| 202 | 3300009176 | Ga0105242_10012280 | Ga0105242_100122809 | 113 |
| 203 | 3300009177 | Ga0105248_10006452 | Ga0105248_1000645217 | 113 |
| 204 | 3300009177 | Ga0105248_10944609 | Ga0105248_109446091 | 113 |
| 205 | 3300009177 | Ga0105248_11119138 | Ga0105248_111191381 | 113 |
| 206 | 3300009545 | Ga0105237_10028982 | Ga0105237_100289822 | 113 |
| 207 | 3300009545 | Ga0105237_11255355 | Ga0105237_112553551 | 113 |
| 208 | 3300009551 | Ga0105238_10092685 | Ga0105238_100926854 | 113 |
| 209 | 3300009553 | Ga0105249_10006656 | Ga0105249_1000665613 | 113 |
| 210 | 3300009553 | Ga0105249_10033047 | Ga0105249_100330474 | 113 |
| 211 | 3300010375 | Ga0105239_10008146 | Ga0105239_1000814610 | 113 |
| 212 | 3300010375 | Ga0105239_10707093 | Ga0105239_107070931 | 113 |
| 213 | 3300011119 | Ga0105246_10476442 | Ga0105246_104764423 | 113 |
| 214 | 3300013100 | Ga0157373_10283325 | Ga0157373_102833252 | 113 |
| 215 | 3300013296 | Ga0157374_10771817 | Ga0157374_107718173 | 113 |
| 216 | 3300013297 | Ga0157378_10029837 | Ga0157378_100298376 | 113 |
| 217 | 3300013306 | Ga0163162_10015988 | Ga0163162_100159887 | 113 |
| 218 | 3300013308 | Ga0157375_10004140 | Ga0157375_1000414014 | 113 |
| 219 | 3300014325 | Ga0163163_10055612 | Ga0163163_100556123 | 113 |
| 220 | 3300014326 | Ga0157380_10042950 | Ga0157380_100429506 | 113 |
| 221 | 3300014745 | Ga0157377_10023445 | Ga0157377_100234453 | 113 |
| 222 | 3300014968 | Ga0157379_10007492 | Ga0157379_1000749212 | 113 |
| 223 | 3300017792 | Ga0163161_10002596 | Ga0163161_1000259610 | 113 |
| 224 | 3300021384 | Ga0213876_10349311 | Ga0213876_103493113 | 113 |
| 225 | 3300025885 | Ga0207653_10043880 | Ga0207653_100438802 | 113 |
| 226 | 3300025898 | Ga0207692_10007036 | Ga0207692_100070362 | 113 |
| 227 | 3300025900 | Ga0207710_10275425 | Ga0207710_102754252 | 113 |
| 228 | 3300025900 | Ga0207710_10336090 | Ga0207710_103360902 | 113 |
| 229 | 3300025901 | Ga0207688_10002256 | Ga0207688_100022569 | 113 |
| 230 | 3300025903 | Ga0207680_10014155 | Ga0207680_100141552 | 113 |
| 231 | 3300025903 | Ga0207680_10739000 | Ga0207680_107390002 | 113 |
| 232 | 3300025905 | Ga0207685_10002905 | Ga0207685_100029052 | 113 |
| 233 | 3300025906 | Ga0207699_10426806 | Ga0207699_104268063 | 113 |
| 234 | 3300025911 | Ga0207654_10063027 | Ga0207654_100630272 | 113 |
| 235 | 3300025914 | Ga0207671_10070883 | Ga0207671_100708834 | 113 |
| 236 | 3300025915 | Ga0207693_10002138 | Ga0207693_100021389 | 113 |
| 237 | 3300025916 | Ga0207663_10066729 | Ga0207663_100667294 | 113 |
| 238 | 3300025917 | Ga0207660_10141829 | Ga0207660_101418293 | 113 |
| 239 | 3300025919 | Ga0207657_10426828 | Ga0207657_104268282 | 113 |
| 240 | 3300025923 | Ga0207681_10118932 | Ga0207681_101189321 | 113 |
| 241 | 3300025924 | Ga0207694_10193712 | Ga0207694_101937123 | 113 |
| 242 | 3300025925 | Ga0207650_10325086 | Ga0207650_103250863 | 113 |
| 243 | 3300025926 | Ga0207659_10100404 | Ga0207659_101004044 | 113 |
| 244 | 3300025927 | Ga0207687_10008447 | Ga0207687_100084475 | 113 |
| 245 | 3300025929 | Ga0207664_10224082 | Ga0207664_102240822 | 113 |
| 246 | 3300025931 | Ga0207644_10001385 | Ga0207644_100013854 | 113 |
| 247 | 3300025931 | Ga0207644_10229309 | Ga0207644_102293093 | 113 |
| 248 | 3300025932 | Ga0207690_10739842 | Ga0207690_107398422 | 113 |
| 249 | 3300025933 | Ga0207706_10001778 | Ga0207706_1000177817 | 113 |
| 250 | 3300025934 | Ga0207686_10085692 | Ga0207686_100856922 | 113 |
| 251 | 3300025935 | Ga0207709_10007635 | Ga0207709_100076354 | 113 |
| 252 | 3300025938 | Ga0207704_10005156 | Ga0207704_1000515611 | 113 |
| 253 | 3300025939 | Ga0207665_10003399 | Ga0207665_100033998 | 113 |
| 254 | 3300025940 | Ga0207691_10570953 | Ga0207691_105709531 | 113 |
| 255 | 3300025941 | Ga0207711_10036998 | Ga0207711_100369983 | 113 |
| 256 | 3300025941 | Ga0207711_10810240 | Ga0207711_108102402 | 113 |
| 257 | 3300025942 | Ga0207689_10225905 | Ga0207689_102259053 | 113 |
| 258 | 3300025949 | Ga0207667_10250564 | Ga0207667_102505642 | 113 |
| 259 | 3300025961 | Ga0207712_10038275 | Ga0207712_100382754 | 113 |
| 260 | 3300025972 | Ga0207668_10014668 | Ga0207668_100146684 | 113 |
| 261 | 3300025972 | Ga0207668_10090288 | Ga0207668_100902882 | 113 |
| 262 | 3300025981 | Ga0207640_10136874 | Ga0207640_101368743 | 113 |
| 263 | 3300025986 | Ga0207658_10012942 | Ga0207658_100129426 | 113 |
| 264 | 3300025986 | Ga0207658_10035789 | Ga0207658_100357894 | 113 |
| 265 | 3300025986 | Ga0207658_10574707 | Ga0207658_105747072 | 113 |
| 266 | 3300026023 | Ga0207677_10007113 | Ga0207677_100071135 | 113 |
| 267 | 3300026035 | Ga0207703_10014586 | Ga0207703_100145865 | 113 |
| 268 | 3300026035 | Ga0207703_11120950 | Ga0207703_111209502 | 113 |
| 269 | 3300026041 | Ga0207639_10010629 | Ga0207639_100106296 | 113 |
| 270 | 3300026067 | Ga0207678_10016795 | Ga0207678_100167955 | 113 |
| 271 | 3300026075 | Ga0207708_10006981 | Ga0207708_100069813 | 113 |
| 272 | 3300026088 | Ga0207641_10056044 | Ga0207641_100560442 | 113 |
| 273 | 3300026088 | Ga0207641_10711708 | Ga0207641_107117082 | 113 |
