F477691

General Info

Members Datasets Scaffolds Average Seq Length
726 306 1452 111

Family's Representative Sequence

Representative Sequence 3300031731|Ga0307405_11973103|Ga0307405_119731031
Length 127
Sequence VSEHPNDFVVGHKQFADIESLLKRALAPVEPSKELEARLETTLGSLVGMAADELEAWEMSAMRDPRNWVRPVAAAAIGSSAAVGLALVRTQRRRHXXRKEAHNAADLLGRTLRDLAREARRVGDDLF

Samples

Sample ID Description Type Environment
1 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
4 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
70 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
71 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
112 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
113 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
114 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
115 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
170 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
171 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
172 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
173 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
174 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
175 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
176 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
177 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
178 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
179 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
180 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
181 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
182 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
183 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
184 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
185 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
186 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
187 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
188 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
189 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
190 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
191 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
192 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
193 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
194 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
195 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
196 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
197 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
198 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
199 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
200 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
201 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
202 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
203 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
204 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
205 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
206 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
207 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
208 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
209 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
210 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
211 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
212 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
213 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
214 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
215 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
216 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
217 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
218 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
219 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
220 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
221 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
222 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
223 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
224 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
225 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
226 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
227 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
228 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
229 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
230 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
231 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
232 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
233 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
234 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
235 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
236 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
237 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
238 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
239 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
240 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
241 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
242 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
243 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
244 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
245 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
246 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
247 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
248 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
249 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
250 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
251 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
252 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
253 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
254 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
255 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
256 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
257 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
258 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
259 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
260 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
261 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
262 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
263 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
264 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
265 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
266 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
267 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
268 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
269 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
270 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
271 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
272 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
273 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
274 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
275 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
276 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
277 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
278 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
279 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
280 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
281 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
282 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
283 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
284 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
285 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
286 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
287 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
288 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
289 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
290 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
292 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
293 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
294 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
295 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
296 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
297 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
298 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
299 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
300 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
301 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
302 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
303 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
304 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
305 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
306 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.86
Metatranscriptomes 0.14
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.28
Nodule 0
Rhizoplane 9.37
Rhizosphere 82.23
Stem 0
Stem Tuber 0
Unclassified 5.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307405_11973103 3300031731 Bacteria 522
2 JGI24737J22298_10086284 3300001990 Bacteria 932
3 JGI24750J21931_1044506 3300002070 Bacteria 681
4 JGI24745J21846_1002780 3300002073 Bacteria 1807
5 Ga0070683_100032293 3300005329 Bacteria 4767
6 Ga0070683_100179005 3300005329 Bacteria 2013
7 Ga0070683_100218571 3300005329 Bacteria 1811
8 Ga0070683_101290376 3300005329 Bacteria 702
9 Ga0070690_100056104 3300005330 Bacteria 2525
10 Ga0070670_100517854 3300005331 Bacteria 1062
11 Ga0068869_100032448 3300005334 Bacteria 3680
12 Ga0068869_100089351 3300005334 Bacteria 2314
13 Ga0068869_100861291 3300005334 Bacteria 782
14 Ga0070680_100221554 3300005336 Bacteria 1597
15 Ga0070682_100033351 3300005337 Bacteria 3128
16 Ga0070682_100062127 3300005337 Bacteria 2365
17 Ga0070682_100153470 3300005337 Bacteria 1583
18 Ga0070682_101254886 3300005337 Bacteria 628
19 Ga0068868_100022537 3300005338 Bacteria 4755
20 Ga0068868_100034290 3300005338 Bacteria 3917
21 Ga0068868_100121803 3300005338 Bacteria 2128
22 Ga0070660_100342705 3300005339 Bacteria 1230
23 Ga0070689_100189216 3300005340 Bacteria 1675
24 Ga0070691_10029379 3300005341 Bacteria 2571
25 Ga0070687_100017693 3300005343 Bacteria 3283
26 Ga0070661_100941091 3300005344 Bacteria 715
27 Ga0070692_10056057 3300005345 Bacteria 2062
28 Ga0070692_10180061 3300005345 Bacteria 1224
29 Ga0070668_100126324 3300005347 Bacteria 2049
30 Ga0070668_100404989 3300005347 Bacteria 1165
31 Ga0070669_100111769 3300005353 Bacteria 2074
32 Ga0070675_100189810 3300005354 Bacteria 1780
33 Ga0070675_100336376 3300005354 Bacteria 1336
34 Ga0070675_102196963 3300005354 Bacteria 508
35 Ga0070671_100222593 3300005355 Bacteria 1601
36 Ga0070671_100752990 3300005355 Bacteria 847
37 Ga0070674_100118496 3300005356 Bacteria 1956
38 Ga0070674_100428010 3300005356 Bacteria 1087
39 Ga0070673_100333355 3300005364 Bacteria 1343
40 Ga0070673_101673861 3300005364 Bacteria 602
41 Ga0070688_100014406 3300005365 Bacteria 4479
42 Ga0070688_100104387 3300005365 Bacteria 1874
43 Ga0070659_100035785 3300005366 Bacteria 3868
44 Ga0070667_101479877 3300005367 Bacteria 637
45 Ga0070703_10366732 3300005406 Bacteria 619
46 Ga0070709_10086496 3300005434 Bacteria 2058
47 Ga0070709_10338431 3300005434 Bacteria 1109
48 Ga0070709_10804202 3300005434 Bacteria 738
49 Ga0070709_10825959 3300005434 Bacteria 729
50 Ga0070714_100116966 3300005435 Unclassified 2367
51 Ga0070714_100141828 3300005435 Bacteria 2158
52 Ga0070714_100777150 3300005435 Bacteria 926
53 Ga0070714_100983154 3300005435 Bacteria 821
54 Ga0070714_101628262 3300005435 Bacteria 631
55 Ga0070714_101677373 3300005435 Bacteria 621
56 Ga0070713_100047033 3300005436 Bacteria 3544
57 Ga0070713_100234894 3300005436 Bacteria 1668
58 Ga0070713_100640409 3300005436 Bacteria 1012
59 Ga0070713_102393053 3300005436 Bacteria 511
60 Ga0070710_10049735 3300005437 Bacteria 2346
61 Ga0070710_10070632 3300005437 Bacteria 2012
62 Ga0070710_10476857 3300005437 Bacteria 850
63 Ga0070710_11403234 3300005437 Bacteria 522
64 Ga0070701_10053812 3300005438 Bacteria 2096
65 Ga0070711_100099646 3300005439 Bacteria 2111
66 Ga0070711_100156497 3300005439 Bacteria 1724
67 Ga0070711_100240498 3300005439 Bacteria 1415
68 Ga0070711_100328462 3300005439 Bacteria 1224
69 Ga0070705_100383749 3300005440 Bacteria 1035
70 Ga0070705_100738382 3300005440 Bacteria 777
71 Ga0070705_101475208 3300005440 Bacteria 569
72 Ga0070700_100439624 3300005441 Bacteria 990
73 Ga0070700_100569351 3300005441 Bacteria 883
74 Ga0070700_101174716 3300005441 Bacteria 640
75 Ga0070694_101152760 3300005444 Bacteria 648
76 Ga0070663_100163155 3300005455 Bacteria 1717
77 Ga0070663_100200056 3300005455 Bacteria 1559
78 Ga0070663_100781346 3300005455 Bacteria 817
79 Ga0070678_100027600 3300005456 Bacteria 3857
80 Ga0070678_100120057 3300005456 Bacteria 2072
81 Ga0070678_101561213 3300005456 Bacteria 619
82 Ga0070662_100110897 3300005457 Bacteria 2090
83 Ga0070662_100418238 3300005457 Bacteria 1108
84 Ga0068867_100353622 3300005459 Bacteria 1227
85 Ga0070685_10281941 3300005466 Bacteria 1113
86 Ga0070685_10445797 3300005466 Bacteria 906
87 Ga0070679_101705429 3300005530 Bacteria 578
88 Ga0070684_100029416 3300005535 Bacteria 4655
89 Ga0070684_102032197 3300005535 Unclassified 542
90 Ga0068853_100277013 3300005539 Bacteria 1546
91 Ga0068853_100417688 3300005539 Bacteria 1257
92 Ga0068853_101659729 3300005539 Bacteria 619
93 Ga0070686_100074255 3300005544 Bacteria 2234
94 Ga0070686_100148122 3300005544 Bacteria 1641
95 Ga0070695_100783761 3300005545 Bacteria 763
96 Ga0070696_100617539 3300005546 Bacteria 876
97 Ga0070696_100690379 3300005546 Unclassified 831
98 Ga0070696_100916473 3300005546 Bacteria 728