| 274 | 3300026089 | Ga0207648_10007938 | Ga0207648_1000793818 | 113 |
| 275 | 3300026095 | Ga0207676_11805136 | Ga0207676_118051362 | 113 |
| 276 | 3300026118 | Ga0207675_100008415 | Ga0207675_1000084157 | 113 |
| 277 | 3300026118 | Ga0207675_101341548 | Ga0207675_1013415482 | 113 |
| 278 | 3300026121 | Ga0207683_10002944 | Ga0207683_1000294418 | 113 |
| 279 | 3300027512 | Ga0209179_1061636 | Ga0209179_10616362 | 113 |
| 280 | 3300028379 | Ga0268266_10007089 | Ga0268266_100070897 | 113 |
| 281 | 3300028379 | Ga0268266_10103876 | Ga0268266_101038763 | 113 |
| 282 | 3300028380 | Ga0268265_10278078 | Ga0268265_102780783 | 113 |
| 283 | 3300028381 | Ga0268264_10128722 | Ga0268264_101287222 | 113 |
| 284 | 3300032005 | Ga0307411_10518712 | Ga0307411_105187122 | 113 |
| 285 | 3300032126 | Ga0307415_100253541 | Ga0307415_1002535413 | 113 |
| 286 | 3300034957 | Ga0373938_0191575 | Ga0373938_0191575_95_436 | 113 |
| 287 | 3300035691 | Ga0373931_0083708 | Ga0373931_0083708_24_365 | 113 |
| 288 | 3300036459 | Ga0372808_041009 | Ga0372808_041009_65_415 | 113 |
| 289 | 3300038443 | Ga0395901_2061833 | Ga0395901_2061833_145_486 | 113 |
| 290 | 3300039437 | Ga0436365_1159535 | Ga0436365_1159535_142_483 | 113 |
| 291 | 3300044658 | Ga0466972_0016444 | Ga0466972_0016444_631_972 | 113 |
| 292 | 3300044694 | Ga0466963_0253255 | Ga0466963_0253255_691_1032 | 113 |
| 293 | 3300044735 | Ga0466968_0218405 | Ga0466968_0218405_410_751 | 113 |
| 294 | 3300044765 | Ga0466970_0115568 | Ga0466970_0115568_345_686 | 113 |
| 295 | 3300044901 | Ga0466960_0583835 | Ga0466960_0583835_184_525 | 113 |
| 296 | 3300045836 | Ga0466958_0315504 | Ga0466958_0315504_386_742 | 113 |
| 297 | 3300048903 | Ga0496100_0003101 | Ga0496100_0003101_2654_2995 | 113 |
| 298 | 3300048904 | Ga0496101_0004725 | Ga0496101_0004725_8203_8544 | 113 |
| 299 | 3300048904 | Ga0496101_0799603 | Ga0496101_0799603_277_618 | 113 |
| 300 | 3300048905 | Ga0496102_0013469 | Ga0496102_0013469_1791_2132 | 113 |
| 301 | 3300048905 | Ga0496102_0070790 | Ga0496102_0070790_2679_3020 | 113 |
| 302 | 3300048906 | Ga0496103_0000638 | Ga0496103_0000638_8114_8455 | 113 |
| 303 | 3300048906 | Ga0496103_0068655 | Ga0496103_0068655_251_592 | 113 |
| 304 | 3300048908 | Ga0496105_0169666 | Ga0496105_0169666_703_1044 | 113 |
| 305 | 3300048908 | Ga0496105_0695843 | Ga0496105_0695843_305_646 | 113 |
| 306 | 3300048909 | Ga0496106_0000851 | Ga0496106_0000851_14578_14919 | 113 |
| 307 | 3300048910 | Ga0496107_0027339 | Ga0496107_0027339_2047_2388 | 113 |
| 308 | 3300048911 | Ga0496108_0337619 | Ga0496108_0337619_856_1197 | 113 |
| 309 | 3300048912 | Ga0496109_0061463 | Ga0496109_0061463_1887_2228 | 113 |
| 310 | 3300048913 | Ga0496110_0084620 | Ga0496110_0084620_1560_1901 | 113 |
| 311 | 3300048914 | Ga0496111_0011268 | Ga0496111_0011268_2084_2425 | 113 |
| 312 | 3300048915 | Ga0496112_0003000 | Ga0496112_0003000_8725_9066 | 113 |
| 313 | 3300048915 | Ga0496112_0538557 | Ga0496112_0538557_681_1022 | 113 |
| 314 | 3300048916 | Ga0496113_0081102 | Ga0496113_0081102_793_1134 | 113 |
| 315 | 3300048916 | Ga0496113_0108705 | Ga0496113_0108705_446_793 | 113 |
| 316 | 3300048916 | Ga0496113_1582407 | Ga0496113_1582407_14_355 | 113 |
| 317 | 3300048917 | Ga0496114_0005066 | Ga0496114_0005066_4952_5293 | 113 |
| 318 | 3300048917 | Ga0496114_0780602 | Ga0496114_0780602_13_354 | 113 |
| 319 | 3300048918 | Ga0496115_0007280 | Ga0496115_0007280_5211_5552 | 113 |
| 320 | 3300050490 | nmdc:mga03n38_251340_c1 | nmdc:mga03n38_251340_c1_215_556 | 113 |
| 321 | 3300050490 | nmdc:mga03n38_58577_c1 | nmdc:mga03n38_58577_c1_1105_1446 | 113 |
| 322 | 3300050491 | nmdc:mga00v17_115348_c1 | nmdc:mga00v17_115348_c1_1001_1342 | 113 |
| 323 | 3300050492 | nmdc:mga0yw44_69467_c1 | nmdc:mga0yw44_69467_c1_937_1278 | 113 |
| 324 | 3300050494 | nmdc:mga06z11_229110_c1 | nmdc:mga06z11_229110_c1_134_475 | 113 |
| 325 | 3300050494 | nmdc:mga06z11_790076_c1 | nmdc:mga06z11_790076_c1_98_439 | 113 |
| 326 | 3300050494 | nmdc:mga06z11_907036_c1 | nmdc:mga06z11_907036_c1_38_379 | 113 |
| 327 | 3300050496 | nmdc:mga07m45_194435_c1 | nmdc:mga07m45_194435_c1_88_429 | 113 |
| 328 | 3300050507 | nmdc:mga05p37_228275_c1 | nmdc:mga05p37_228275_c1_1693_2034 | 113 |
| 329 | 3300050509 | nmdc:mga0qj67_136182_c1 | nmdc:mga0qj67_136182_c1_309_650 | 113 |
| 330 | 3300050516 | nmdc:mga0sz30_12989_c1 | nmdc:mga0sz30_12989_c1_2737_3078 | 113 |
| 331 | 3300050516 | nmdc:mga0sz30_25693_c1 | nmdc:mga0sz30_25693_c1_1819_2160 | 113 |
| 332 | 3300050516 | nmdc:mga0sz30_4369_c1 | nmdc:mga0sz30_4369_c1_3001_3342 | 113 |
| 333 | 3300053153 | Ga0500616_0003087 | Ga0500616_0003087_3487_3828 | 113 |
| 334 | 3300059478 | Ga0587093_105030 | Ga0587093_105030_152_493 | 113 |
| 335 | 3300059643 | Ga0587072_188349 | Ga0587072_188349_155_496 | 113 |
| 336 | 3300003354 | JGI25160J50197_1055960 | JGI25160J50197_10559601 | 114 |
| 337 | 3300005355 | Ga0070671_100515899 | Ga0070671_1005158992 | 114 |
| 338 | 3300005434 | Ga0070709_10101629 | Ga0070709_101016293 | 114 |
| 339 | 3300005434 | Ga0070709_10579727 | Ga0070709_105797271 | 114 |