99 Ga0070693_101048747 3300005547 Bacteria 619
100 Ga0070665_100086740 3300005548 Bacteria 3135
101 Ga0070704_100160292 3300005549 Bacteria 1778
102 Ga0068855_100432185 3300005563 Bacteria 1439
103 Ga0070664_100193090 3300005564 Bacteria 1814
104 Ga0070664_100320854 3300005564 Bacteria 1403
105 Ga0070664_100644032 3300005564 Bacteria 985
106 Ga0068857_100194874 3300005577 Bacteria 1846
107 Ga0068857_100659794 3300005577 Bacteria 992
108 Ga0068854_100287822 3300005578 Bacteria 1325
109 Ga0068854_100331727 3300005578 Bacteria 1239
110 Ga0068856_100003626 3300005614 Bacteria 15508
111 Ga0068856_100029968 3300005614 Bacteria 5318
112 Ga0068856_100292479 3300005614 Bacteria 1646
113 Ga0068856_100416762 3300005614 Bacteria 1363
114 Ga0068856_100542821 3300005614 Bacteria 1184
115 Ga0070702_100021061 3300005615 Bacteria 3425
116 Ga0070702_100042928 3300005615 Bacteria 2545
117 Ga0070702_100092428 3300005615 Bacteria 1837
118 Ga0070702_100693957 3300005615 Bacteria 775
119 Ga0068852_100055996 3300005616 Bacteria 3406
120 Ga0068852_100080088 3300005616 Bacteria 2895
121 Ga0068852_100202853 3300005616 Bacteria 1877
122 Ga0068859_100116392 3300005617 Bacteria 2738
123 Ga0068859_100138482 3300005617 Bacteria 2507
124 Ga0068859_100220635 3300005617 Bacteria 1984
125 Ga0068859_100378222 3300005617 Bacteria 1512
126 Ga0068864_100108930 3300005618 Bacteria 2465
127 Ga0068864_100537270 3300005618 Bacteria 1129
128 Ga0068866_10024030 3300005718 Bacteria 2842
129 Ga0068866_10027790 3300005718 Bacteria 2689
130 Ga0068866_10692546 3300005718 Bacteria 698
131 Ga0068861_100157187 3300005719 Bacteria 1872
132 Ga0068861_100167001 3300005719 Bacteria 1820
133 Ga0068851_10217353 3300005834 Bacteria 1072
134 Ga0068863_100396848 3300005841 Bacteria 1349
135 Ga0068863_100488233 3300005841 Unclassified 1212
136 Ga0068858_100811034 3300005842 Bacteria 913
137 Ga0068858_101140382 3300005842 Bacteria 766
138 Ga0068860_100198286 3300005843 Bacteria 1945
139 Ga0068860_100849443 3300005843 Bacteria 927
140 Ga0068860_101134304 3300005843 Bacteria 802
141 Ga0068860_102746214 3300005843 Bacteria 511
142 Ga0068862_100089343 3300005844 Bacteria 2682
143 Ga0081538_10001995 3300005981 Bacteria 20393
144 Ga0081538_10055768 3300005981 Bacteria 2322
145 Ga0070717_10756422 3300006028 Bacteria 883
146 Ga0070717_11048135 3300006028 Bacteria 743
147 Ga0070717_11472441 3300006028 Bacteria 618
148 Ga0070717_11958195 3300006028 Bacteria 528
149 Ga0075363_100098785 3300006048 Bacteria 1614
150 Ga0075432_10354065 3300006058 Bacteria 623
151 Ga0070715_10824052 3300006163 Unclassified 565
152 Ga0070716_100152807 3300006173 Bacteria 1487
153 Ga0070716_100780102 3300006173 Bacteria 738
154 Ga0070712_100018968 3300006175 Bacteria 4477
155 Ga0070712_100138211 3300006175 Bacteria 1856
156 Ga0070712_100265484 3300006175 Bacteria 1377
157 Ga0070712_100272480 3300006175 Bacteria 1360
158 Ga0070712_100809538 3300006175 Bacteria 804
159 Ga0097621_100863370 3300006237 Bacteria 841
160 Ga0068871_100573504 3300006358 Bacteria 1024
161 Ga0075428_100444121 3300006844 Bacteria 1389
162 Ga0075431_100460437 3300006847 Bacteria 1266
163 Ga0075431_101365882 3300006847 Bacteria 669
164 Ga0075433_10293207 3300006852 Bacteria 1440
165 Ga0075433_10538451 3300006852 Bacteria 1027
166 Ga0075433_10921601 3300006852 Bacteria 762
167 Ga0075434_100096488 3300006871 Bacteria 2961
168 Ga0075434_100162624 3300006871 Bacteria 2252
169 Ga0075434_100229258 3300006871 Bacteria 1877
170 Ga0068865_100382137 3300006881 Bacteria 1149
171 Ga0068865_100712831 3300006881 Bacteria 858
172 Ga0068865_100912085 3300006881 Bacteria 765
173 Ga0075436_100746830 3300006914 Bacteria 726
174 Ga0097620_100116398 3300006931 Bacteria 2738
175 Ga0097620_100138483 3300006931 Bacteria 2507
176 Ga0097620_100220633 3300006931 Bacteria 1984
177 Ga0097620_100378228 3300006931 Bacteria 1512
178 Ga0105251_10203747 3300009011 Bacteria 891
179 Ga0105251_10262998 3300009011 Bacteria 779
180 Ga0105240_10047079 3300009093 Bacteria 5459
181 Ga0105240_10336170 3300009093 Bacteria 1717
182 Ga0111539_10023359 3300009094 Bacteria 7596
183 Ga0111539_10064360 3300009094 Bacteria 4338
184 Ga0111539_11054863 3300009094 Bacteria 945
185 Ga0105245_10010610 3300009098 Bacteria 8015
186 Ga0105245_10025471 3300009098 Bacteria 5202
187 Ga0105245_10028772 3300009098 Bacteria 4903
188 Ga0105247_10084694 3300009101 Bacteria 2003
189 Ga0105247_10275878 3300009101 Bacteria 1158
190 Ga0105243_10007928 3300009148 Bacteria 8154
191 Ga0105243_10252011 3300009148 Bacteria 1576
192 Ga0105243_10794510 3300009148 Bacteria 932
193 Ga0105242_11010479 3300009176 Bacteria 840
194 Ga0105242_11214336 3300009176 Bacteria 774
195 Ga0105242_11300941 3300009176 Bacteria 751
196 Ga0105248_10350585 3300009177 Bacteria 1662
197 Ga0105237_10336445 3300009545 Bacteria 1514
198 Ga0105237_10427427 3300009545 Bacteria 1330
199 Ga0105237_11916543 3300009545 Bacteria 601
200 Ga0105238_10141464 3300009551 Bacteria 2383
201 Ga0105238_10554936 3300009551 Bacteria 1153
202 Ga0105249_10021570 3300009553 Bacteria 5768
203 Ga0105249_10404838 3300009553 Bacteria 1395
204 Ga0105249_10427586 3300009553 Bacteria 1359
205 Ga0105239_10040711 3300010375 Bacteria 5091
206 Ga0105239_10344391 3300010375 Bacteria 1682
207 Ga0105239_12633449 3300010375 Bacteria 587
208 Ga0105246_10064650 3300011119 Bacteria 2556
209 Ga0105246_10245456 3300011119 Bacteria 1418
210 Ga0157345_1051217 3300012498 Bacteria 526
211 Ga0157371_11069932 3300013102 Bacteria 618
212 Ga0157370_12080731 3300013104 Bacteria 509
213 Ga0157369_10407860 3300013105 Bacteria 1409
214 Ga0157369_11624057 3300013105 Bacteria 657
215 Ga0157374_10042410 3300013296 Bacteria 4197
216 Ga0157374_10115920 3300013296 Bacteria 2581
217 Ga0157378_10194241 3300013297 Bacteria 1916
218 Ga0163162_10221680 3300013306 Bacteria 2021
219 Ga0163162_10732834 3300013306 Bacteria 1109
220 Ga0157375_10057404 3300013308 Bacteria 3848
221 Ga0157375_10856983 3300013308 Bacteria 1055
222 Ga0163163_10050367 3300014325 Bacteria 4101
223 Ga0163163_10275137 3300014325 Bacteria 1735
224 Ga0163163_10854622 3300014325 Bacteria 973
225 Ga0157380_10014936 3300014326 Bacteria 5694
226 Ga0182008_10493775 3300014497 Bacteria 672
227 Ga0157377_10024865 3300014745 Bacteria 3188
228 Ga0157377_10104156 3300014745 Bacteria 1696
229 Ga0157377_10531455 3300014745 Bacteria 827
230 Ga0157379_10093013 3300014968 Bacteria 2705
231 Ga0157379_10535906 3300014968 Bacteria 1088
232 Ga0157379_11119781 3300014968 Bacteria 755
233 Ga0163161_10082551 3300017792 Bacteria 2368
234 Ga0163161_10303229 3300017792 Bacteria 1258
235 Ga0206356_11276845 3300020070 Bacteria 985
236 Ga0213873_10004743 3300021358 Bacteria 2561
237 Ga0213873_10150634 3300021358 Bacteria 700
238 Ga0213874_10004176 3300021377 Bacteria 3268
239 Ga0213874_10005903 3300021377 Bacteria 2874
240 Ga0213874_10243115 3300021377 Unclassified 661
241 Ga0213876_10001544 3300021384 Bacteria 14174
242 Ga0213876_10016766 3300021384 Bacteria 3870
243 Ga0213876_10018801 3300021384 Bacteria 3649
244 Ga0213876_10019979 3300021384 Bacteria 3538
245 Ga0213876_10059971 3300021384 Bacteria 2008
246 Ga0213876_10067929 3300021384 Bacteria 1883
247 Ga0213876_10082410 3300021384 Bacteria 1702
248 Ga0213876_10110720 3300021384 Bacteria 1457
249 Ga0213876_10315159 3300021384 Bacteria 831
250 Ga0213875_10006593 3300021388 Bacteria 6075
251 Ga0213875_10009721 3300021388 Bacteria 4855
252 Ga0213875_10072650 3300021388 Bacteria 1605
253 Ga0213875_10152753 3300021388 Bacteria 1082
254 Ga0207692_10075585 3300025898 Bacteria 1787
255 Ga0207692_10138381 3300025898 Bacteria 1382
256 Ga0207642_10069704 3300025899 Bacteria 1669
257 Ga0207642_10095632 3300025899 Bacteria 1479
258 Ga0207642_10212674 3300025899 Bacteria 1075
259 Ga0207642_10428971 3300025899 Bacteria 797
260 Ga0207710_10395327 3300025900 Bacteria 709
261 Ga0207688_10007211 3300025901 Bacteria 6048
262 Ga0207688_10012838 3300025901 Bacteria 4554
263 Ga0207688_10108405 3300025901 Bacteria 1610
264 Ga0207680_10265253 3300025903 Bacteria 1190
265 Ga0207647_10114653 3300025904 Bacteria 1592
266 Ga0207647_10138314 3300025904 Bacteria 1428
267 Ga0207699_10108625 3300025906 Bacteria 1774
268 Ga0207643_10480247 3300025908 Bacteria 793
269 Ga0207671_10260719 3300025914 Bacteria 1364
270 Ga0207693_10005756 3300025915 Bacteria 10286
271 Ga0207693_10382821 3300025915 Bacteria 1100
272 Ga0207663_10063422 3300025916 Bacteria 2353
273 Ga0207663_10113009 3300025916 Bacteria 1846
274 Ga0207660_10277369 3300025917 Bacteria 1329
275 Ga0207662_10011133 3300025918 Bacteria 4977
276 Ga0207657_10050330 3300025919 Bacteria 3626
277 Ga0207657_10328026 3300025919 Bacteria 1209
278 Ga0207649_10497107 3300025920 Bacteria 927
279 Ga0207652_10899568 3300025921 Bacteria 782
280 Ga0207681_10682263 3300025923 Bacteria 853
281 Ga0207694_10419620 3300025924 Bacteria 1114
282 Ga0207694_10484465 3300025924 Unclassified 1035
283 Ga0207650_10330619 3300025925 Bacteria 1250
284 Ga0207659_10026572 3300025926 Bacteria 3907
285 Ga0207659_10313500 3300025926 Bacteria 1292
286 Ga0207687_10016823 3300025927 Bacteria 4807