| 340 | 3300005434 | Ga0070709_11551455 | Ga0070709_115514551 | 114 |
| 341 | 3300005435 | Ga0070714_100014627 | Ga0070714_1000146274 | 114 |
| 342 | 3300005435 | Ga0070714_100535042 | Ga0070714_1005350421 | 114 |
| 343 | 3300005435 | Ga0070714_101633775 | Ga0070714_1016337752 | 114 |
| 344 | 3300005436 | Ga0070713_100356772 | Ga0070713_1003567722 | 114 |
| 345 | 3300005436 | Ga0070713_102400823 | Ga0070713_1024008231 | 114 |
| 346 | 3300005437 | Ga0070710_10098735 | Ga0070710_100987354 | 114 |
| 347 | 3300005437 | Ga0070710_10376908 | Ga0070710_103769083 | 114 |
| 348 | 3300005437 | Ga0070710_10387119 | Ga0070710_103871192 | 114 |
| 349 | 3300005437 | Ga0070710_11239824 | Ga0070710_112398241 | 114 |
| 350 | 3300005437 | Ga0070710_11449794 | Ga0070710_114497941 | 114 |
| 351 | 3300005439 | Ga0070711_101882462 | Ga0070711_1018824621 | 114 |
| 352 | 3300005445 | Ga0070708_100013584 | Ga0070708_10001358411 | 114 |
| 353 | 3300005467 | Ga0070706_100583427 | Ga0070706_1005834272 | 114 |
| 354 | 3300005468 | Ga0070707_100353046 | Ga0070707_1003530462 | 114 |
| 355 | 3300005614 | Ga0068856_100970156 | Ga0068856_1009701563 | 114 |
| 356 | 3300005719 | Ga0068861_101654380 | Ga0068861_1016543802 | 114 |
| 357 | 3300005841 | Ga0068863_100236891 | Ga0068863_1002368913 | 114 |
| 358 | 3300006028 | Ga0070717_10911773 | Ga0070717_109117732 | 114 |
| 359 | 3300006038 | Ga0075365_10021101 | Ga0075365_100211014 | 114 |
| 360 | 3300006038 | Ga0075365_10084632 | Ga0075365_100846322 | 114 |
| 361 | 3300006038 | Ga0075365_10089239 | Ga0075365_100892393 | 114 |
| 362 | 3300006038 | Ga0075365_10249753 | Ga0075365_102497531 | 114 |
| 363 | 3300006038 | Ga0075365_11026785 | Ga0075365_110267851 | 114 |
| 364 | 3300006048 | Ga0075363_100051731 | Ga0075363_1000517313 | 114 |
| 365 | 3300006048 | Ga0075363_100079221 | Ga0075363_1000792213 | 114 |
| 366 | 3300006051 | Ga0075364_10006662 | Ga0075364_100066623 | 114 |
| 367 | 3300006051 | Ga0075364_10039979 | Ga0075364_100399794 | 114 |
| 368 | 3300006051 | Ga0075364_10055840 | Ga0075364_100558404 | 114 |
| 369 | 3300006051 | Ga0075364_10128648 | Ga0075364_101286484 | 114 |
| 370 | 3300006051 | Ga0075364_10449365 | Ga0075364_104493653 | 114 |
| 371 | 3300006163 | Ga0070715_10004177 | Ga0070715_100041773 | 114 |
| 372 | 3300006173 | Ga0070716_100025500 | Ga0070716_1000255005 | 114 |
| 373 | 3300006175 | Ga0070712_100211110 | Ga0070712_1002111102 | 114 |
| 374 | 3300006175 | Ga0070712_100777633 | Ga0070712_1007776332 | 114 |
| 375 | 3300006175 | Ga0070712_101871470 | Ga0070712_1018714701 | 114 |
| 376 | 3300006177 | Ga0075362_10356194 | Ga0075362_103561942 | 114 |
| 377 | 3300006178 | Ga0075367_10129597 | Ga0075367_101295973 | 114 |
| 378 | 3300006178 | Ga0075367_10180546 | Ga0075367_101805461 | 114 |
| 379 | 3300006178 | Ga0075367_10410360 | Ga0075367_104103602 | 114 |
| 380 | 3300006178 | Ga0075367_10901688 | Ga0075367_109016882 | 114 |
| 381 | 3300006186 | Ga0075369_10424872 | Ga0075369_104248722 | 114 |
| 382 | 3300006237 | Ga0097621_100507887 | Ga0097621_1005078872 | 114 |
| 383 | 3300006353 | Ga0075370_10223618 | Ga0075370_102236182 | 114 |
| 384 | 3300007076 | Ga0075435_100578607 | Ga0075435_1005786072 | 114 |
| 385 | 3300009174 | Ga0105241_11526043 | Ga0105241_115260431 | 114 |
| 386 | 3300009545 | Ga0105237_11243367 | Ga0105237_112433672 | 114 |
| 387 | 3300009551 | Ga0105238_10841928 | Ga0105238_108419281 | 114 |
| 388 | 3300010375 | Ga0105239_10655611 | Ga0105239_106556112 | 114 |
| 389 | 3300012498 | Ga0157345_1059555 | Ga0157345_10595551 | 114 |
| 390 | 3300013105 | Ga0157369_10725168 | Ga0157369_107251682 | 114 |
| 391 | 3300013307 | Ga0157372_11231789 | Ga0157372_112317892 | 114 |
| 392 | 3300021388 | Ga0213875_10046442 | Ga0213875_100464422 | 114 |
| 393 | 3300025302 | Ga0207426_1014742 | Ga0207426_10147422 | 114 |
| 394 | 3300025898 | Ga0207692_10207298 | Ga0207692_102072982 | 114 |
| 395 | 3300025898 | Ga0207692_10552026 | Ga0207692_105520262 | 114 |
| 396 | 3300025905 | Ga0207685_10026638 | Ga0207685_100266383 | 114 |
| 397 | 3300025906 | Ga0207699_10030008 | Ga0207699_100300084 | 114 |
| 398 | 3300025906 | Ga0207699_10034493 | Ga0207699_100344933 | 114 |
| 399 | 3300025915 | Ga0207693_10067573 | Ga0207693_100675733 | 114 |
| 400 | 3300025915 | Ga0207693_10271285 | Ga0207693_102712853 | 114 |
| 401 | 3300025916 | Ga0207663_10473316 | Ga0207663_104733162 | 114 |
| 402 | 3300025916 | Ga0207663_11328073 | Ga0207663_113280731 | 114 |
| 403 | 3300025922 | Ga0207646_10118711 | Ga0207646_101187112 | 114 |
| 404 | 3300025928 | Ga0207700_10091706 | Ga0207700_100917063 | 114 |
| 405 | 3300025928 | Ga0207700_10720099 | Ga0207700_107200993 | 114 |
| 406 | 3300025929 | Ga0207664_10033835 | Ga0207664_100338353 | 114 |
| 407 | 3300025929 | Ga0207664_10039077 | Ga0207664_100390772 | 114 |
| 408 | 3300025929 | Ga0207664_10062491 | Ga0207664_100624915 | 114 |
| 409 | 3300025931 | Ga0207644_11540861 | Ga0207644_115408611 | 114 |
| 410 | 3300025939 | Ga0207665_10072021 | Ga0207665_100720213 | 114 |
| 411 | 3300026023 | Ga0207677_10466810 | Ga0207677_104668102 | 114 |