287 Ga0207687_10208847 3300025927 Bacteria 1531
288 Ga0207687_10284434 3300025927 Bacteria 1327
289 Ga0207687_11098530 3300025927 Bacteria 683
290 Ga0207700_10054061 3300025928 Bacteria 3012
291 Ga0207700_10677006 3300025928 Bacteria 920
292 Ga0207664_10753546 3300025929 Bacteria 876
293 Ga0207664_11474607 3300025929 Unclassified 602
294 Ga0207664_11737989 3300025929 Unclassified 546
295 Ga0207664_11911014 3300025929 Unclassified 516
296 Ga0207644_10052163 3300025931 Bacteria 2939
297 Ga0207644_11231014 3300025931 Bacteria 629
298 Ga0207690_10211365 3300025932 Bacteria 1479
299 Ga0207706_10047059 3300025933 Bacteria 3818
300 Ga0207706_10121093 3300025933 Bacteria 2301
301 Ga0207709_10049263 3300025935 Bacteria 2571
302 Ga0207709_10059297 3300025935 Bacteria 2382
303 Ga0207709_10068027 3300025935 Bacteria 2250
304 Ga0207670_10025897 3300025936 Bacteria 3689
305 Ga0207670_10156497 3300025936 Bacteria 1697
306 Ga0207669_10461957 3300025937 Bacteria 1008
307 Ga0207704_11003394 3300025938 Bacteria 706
308 Ga0207665_10207706 3300025939 Bacteria 1429
309 Ga0207691_10139578 3300025940 Bacteria 2136
310 Ga0207711_10138997 3300025941 Bacteria 2184
311 Ga0207711_10324794 3300025941 Bacteria 1422
312 Ga0207689_10017383 3300025942 Bacteria 6086
313 Ga0207689_10021161 3300025942 Bacteria 5468
314 Ga0207689_10595399 3300025942 Unclassified 930
315 Ga0207661_10141188 3300025944 Bacteria 2073
316 Ga0207661_10552908 3300025944 Bacteria 1054
317 Ga0207661_10947323 3300025944 Bacteria 793
318 Ga0207661_12025954 3300025944 Bacteria 522
319 Ga0207679_10113250 3300025945 Bacteria 2145
320 Ga0207679_10146296 3300025945 Bacteria 1917
321 Ga0207712_10052768 3300025961 Bacteria 2849
322 Ga0207640_10143071 3300025981 Bacteria 1746
323 Ga0207640_10286672 3300025981 Bacteria 1296
324 Ga0207640_10319678 3300025981 Bacteria 1235
325 Ga0207640_10417378 3300025981 Bacteria 1097
326 Ga0207677_10287797 3300026023 Bacteria 1352
327 Ga0207677_10561622 3300026023 Bacteria 996
328 Ga0207703_10328883 3300026035 Bacteria 1401
329 Ga0207703_10682414 3300026035 Bacteria 976
330 Ga0207639_10094479 3300026041 Bacteria 2401
331 Ga0207639_10766989 3300026041 Bacteria 897
332 Ga0207678_10003114 3300026067 Bacteria 15012
333 Ga0207678_10103678 3300026067 Bacteria 2428
334 Ga0207678_10215948 3300026067 Bacteria 1641
335 Ga0207678_10275147 3300026067 Bacteria 1444
336 Ga0207708_10000226 3300026075 Bacteria 44514
337 Ga0207708_10013877 3300026075 Bacteria 6022
338 Ga0207708_10280321 3300026075 Bacteria 1350
339 Ga0207702_10029142 3300026078 Bacteria 4592
340 Ga0207702_10080973 3300026078 Bacteria 2819
341 Ga0207702_10138348 3300026078 Bacteria 2200
342 Ga0207702_10239970 3300026078 Bacteria 1698
343 Ga0207702_11473013 3300026078 Unclassified 674
344 Ga0207702_11967837 3300026078 Bacteria 575
345 Ga0207641_11871868 3300026088 Bacteria 602
346 Ga0207648_10056116 3300026089 Bacteria 3438
347 Ga0207648_10405801 3300026089 Bacteria 1235
348 Ga0207676_10292175 3300026095 Bacteria 1484
349 Ga0207676_10888308 3300026095 Bacteria 873
350 Ga0207674_10029139 3300026116 Bacteria 5817
351 Ga0207674_10042131 3300026116 Bacteria 4718
352 Ga0207675_100020263 3300026118 Bacteria 6201
353 Ga0207675_100080394 3300026118 Bacteria 3056
354 Ga0207675_100088886 3300026118 Bacteria 2902
355 Ga0207675_100202044 3300026118 Bacteria 1909
356 Ga0207683_10004568 3300026121 Bacteria 11923
357 Ga0207683_10084090 3300026121 Bacteria 2828
358 Ga0207683_10170604 3300026121 Bacteria 1970
359 Ga0207683_11505716 3300026121 Bacteria 621
360 Ga0207698_10021222 3300026142 Bacteria 4487
361 Ga0207698_10070279 3300026142 Bacteria 2773
362 Ga0207698_10156456 3300026142 Bacteria 1987
363 Ga0207428_10012948 3300027907 Bacteria 7310
364 Ga0207428_10130068 3300027907 Bacteria 1927
365 Ga0207428_10566395 3300027907 Bacteria 821
366 Ga0207428_10645978 3300027907 Unclassified 760
367 Ga0207428_10888346 3300027907 Bacteria 630
368 Ga0268266_10075048 3300028379 Bacteria 2937
369 Ga0268264_10743463 3300028381 Bacteria 977
370 Ga0268264_10868429 3300028381 Bacteria 904
371 Ga0268264_11368024 3300028381 Bacteria 718
372 Ga0268264_11894974 3300028381 Bacteria 606
373 Ga0265337_1001237 3300028556 Bacteria 12935
374 Ga0265326_10001628 3300028558 Bacteria 7783
375 Ga0265319_1001701 3300028563 Bacteria 12696
376 Ga0265318_10005258 3300028577 Bacteria 6093
377 Ga0265322_10003590 3300028654 Bacteria 4666
378 Ga0265336_10000001 3300028666 Bacteria 916179
379 Ga0265338_10000228 3300028800 Bacteria 104553
380 Ga0265338_10085638 3300028800 Unclassified 2626