| 412 | 3300026078 | Ga0207702_10411469 | Ga0207702_104114693 | 114 |
| 413 | 3300026088 | Ga0207641_10337217 | Ga0207641_103372174 | 114 |
| 414 | 3300026142 | Ga0207698_11327804 | Ga0207698_113278042 | 114 |
| 415 | 3300028794 | Ga0307515_10013555 | Ga0307515_1001355511 | 114 |
| 416 | 3300028794 | Ga0307515_10037351 | Ga0307515_100373519 | 114 |
| 417 | 3300030522 | Ga0307512_10016119 | Ga0307512_100161197 | 114 |
| 418 | 3300030863 | Ga0265766_1021317 | Ga0265766_10213172 | 114 |
| 419 | 3300030882 | Ga0265764_112221 | Ga0265764_1122212 | 114 |
| 420 | 3300031043 | Ga0265779_111167 | Ga0265779_1111672 | 114 |
| 421 | 3300031456 | Ga0307513_10001447 | Ga0307513_1000144713 | 114 |
| 422 | 3300031456 | Ga0307513_10281069 | Ga0307513_102810692 | 114 |
| 423 | 3300031507 | Ga0307509_10093794 | Ga0307509_100937944 | 114 |
| 424 | 3300031616 | Ga0307508_10197969 | Ga0307508_101979693 | 114 |
| 425 | 3300031616 | Ga0307508_10648439 | Ga0307508_106484392 | 114 |
| 426 | 3300031730 | Ga0307516_10002519 | Ga0307516_100025193 | 114 |
| 427 | 3300031730 | Ga0307516_10604636 | Ga0307516_106046362 | 114 |
| 428 | 3300031730 | Ga0307516_10705757 | Ga0307516_107057572 | 114 |
| 429 | 3300031838 | Ga0307518_10108463 | Ga0307518_101084632 | 114 |
| 430 | 3300033179 | Ga0307507_10000090 | Ga0307507_1000009032 | 114 |
| 431 | 3300033179 | Ga0307507_10399600 | Ga0307507_103996001 | 114 |
| 432 | 3300033180 | Ga0307510_10294973 | Ga0307510_102949733 | 114 |
| 433 | 3300035083 | Ga0373926_0001208 | Ga0373926_0001208_6507_6851 | 114 |
| 434 | 3300035089 | Ga0373944_0010340 | Ga0373944_0010340_1652_1996 | 114 |
| 435 | 3300035113 | Ga0373936_0000687 | Ga0373936_0000687_6197_6541 | 114 |
| 436 | 3300035116 | Ga0373945_0000543 | Ga0373945_0000543_6329_6673 | 114 |
| 437 | 3300035120 | Ga0373957_0208834 | Ga0373957_0208834_306_650 | 114 |
| 438 | 3300035170 | Ga0373943_0000294 | Ga0373943_0000294_17616_17960 | 114 |
| 439 | 3300035170 | Ga0373943_0389543 | Ga0373943_0389543_154_498 | 114 |
| 440 | 3300035170 | Ga0373943_0437980 | Ga0373943_0437980_183_527 | 114 |
| 441 | 3300035171 | Ga0373946_0000333 | Ga0373946_0000333_753_1097 | 114 |
| 442 | 3300035410 | Ga0373924_0244556 | Ga0373924_0244556_385_729 | 114 |
| 443 | 3300035692 | Ga0373935_0038129 | Ga0373935_0038129_2563_2907 | 114 |
| 444 | 3300035692 | Ga0373935_0096349 | Ga0373935_0096349_1450_1794 | 114 |
| 445 | 3300035695 | Ga0373927_0033472 | Ga0373927_0033472_2801_3145 | 114 |
| 446 | 3300035695 | Ga0373927_0567573 | Ga0373927_0567573_266_610 | 114 |
| 447 | 3300035725 | Ga0373947_0000366 | Ga0373947_0000366_19028_19372 | 114 |
| 448 | 3300035725 | Ga0373947_0187145 | Ga0373947_0187145_63_407 | 114 |
| 449 | 3300035725 | Ga0373947_0410272 | Ga0373947_0410272_416_760 | 114 |
| 450 | 3300037068 | Ga0373925_0004806 | Ga0373925_0004806_517_861 | 114 |
| 451 | 3300037418 | Ga0395900_0130030 | Ga0395900_0130030_462_806 | 114 |
| 452 | 3300037466 | Ga0395898_0000967 | Ga0395898_0000967_214_558 | 114 |
| 453 | 3300037471 | Ga0395905_0383175 | Ga0395905_0383175_268_612 | 114 |
| 454 | 3300037853 | Ga0436364_1448068 | Ga0436364_1448068_6523_6867 | 114 |
| 455 | 3300038443 | Ga0395901_0050096 | Ga0395901_0050096_2291_2635 | 114 |
| 456 | 3300041406 | Ga0439439_0011776 | Ga0439439_0011776_269_613 | 114 |
| 457 | 3300041453 | Ga0451797_0572430 | Ga0451797_0572430_184_528 | 114 |
| 458 | 3300041463 | Ga0451804_0381060 | Ga0451804_0381060_238_582 | 114 |
| 459 | 3300041509 | Ga0451843_0192007 | Ga0451843_0192007_131_475 | 114 |
| 460 | 3300041512 | Ga0451853_0321697 | Ga0451853_0321697_100_456 | 114 |
| 461 | 3300041999 | Ga0439433_0004058 | Ga0439433_0004058_1652_1996 | 114 |
| 462 | 3300042007 | Ga0439449_0001367 | Ga0439449_0001367_5519_5863 | 114 |
| 463 | 3300042014 | Ga0439457_003638 | Ga0439457_003638_1392_1736 | 114 |
| 464 | 3300044656 | Ga0466969_0137673 | Ga0466969_0137673_471_815 | 114 |
| 465 | 3300044684 | Ga0466966_0044209 | Ga0466966_0044209_2415_2759 | 114 |
| 466 | 3300044684 | Ga0466966_0908793 | Ga0466966_0908793_30_374 | 114 |
| 467 | 3300044693 | Ga0466961_0220442 | Ga0466961_0220442_516_860 | 114 |
| 468 | 3300044694 | Ga0466963_0395146 | Ga0466963_0395146_551_913 | 114 |
| 469 | 3300044694 | Ga0466963_0817024 | Ga0466963_0817024_164_508 | 114 |
| 470 | 3300044719 | Ga0466971_0454048 | Ga0466971_0454048_110_454 | 114 |
| 471 | 3300044735 | Ga0466968_0107092 | Ga0466968_0107092_845_1189 | 114 |
| 472 | 3300044735 | Ga0466968_0150607 | Ga0466968_0150607_222_566 | 114 |
| 473 | 3300044842 | Ga0466957_0165703 | Ga0466957_0165703_203_547 | 114 |
| 474 | 3300045049 | Ga0466959_0223801 | Ga0466959_0223801_734_1078 | 114 |
| 475 | 3300045836 | Ga0466958_0060390 | Ga0466958_0060390_1759_2103 | 114 |
| 476 | 3300045976 | Ga0466967_0221669 | Ga0466967_0221669_319_663 | 114 |
| 477 | 3300045976 | Ga0466967_0626896 | Ga0466967_0626896_561_905 | 114 |
| 478 | 3300046454 | Ga0495592_0000338 | Ga0495592_0000338_37646_37993 | 114 |
| 479 | 3300046459 | Ga0495629_0497543 | Ga0495629_0497543_204_551 | 114 |
| 480 | 3300046460 | Ga0495638_0162577 | Ga0495638_0162577_787_1131 | 114 |
| 481 | 3300046461 | Ga0495641_0123460 | Ga0495641_0123460_747_1091 | 114 |
| 482 | 3300046462 | Ga0495651_0000436 | Ga0495651_0000436_318_665 | 114 |
| 483 | 3300046462 | Ga0495651_0223143 | Ga0495651_0223143_802_1146 | 114 |
| 484 | 3300046463 | Ga0495653_0014057 | Ga0495653_0014057_3723_4070 | 114 |
| 485 | 3300046463 | Ga0495653_0022636 | Ga0495653_0022636_705_1049 | 114 |
| 486 | 3300046475 | Ga0495639_0063782 | Ga0495639_0063782_241_585 | 114 |
| 487 | 3300046476 | Ga0495662_0177879 | Ga0495662_0177879_672_1019 | 114 |
| 488 | 3300046476 | Ga0495662_0396988 | Ga0495662_0396988_312_656 | 114 |
| 489 | 3300046477 | Ga0495664_0028227 | Ga0495664_0028227_144_488 | 114 |
| 490 | 3300046511 | Ga0495608_0061454 | Ga0495608_0061454_1381_1725 | 114 |
| 491 | 3300046514 | Ga0495618_0064466 | Ga0495618_0064466_976_1320 | 114 |
| 492 | 3300046517 | Ga0495630_0000359 | Ga0495630_0000359_32073_32420 | 114 |
| 493 | 3300046517 | Ga0495630_0375039 | Ga0495630_0375039_540_884 | 114 |
| 494 | 3300046529 | Ga0495652_0055768 | Ga0495652_0055768_125_469 | 114 |
| 495 | 3300046531 | Ga0495665_0009674 | Ga0495665_0009674_213_560 | 114 |
| 496 | 3300046536 | Ga0495587_0092851 | Ga0495587_0092851_918_1262 | 114 |
| 497 | 3300046543 | Ga0495645_0259752 | Ga0495645_0259752_613_957 | 114 |
| 498 | 3300046559 | Ga0495667_0025134 | Ga0495667_0025134_2191_2535 | 114 |
| 499 | 3300046642 | Ga0495634_0019164 | Ga0495634_0019164_3998_4342 | 114 |
| 500 | 3300046642 | Ga0495634_0039098 | Ga0495634_0039098_2792_3154 | 114 |
| 501 | 3300046663 | Ga0495635_0035888 | Ga0495635_0035888_2776_3120 | 114 |
| 502 | 3300046675 | Ga0495657_0041857 | Ga0495657_0041857_2343_2687 | 114 |
| 503 | 3300046678 | Ga0495599_0744449 | Ga0495599_0744449_186_530 | 114 |
| 504 | 3300046679 | Ga0495623_0094568 | Ga0495623_0094568_1183_1530 | 114 |
| 505 | 3300046680 | Ga0495646_0000169 | Ga0495646_0000169_32237_32584 | 114 |
| 506 | 3300046689 | Ga0495613_1015008 | Ga0495613_1015008_162_506 | 114 |
| 507 | 3300046690 | Ga0495624_0000781 | Ga0495624_0000781_6015_6359 | 114 |
| 508 | 3300046809 | Ga0495600_0031605 | Ga0495600_0031605_1186_1548 | 114 |
| 509 | 3300046809 | Ga0495600_0587786 | Ga0495600_0587786_42_386 | 114 |
| 510 | 3300047315 | Ga0495581_0007309 | Ga0495581_0007309_457_801 | 114 |
| 511 | 3300047319 | Ga0495674_0000657 | Ga0495674_0000657_25881_26225 | 114 |
| 512 | 3300047321 | Ga0495676_0067255 | Ga0495676_0067255_1275_1619 | 114 |
| 513 | 3300047322 | Ga0495680_0006292 | Ga0495680_0006292_8704_9048 | 114 |
| 514 | 3300047471 | Ga0495684_0230562 | Ga0495684_0230562_856_1200 | 114 |
| 515 | 3300048088 | Ga0495602_0260374 | Ga0495602_0260374_196_540 | 114 |
| 516 | 3300048903 | Ga0496100_0798004 | Ga0496100_0798004_133_477 | 114 |
| 517 | 3300048905 | Ga0496102_0032674 | Ga0496102_0032674_787_1134 | 114 |
| 518 | 3300048907 | Ga0496104_0444230 | Ga0496104_0444230_233_577 | 114 |
| 519 | 3300048908 | Ga0496105_0609144 | Ga0496105_0609144_446_790 | 114 |
| 520 | 3300048911 | Ga0496108_0173882 | Ga0496108_0173882_1315_1659 | 114 |
| 521 | 3300048912 | Ga0496109_0506164 | Ga0496109_0506164_219_563 | 114 |
| 522 | 3300048913 | Ga0496110_1501552 | Ga0496110_1501552_95_439 | 114 |
| 523 | 3300048914 | Ga0496111_0640985 | Ga0496111_0640985_159_503 | 114 |
| 524 | 3300048915 | Ga0496112_0212603 | Ga0496112_0212603_1514_1858 | 114 |
| 525 | 3300048929 | Ga0496126_0364197 | Ga0496126_0364197_120_464 | 114 |
| 526 | 3300049571 | Ga0501034_0759007 | Ga0501034_0759007_332_676 | 114 |
| 527 | 3300050489 | nmdc:mga03683_61232_c1 | nmdc:mga03683_61232_c1_1197_1541 | 114 |
| 528 | 3300050490 | nmdc:mga03n38_53227_c1 | nmdc:mga03n38_53227_c1_715_1059 | 114 |
| 529 | 3300050491 | nmdc:mga00v17_34982_c2 | nmdc:mga00v17_34982_c2_1159_1503 | 114 |
| 530 | 3300050491 | nmdc:mga00v17_83170_c1 | nmdc:mga00v17_83170_c1_1365_1709 | 114 |
| 531 | 3300050491 | nmdc:mga00v17_8482_c1 | nmdc:mga00v17_8482_c1_4070_4414 | 114 |
| 532 | 3300050491 | nmdc:mga00v17_935541_c1 | nmdc:mga00v17_935541_c1_50_394 | 114 |
| 533 | 3300050492 | nmdc:mga0yw44_269178_c1 | nmdc:mga0yw44_269178_c1_54_398 | 114 |
| 534 | 3300050492 | nmdc:mga0yw44_513203_c1 | nmdc:mga0yw44_513203_c1_42_386 | 114 |
| 535 | 3300050492 | nmdc:mga0yw44_551439_c1 | nmdc:mga0yw44_551439_c1_295_639 | 114 |
| 536 | 3300050492 | nmdc:mga0yw44_647906_c1 | nmdc:mga0yw44_647906_c1_169_513 | 114 |
| 537 | 3300050494 | nmdc:mga06z11_393054_c1 | nmdc:mga06z11_393054_c1_310_654 | 114 |
| 538 | 3300050494 | nmdc:mga06z11_437005_c1 | nmdc:mga06z11_437005_c1_264_608 | 114 |
| 539 | 3300050494 | nmdc:mga06z11_931858_c1 | nmdc:mga06z11_931858_c1_37_381 | 114 |
| 540 | 3300050512 | nmdc:mga0n895_1042456_c1 | nmdc:mga0n895_1042456_c1_412_756 | 114 |
| 541 | 3300050513 | nmdc:mga0rr50_396358_c1 | nmdc:mga0rr50_396358_c1_808_1152 | 114 |
| 542 | 3300053077 | Ga0495601_0042212 | Ga0495601_0042212_2293_2655 | 114 |
| 543 | 3300053078 | Ga0495612_0009997 | Ga0495612_0009997_2184_2546 | 114 |
| 544 | 3300053084 | Ga0495595_0345181 | Ga0495595_0345181_27_371 | 114 |