381 Ga0265324_10003753 3300029957 Bacteria 7102
382 Ga0265330_10133475 3300031235 Bacteria 1056
383 Ga0265320_10089192 3300031240 Bacteria 1430
384 Ga0265325_10146347 3300031241 Bacteria 1120
385 Ga0265340_10000005 3300031247 Bacteria 204570
386 Ga0265339_10040215 3300031249 Bacteria 2600
387 Ga0265327_10047682 3300031251 Bacteria 2258
388 Ga0265327_10181911 3300031251 Bacteria 961
389 Ga0265316_10774927 3300031344 Bacteria 674
390 Ga0307408_100861491 3300031548 Bacteria 827
391 Ga0265342_10105901 3300031712 Bacteria 1596
392 Ga0307410_10037815 3300031852 Bacteria 3156
393 Ga0307410_10720229 3300031852 Bacteria 842
394 Ga0307406_10039098 3300031901 Bacteria 2941
395 Ga0307406_10445968 3300031901 Bacteria 1037
396 Ga0307407_10051461 3300031903 Bacteria 2361
397 Ga0307409_100030383 3300031995 Bacteria 3880
398 Ga0307409_101305067 3300031995 Bacteria 751
399 Ga0307409_101801954 3300031995 Bacteria 641
400 Ga0307416_100039676 3300032002 Bacteria 3649
401 Ga0307416_100172531 3300032002 Bacteria 2015
402 Ga0307414_10428312 3300032004 Bacteria 1155
403 Ga0307415_100031677 3300032126 Bacteria 3410
404 Ga0307415_100586773 3300032126 Bacteria 989
405 Ga0307415_100676845 3300032126 Bacteria 928
406 Ga0307415_101174414 3300032126 Bacteria 722
407 Ga0307415_101699825 3300032126 Bacteria 608
408 Ga0373958_0039645 3300034819 Bacteria 959
409 Ga0373952_0067919 3300035092 Bacteria 886
410 Ga0373932_0105400 3300035112 Bacteria 923
411 Ga0373956_0277059 3300035119 Bacteria 798
412 Ga0373960_0128849 3300035121 Bacteria 847
413 Ga0373931_0300892 3300035691 Bacteria 991
414 Ga0373933_0020968 3300035724 Bacteria 3707
415 Ga0373933_0636503 3300035724 Bacteria 701
416 Ga0373937_0038067 3300036401 Bacteria 4384
417 Ga0395899_0646126 3300037312 Bacteria 669
418 Ga0395900_0013411 3300037418 Bacteria 8373
419 Ga0395898_0000955 3300037466 Bacteria 46041
420 Ga0395898_0304826 3300037466 Bacteria 1519
421 Ga0395898_0642318 3300037466 Bacteria 1004
422 Ga0436364_0314628 3300037853 Bacteria 20379
423 Ga0436364_0400719 3300037853 Bacteria 737
424 Ga0436364_0419681 3300037853 Bacteria 1299
425 Ga0436364_0442633 3300037853 Bacteria 1353
426 Ga0436364_0738192 3300037853 Bacteria 7932
427 Ga0436364_0799253 3300037853 Bacteria 909
428 Ga0436364_0829896 3300037853 Bacteria 2424
429 Ga0436364_0896740 3300037853 Bacteria 3613
430 Ga0436364_0922578 3300037853 Bacteria 4552
431 Ga0395901_0218472 3300038443 Bacteria 1993
432 Ga0395901_0436596 3300038443 Bacteria 1341
433 Ga0395901_1126584 3300038443 Bacteria 754
434 Ga0436365_0026833 3300039437 Bacteria 1308
435 Ga0436365_0083670 3300039437 Bacteria 646
436 Ga0436365_0483533 3300039437 Bacteria 10403
437 Ga0436365_0669023 3300039437 Bacteria 1995
438 Ga0436365_0728165 3300039437 Bacteria 4176
439 Ga0436365_0863062 3300039437 Bacteria 3344
440 Ga0436365_0974012 3300039437 Bacteria 5202
441 Ga0436365_1050938 3300039437 Unclassified 537
442 Ga0436365_1111719 3300039437 Bacteria 2670
443 Ga0436365_1219695 3300039437 Bacteria 7396
444 Ga0436365_1258586 3300039437 Bacteria 733
445 Ga0436365_1508964 3300039437 Bacteria 1371
446 Ga0436365_1547668 3300039437 Bacteria 6567
447 Ga0436365_1551735 3300039437 Bacteria 3862
448 Ga0436365_1558474 3300039437 Bacteria 3118
449 Ga0436365_1564126 3300039437 Bacteria 1126
450 Ga0436365_1666267 3300039437 Bacteria 4379
451 Ga0436360_0250102 3300039438 Unclassified 550
452 Ga0436361_0099371 3300039447 Bacteria 1542
453 Ga0436363_0296521 3300039450 Bacteria 580
454 Ga0436363_0362406 3300039450 Bacteria 1152
455 Ga0436363_0391877 3300039450 Bacteria 11742
456 Ga0436363_0435659 3300039450 Bacteria 764
457 Ga0436363_0557853 3300039450 Unclassified 693
458 Ga0436363_0678117 3300039450 Bacteria 33768
459 Ga0436363_0996692 3300039450 Bacteria 570
460 Ga0436363_1057956 3300039450 Bacteria 1501
461 Ga0436363_1066234 3300039450 Bacteria 1675
462 Ga0436363_1066858 3300039450 Bacteria 766
463 Ga0436363_1077534 3300039450 Bacteria 999
464 Ga0436363_1093983 3300039450 Bacteria 1617
465 Ga0436363_1138834 3300039450 Bacteria 1640
466 Ga0436363_1242862 3300039450 Bacteria 5419
467 Ga0436363_1338018 3300039450 Unclassified 592
468 Ga0436362_0429893 3300039453 Bacteria 1081
469 Ga0436362_0498550 3300039453 Bacteria 3524
470 Ga0436362_0627932 3300039453 Unclassified 615
471 Ga0436362_0668156 3300039453 Bacteria 938
472 Ga0436362_0732498 3300039453 Bacteria 1854
473 Ga0451853_0303467 3300041512 Bacteria 1085
474 Ga0439448_0036046 3300042005 Bacteria 1586
475 Ga0439455_0104455 3300042012 Bacteria 785
476 Ga0439463_091031 3300042016 Bacteria 785