| 545 | 3300053085 | Ga0495619_0055007 | Ga0495619_0055007_1959_2306 | 114 |
| 546 | 3300053085 | Ga0495619_0518370 | Ga0495619_0518370_252_596 | 114 |
| 547 | 3300053088 | Ga0500644_0012178 | Ga0500644_0012178_1004_1348 | 114 |
| 548 | 3300053090 | Ga0500646_0095653 | Ga0500646_0095653_492_836 | 114 |
| 549 | 3300053090 | Ga0500646_0329660 | Ga0500646_0329660_152_496 | 114 |
| 550 | 3300053094 | Ga0500566_0005968 | Ga0500566_0005968_664_1008 | 114 |
| 551 | 3300053098 | Ga0500650_0214146 | Ga0500650_0214146_165_509 | 114 |
| 552 | 3300053104 | Ga0500556_0188818 | Ga0500556_0188818_149_493 | 114 |
| 553 | 3300053131 | Ga0500652_061681 | Ga0500652_061681_1047_1391 | 114 |
| 554 | 3300053153 | Ga0500616_0116274 | Ga0500616_0116274_243_587 | 114 |
| 555 | 3300053727 | Ga0500611_037074 | Ga0500611_037074_119_463 | 114 |
| 556 | 3300059492 | Ga0587073_0246022 | Ga0587073_0246022_76_420 | 114 |
| 557 | 3300048922 | Ga0496119_0207558 | Ga0496119_0207558_34_381 | 115 |
| 558 | 3300001990 | JGI24737J22298_10029444 | JGI24737J22298_100294443 | 116 |
| 559 | 3300001991 | JGI24743J22301_10002724 | JGI24743J22301_100027243 | 116 |
| 560 | 3300001991 | JGI24743J22301_10003790 | JGI24743J22301_100037905 | 116 |
| 561 | 3300002073 | JGI24745J21846_1008600 | JGI24745J21846_10086002 | 116 |
| 562 | 3300002074 | JGI24748J21848_1014728 | JGI24748J21848_10147282 | 116 |
| 563 | 3300002244 | JGI24742J22300_10054849 | JGI24742J22300_100548493 | 116 |
| 564 | 3300005334 | Ga0068869_100909791 | Ga0068869_1009097912 | 116 |
| 565 | 3300005335 | Ga0070666_10446687 | Ga0070666_104466872 | 116 |
| 566 | 3300005336 | Ga0070680_101100509 | Ga0070680_1011005092 | 116 |
| 567 | 3300005338 | Ga0068868_100120875 | Ga0068868_1001208753 | 116 |
| 568 | 3300005338 | Ga0068868_100459682 | Ga0068868_1004596821 | 116 |
| 569 | 3300005343 | Ga0070687_100374472 | Ga0070687_1003744722 | 116 |
| 570 | 3300005347 | Ga0070668_100512717 | Ga0070668_1005127172 | 116 |
| 571 | 3300005356 | Ga0070674_100484940 | Ga0070674_1004849401 | 116 |
| 572 | 3300005365 | Ga0070688_100034762 | Ga0070688_1000347622 | 116 |
| 573 | 3300005434 | Ga0070709_10182129 | Ga0070709_101821291 | 116 |
| 574 | 3300005435 | Ga0070714_100155966 | Ga0070714_1001559662 | 116 |
| 575 | 3300005436 | Ga0070713_100024506 | Ga0070713_1000245062 | 116 |
| 576 | 3300005438 | Ga0070701_10057237 | Ga0070701_100572373 | 116 |
| 577 | 3300005440 | Ga0070705_100131616 | Ga0070705_1001316162 | 116 |
| 578 | 3300005441 | Ga0070700_100021032 | Ga0070700_1000210323 | 116 |
| 579 | 3300005546 | Ga0070696_100246816 | Ga0070696_1002468163 | 116 |
| 580 | 3300005547 | Ga0070693_100856860 | Ga0070693_1008568602 | 116 |
| 581 | 3300005548 | Ga0070665_100117553 | Ga0070665_1001175532 | 116 |
| 582 | 3300005563 | Ga0068855_100285905 | Ga0068855_1002859052 | 116 |
| 583 | 3300005563 | Ga0068855_101562486 | Ga0068855_1015624861 | 116 |
| 584 | 3300005617 | Ga0068859_100000044 | Ga0068859_100000044141 | 116 |
| 585 | 3300005618 | Ga0068864_100131730 | Ga0068864_1001317303 | 116 |
| 586 | 3300005840 | Ga0068870_10530848 | Ga0068870_105308482 | 116 |
| 587 | 3300005841 | Ga0068863_100089808 | Ga0068863_1000898082 | 116 |
| 588 | 3300005842 | Ga0068858_100054705 | Ga0068858_1000547053 | 116 |
| 589 | 3300005843 | Ga0068860_100364393 | Ga0068860_1003643933 | 116 |
| 590 | 3300005844 | Ga0068862_100481815 | Ga0068862_1004818152 | 116 |
| 591 | 3300005981 | Ga0081538_10111883 | Ga0081538_101118833 | 116 |
| 592 | 3300006028 | Ga0070717_10533832 | Ga0070717_105338322 | 116 |
| 593 | 3300006173 | Ga0070716_101719316 | Ga0070716_1017193162 | 116 |
| 594 | 3300006175 | Ga0070712_100277263 | Ga0070712_1002772631 | 116 |
| 595 | 3300006178 | Ga0075367_10124073 | Ga0075367_101240732 | 116 |
| 596 | 3300006237 | Ga0097621_100580725 | Ga0097621_1005807252 | 116 |
| 597 | 3300006353 | Ga0075370_10007156 | Ga0075370_100071562 | 116 |
| 598 | 3300006852 | Ga0075433_10505741 | Ga0075433_105057413 | 116 |
| 599 | 3300006931 | Ga0097620_100000044 | Ga0097620_100000044141 | 116 |
| 600 | 3300009036 | Ga0105244_10213707 | Ga0105244_102137072 | 116 |
| 601 | 3300009093 | Ga0105240_12511821 | Ga0105240_125118211 | 116 |
| 602 | 3300009098 | Ga0105245_10707297 | Ga0105245_107072972 | 116 |
| 603 | 3300009098 | Ga0105245_10722784 | Ga0105245_107227842 | 116 |
| 604 | 3300009101 | Ga0105247_10015654 | Ga0105247_100156545 | 116 |
| 605 | 3300009177 | Ga0105248_12294114 | Ga0105248_122941141 | 116 |
| 606 | 3300009545 | Ga0105237_10630005 | Ga0105237_106300052 | 116 |
| 607 | 3300009545 | Ga0105237_10795809 | Ga0105237_107958092 | 116 |
| 608 | 3300009553 | Ga0105249_10341596 | Ga0105249_103415962 | 116 |
| 609 | 3300010375 | Ga0105239_10411845 | Ga0105239_104118454 | 116 |
| 610 | 3300013296 | Ga0157374_10018933 | Ga0157374_100189332 | 116 |
| 611 | 3300013297 | Ga0157378_10522278 | Ga0157378_105222783 | 116 |
| 612 | 3300013306 | Ga0163162_10998113 | Ga0163162_109981132 | 116 |
| 613 | 3300013308 | Ga0157375_10006206 | Ga0157375_100062064 | 116 |
| 614 | 3300014326 | Ga0157380_10240074 | Ga0157380_102400743 | 116 |
| 615 | 3300014326 | Ga0157380_10793598 | Ga0157380_107935982 | 116 |
| 616 | 3300014745 | Ga0157377_10052736 | Ga0157377_100527362 | 116 |
| 617 | 3300017792 | Ga0163161_10174330 | Ga0163161_101743302 | 116 |
| 618 | 3300017792 | Ga0163161_10726265 | Ga0163161_107262652 | 116 |
| 619 | 3300020076 | Ga0206355_1651516 | Ga0206355_16515162 | 116 |
| 620 | 3300020081 | Ga0206354_11416303 | Ga0206354_114163034 | 116 |
| 621 | 3300020082 | Ga0206353_10179585 | Ga0206353_101795854 | 116 |
| 622 | 3300021384 | Ga0213876_10001772 | Ga0213876_100017724 | 116 |
| 623 | 3300025900 | Ga0207710_10665116 | Ga0207710_106651162 | 116 |
| 624 | 3300025901 | Ga0207688_10015760 | Ga0207688_100157604 | 116 |
| 625 | 3300025903 | Ga0207680_10439242 | Ga0207680_104392422 | 116 |
| 626 | 3300025906 | Ga0207699_10551351 | Ga0207699_105513512 | 116 |
| 627 | 3300025906 | Ga0207699_11098280 | Ga0207699_110982801 | 116 |
| 628 | 3300025913 | Ga0207695_11496840 | Ga0207695_114968402 | 116 |
| 629 | 3300025914 | Ga0207671_10558867 | Ga0207671_105588673 | 116 |
| 630 | 3300025915 | Ga0207693_10243901 | Ga0207693_102439011 | 116 |
| 631 | 3300025917 | Ga0207660_10853807 | Ga0207660_108538072 | 116 |
| 632 | 3300025927 | Ga0207687_11956603 | Ga0207687_119566032 | 116 |
| 633 | 3300025928 | Ga0207700_10718081 | Ga0207700_107180812 | 116 |
| 634 | 3300025929 | Ga0207664_10102470 | Ga0207664_101024703 | 116 |
| 635 | 3300025939 | Ga0207665_11563964 | Ga0207665_115639642 | 116 |
| 636 | 3300025940 | Ga0207691_10024897 | Ga0207691_100248975 | 116 |
| 637 | 3300025940 | Ga0207691_11123783 | Ga0207691_111237832 | 116 |
| 638 | 3300025941 | Ga0207711_10515901 | Ga0207711_105159012 | 116 |
| 639 | 3300025942 | Ga0207689_10030701 | Ga0207689_100307015 | 116 |
| 640 | 3300025949 | Ga0207667_10526029 | Ga0207667_105260292 | 116 |
| 641 | 3300025949 | Ga0207667_11802116 | Ga0207667_118021161 | 116 |
| 642 | 3300025960 | Ga0207651_10237321 | Ga0207651_102373212 | 116 |
| 643 | 3300025961 | Ga0207712_10083241 | Ga0207712_100832412 | 116 |
| 644 | 3300025972 | Ga0207668_10111236 | Ga0207668_101112364 | 116 |
| 645 | 3300026023 | Ga0207677_10195011 | Ga0207677_101950113 | 116 |
| 646 | 3300026035 | Ga0207703_10048420 | Ga0207703_100484201 | 116 |
| 647 | 3300026035 | Ga0207703_10688462 | Ga0207703_106884622 | 116 |
| 648 | 3300026041 | Ga0207639_10639809 | Ga0207639_106398091 | 116 |
| 649 | 3300026075 | Ga0207708_10032029 | Ga0207708_100320292 | 116 |
| 650 | 3300026088 | Ga0207641_10089736 | Ga0207641_100897363 | 116 |
| 651 | 3300026095 | Ga0207676_10071437 | Ga0207676_100714372 | 116 |
| 652 | 3300026142 | Ga0207698_10400126 | Ga0207698_104001262 | 116 |
| 653 | 3300028379 | Ga0268266_10019158 | Ga0268266_100191585 | 116 |
| 654 | 3300028794 | Ga0307515_10377607 | Ga0307515_103776071 | 116 |
| 655 | 3300031456 | Ga0307513_10458326 | Ga0307513_104583262 | 116 |
| 656 | 3300035086 | Ga0373934_0278080 | Ga0373934_0278080_216_566 | 116 |
| 657 | 3300035113 | Ga0373936_0005405 | Ga0373936_0005405_1681_2031 | 116 |
| 658 | 3300035115 | Ga0373941_0044303 | Ga0373941_0044303_845_1195 | 116 |
| 659 | 3300035117 | Ga0373953_0039885 | Ga0373953_0039885_244_594 | 116 |
| 660 | 3300035118 | Ga0373954_0066097 | Ga0373954_0066097_269_619 | 116 |
| 661 | 3300035692 | Ga0373935_0955298 | Ga0373935_0955298_161_511 | 116 |
| 662 | 3300035724 | Ga0373933_0206277 | Ga0373933_0206277_286_636 | 116 |
| 663 | 3300036401 | Ga0373937_0033012 | Ga0373937_0033012_2493_2843 | 116 |
| 664 | 3300037068 | Ga0373925_0255757 | Ga0373925_0255757_810_1160 | 116 |
| 665 | 3300038443 | Ga0395901_0866824 | Ga0395901_0866824_242_592 | 116 |
| 666 | 3300039437 | Ga0436365_1258441 | Ga0436365_1258441_169_546 | 116 |
| 667 | 3300039437 | Ga0436365_1483817 | Ga0436365_1483817_2132_2509 | 116 |
| 668 | 3300044658 | Ga0466972_0030862 | Ga0466972_0030862_1874_2224 | 116 |
| 669 | 3300044684 | Ga0466966_0066180 | Ga0466966_0066180_333_716 | 116 |
| 670 | 3300044693 | Ga0466961_0006230 | Ga0466961_0006230_5616_5999 | 116 |
| 671 | 3300044694 | Ga0466963_0062359 | Ga0466963_0062359_613_963 | 116 |
| 672 | 3300044694 | Ga0466963_1192531 | Ga0466963_1192531_65_415 | 116 |
| 673 | 3300044706 | Ga0466964_0799686 | Ga0466964_0799686_22_405 | 116 |
| 674 | 3300044719 | Ga0466971_0000363 | Ga0466971_0000363_1473_1856 | 116 |
| 675 | 3300044765 | Ga0466970_0029299 | Ga0466970_0029299_2108_2458 | 116 |
| 676 | 3300045049 | Ga0466959_0017959 | Ga0466959_0017959_2850_3200 | 116 |
| 677 | 3300045836 | Ga0466958_0003984 | Ga0466958_0003984_2838_3188 | 116 |
| 678 | 3300045836 | Ga0466958_0011624 | Ga0466958_0011624_4088_4471 | 116 |
| 679 | 3300045976 | Ga0466967_0161463 | Ga0466967_0161463_1621_1971 | 116 |
| 680 | 3300046454 | Ga0495592_0373894 | Ga0495592_0373894_233_583 | 116 |
| 681 | 3300046459 | Ga0495629_0080691 | Ga0495629_0080691_306_692 | 116 |
| 682 | 3300046459 | Ga0495629_0545982 | Ga0495629_0545982_234_584 | 116 |
| 683 | 3300046461 | Ga0495641_0280929 | Ga0495641_0280929_177_527 | 116 |
| 684 | 3300046462 | Ga0495651_0056166 | Ga0495651_0056166_239_589 | 116 |