477 Ga0466969_0013906 3300044656 Bacteria 4236
478 Ga0466969_0078369 3300044656 Bacteria 1580
479 Ga0466969_0147620 3300044656 Bacteria 1084
480 Ga0466969_0213393 3300044656 Bacteria 879
481 Ga0466969_0258186 3300044656 Bacteria 790
482 Ga0466969_0507499 3300044656 Bacteria 551
483 Ga0466972_0159164 3300044658 Bacteria 1061
484 Ga0466965_0145527 3300044683 Bacteria 1236
485 Ga0466965_0435420 3300044683 Bacteria 728
486 Ga0466965_0470109 3300044683 Bacteria 702
487 Ga0466966_0045008 3300044684 Bacteria 2823
488 Ga0466966_0109193 3300044684 Bacteria 1706
489 Ga0466966_0112283 3300044684 Bacteria 1679
490 Ga0466966_0121140 3300044684 Bacteria 1607
491 Ga0466966_0132737 3300044684 Bacteria 1524
492 Ga0466966_0178082 3300044684 Bacteria 1291
493 Ga0466966_0324248 3300044684 Bacteria 925
494 Ga0466966_0565812 3300044684 Bacteria 684
495 Ga0466966_0602683 3300044684 Bacteria 661
496 Ga0466966_0611001 3300044684 Bacteria 656
497 Ga0466961_0055193 3300044693 Bacteria 2533
498 Ga0466961_0191634 3300044693 Bacteria 1267
499 Ga0466961_0197762 3300044693 Bacteria 1244
500 Ga0466961_0671420 3300044693 Bacteria 621
501 Ga0466963_0022007 3300044694 Bacteria 4031
502 Ga0466963_0045514 3300044694 Bacteria 2890
503 Ga0466963_0046733 3300044694 Bacteria 2855
504 Ga0466963_0150129 3300044694 Bacteria 1618
505 Ga0466963_0258202 3300044694 Bacteria 1223
506 Ga0466963_0340232 3300044694 Bacteria 1056
507 Ga0466963_0762896 3300044694 Unclassified 682
508 Ga0466963_0860412 3300044694 Bacteria 639
509 Ga0466963_1135734 3300044694 Bacteria 549
510 Ga0466963_1234958 3300044694 Bacteria 525
511 Ga0466964_0037197 3300044706 Bacteria 1954
512 Ga0466964_0147940 3300044706 Bacteria 1086
513 Ga0466971_0003070 3300044719 Bacteria 7100
514 Ga0466971_0052597 3300044719 Bacteria 1834
515 Ga0466971_0120852 3300044719 Bacteria 1212
516 Ga0466971_0386108 3300044719 Bacteria 681
517 Ga0466971_0649226 3300044719 Unclassified 528
518 Ga0466968_0056800 3300044735 Bacteria 1682
519 Ga0466968_0060642 3300044735 Bacteria 1631
520 Ga0466968_0093126 3300044735 Bacteria 1338
521 Ga0466968_0204314 3300044735 Bacteria 926
522 Ga0466968_0383550 3300044735 Bacteria 687
523 Ga0466968_0394658 3300044735 Bacteria 677
524 Ga0466968_0409321 3300044735 Bacteria 666
525 Ga0466968_0515460 3300044735 Bacteria 597
526 Ga0466968_0578422 3300044735 Unclassified 565
527 Ga0466970_0049590 3300044765 Bacteria 2239
528 Ga0466970_0216906 3300044765 Bacteria 1067
529 Ga0466970_0698688 3300044765 Unclassified 591
530 Ga0466957_0019957 3300044842 Bacteria 3944
531 Ga0466957_0547161 3300044842 Bacteria 806
532 Ga0466957_0944795 3300044842 Unclassified 617
533 Ga0466960_0000044 3300044901 Bacteria 40726
534 Ga0466960_0018607 3300044901 Bacteria 3048
535 Ga0466960_0025367 3300044901 Bacteria 2682
536 Ga0466960_0243102 3300044901 Bacteria 997
537 Ga0466960_0668273 3300044901 Bacteria 621
538 Ga0466959_0005116 3300045049 Bacteria 8928
539 Ga0466959_0024774 3300045049 Bacteria 4444
540 Ga0466959_0086797 3300045049 Bacteria 2251
541 Ga0466959_0111203 3300045049 Bacteria 1955
542 Ga0466959_0138087 3300045049 Bacteria 1724
543 Ga0466959_0161369 3300045049 Bacteria 1576
544 Ga0466959_0336363 3300045049 Bacteria 1030
545 Ga0466959_0375226 3300045049 Bacteria 968
546 Ga0466959_0651842 3300045049 Bacteria 707
547 Ga0466958_0006698 3300045836 Bacteria 6287
548 Ga0466958_0007453 3300045836 Bacteria 6021
549 Ga0466958_0014679 3300045836 Bacteria 4473
550 Ga0466958_0031293 3300045836 Bacteria 3162
551 Ga0466958_0066399 3300045836 Bacteria 2203
552 Ga0466958_0067614 3300045836 Bacteria 2183
553 Ga0466958_0083088 3300045836 Bacteria 1973
554 Ga0466958_0166540 3300045836 Unclassified 1394
555 Ga0466958_0362905 3300045836 Bacteria 933
556 Ga0466958_0514012 3300045836 Bacteria 777
557 Ga0466958_0769108 3300045836 Bacteria 628
558 Ga0466967_0003569 3300045976 Bacteria 10201
559 Ga0466967_0074272 3300045976 Bacteria 3053
560 Ga0466967_0086837 3300045976 Bacteria 2835
561 Ga0466967_0190597 3300045976 Bacteria 1937
562 Ga0466967_0271209 3300045976 Bacteria 1626
563 Ga0466967_0297277 3300045976 Bacteria 1553
564 Ga0466967_0376745 3300045976 Bacteria 1377
565 Ga0466967_0406549 3300045976 Bacteria 1325
566 Ga0466967_0599605 3300045976 Bacteria 1087
567 Ga0466967_0799976 3300045976 Bacteria 936
568 Ga0466967_0861275 3300045976 Bacteria 901
569 Ga0466967_0933913 3300045976 Bacteria 863
570 Ga0466967_1003995 3300045976 Bacteria 831
571 Ga0466967_1208786 3300045976 Bacteria 753
572 Ga0466967_1785764 3300045976 Bacteria 612
573 Ga0495592_0116512 3300046454 Bacteria 1885
574