| 685 | 3300046463 | Ga0495653_0022668 | Ga0495653_0022668_3378_3728 | 116 |
| 686 | 3300046511 | Ga0495608_0094074 | Ga0495608_0094074_1335_1685 | 116 |
| 687 | 3300046516 | Ga0495628_0834969 | Ga0495628_0834969_49_399 | 116 |
| 688 | 3300046517 | Ga0495630_0728973 | Ga0495630_0728973_148_498 | 116 |
| 689 | 3300046529 | Ga0495652_0399966 | Ga0495652_0399966_412_762 | 116 |
| 690 | 3300046536 | Ga0495587_0519307 | Ga0495587_0519307_276_626 | 116 |
| 691 | 3300046559 | Ga0495667_0042022 | Ga0495667_0042022_2424_2774 | 116 |
| 692 | 3300046663 | Ga0495635_0014225 | Ga0495635_0014225_4867_5217 | 116 |
| 693 | 3300046675 | Ga0495657_0105985 | Ga0495657_0105985_1380_1730 | 116 |
| 694 | 3300046679 | Ga0495623_0539413 | Ga0495623_0539413_18_368 | 116 |
| 695 | 3300047319 | Ga0495674_0185098 | Ga0495674_0185098_969_1319 | 116 |
| 696 | 3300047322 | Ga0495680_0738060 | Ga0495680_0738060_144_494 | 116 |
| 697 | 3300048088 | Ga0495602_0524714 | Ga0495602_0524714_294_644 | 116 |
| 698 | 3300048905 | Ga0496102_0415608 | Ga0496102_0415608_855_1205 | 116 |
| 699 | 3300048909 | Ga0496106_0020856 | Ga0496106_0020856_219_569 | 116 |
| 700 | 3300048910 | Ga0496107_0615483 | Ga0496107_0615483_246_596 | 116 |
| 701 | 3300048911 | Ga0496108_0001502 | Ga0496108_0001502_5549_5899 | 116 |
| 702 | 3300048912 | Ga0496109_0006002 | Ga0496109_0006002_7310_7660 | 116 |
| 703 | 3300048913 | Ga0496110_0365545 | Ga0496110_0365545_319_669 | 116 |
| 704 | 3300048915 | Ga0496112_0100483 | Ga0496112_0100483_2364_2714 | 116 |
| 705 | 3300048916 | Ga0496113_0324320 | Ga0496113_0324320_706_1056 | 116 |
| 706 | 3300048918 | Ga0496115_0799962 | Ga0496115_0799962_323_685 | 116 |
| 707 | 3300049568 | Ga0501031_0096461 | Ga0501031_0096461_1524_1886 | 116 |
| 708 | 3300049569 | Ga0501032_0204739 | Ga0501032_0204739_799_1161 | 116 |
| 709 | 3300049570 | Ga0501033_0039523 | Ga0501033_0039523_2714_3076 | 116 |
| 710 | 3300049571 | Ga0501034_0085696 | Ga0501034_0085696_1552_1914 | 116 |
| 711 | 3300049572 | Ga0501036_0073697 | Ga0501036_0073697_1151_1513 | 116 |
| 712 | 3300049573 | Ga0501037_0288738 | Ga0501037_0288738_428_790 | 116 |
| 713 | 3300049574 | Ga0501038_0025400 | Ga0501038_0025400_2606_2968 | 116 |
| 714 | 3300049575 | Ga0501039_0952650 | Ga0501039_0952650_73_435 | 116 |
| 715 | 3300049579 | Ga0501043_0163212 | Ga0501043_0163212_1228_1590 | 116 |
| 716 | 3300049586 | Ga0501070_0068608 | Ga0501070_0068608_1263_1625 | 116 |
| 717 | 3300049588 | Ga0501072_1464448 | Ga0501072_1464448_131_493 | 116 |
| 718 | 3300049822 | Ga0501035_0174123 | Ga0501035_0174123_1112_1474 | 116 |
| 719 | 3300049823 | Ga0501044_0145020 | Ga0501044_0145020_1551_1913 | 116 |
| 720 | 3300049824 | Ga0501045_0186590 | Ga0501045_0186590_852_1214 | 116 |
| 721 | 3300050493 | nmdc:mga0k408_434063_c1 | nmdc:mga0k408_434063_c1_364_714 | 116 |
| 722 | 3300050495 | nmdc:mga04h51_162848_c1 | nmdc:mga04h51_162848_c1_257_607 | 116 |
| 723 | 3300050496 | nmdc:mga07m45_3342_c1 | nmdc:mga07m45_3342_c1_818_1168 | 116 |
| 724 | 3300050515 | nmdc:mga0a205_446637_c1 | nmdc:mga0a205_446637_c1_557_907 | 116 |
| 725 | 3300050516 | nmdc:mga0sz30_68842_c1 | nmdc:mga0sz30_68842_c1_223_573 | 116 |
| 726 | 3300061719 | Ga0466962_0004991 | Ga0466962_0004991_1578_1961 | 116 |
| 727 | 3300061719 | Ga0466962_0128654 | Ga0466962_0128654_450_800 | 116 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7a76-assembly1.cif.gz_C | bacillithiol disulfide reductase bdr (ypda) from bacillus cereus | 0.7842 | 79 | 108 |
| 3s5w-assembly1.cif.gz_A | ornithine hydroxylase (pvda) from pseudomonas aeruginosa | 0.78 | 78 | 108 |
| 3s61-assembly1.cif.gz_A | reduced form of ornithine hydroxylase (pvda) from pseudomonas aeruginosa | 0.7766 | 78 | 108 |
| 3oxh-assembly1.cif.gz_A | mycobacterium tuberculosis kinase inhibitor homolog rv0577 | 0.7546 | 3 | 110 |
| 5j5z-assembly1.cif.gz_B | crystal structure of the d444v disease-causing mutant of the human dihydrolipoamide dehydrogenase | 0.7463 | 78 | 107 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3itwA02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.7957 | 77 | 110 | 3.30.720.110 |
| 2kjzB01 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.7904 | 1 | 53 | 3.30.720.120 |
| af_Q8IMG8_32_291_3.40.850.10 | Alpha Beta;3-Layer(aba) Sandwich;Kinesin;Kinesin motor domain | 0.7881 | 91 | 108 | 3.40.850.10 |
| af_Q2FVD9_38_137_3.10.450.130 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,;folded 79 residue fragment of lin0334 like domains | 0.7774 | 78 | 107 | 3.10.450.130 |
| 3oxhA01 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.7624 | 2 | 110 | 3.10.180.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1E7N0R6-F1-model_v4 | Glyoxalase | 0.9702 | 1 | 114 |
|
| AF-A0A1T4S1E5-F1-model_v4 | Ribbon-helix-helix protein, copG family | 0.97 | 1 | 110 |
GO:0006355
|
| AF-A0A370HE07-F1-model_v4 | Glyoxalase | 0.9624 | 1 | 111 |
|
| AF-A0A1E7N0R6-F1-model_v4 | Glyoxalase | 0.9618 | 1 | 114 |
|
| AF-Q0RTL6-F1-model_v4 | Glyoxalase-like domain-containing protein | 0.9603 | 12 | 112 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar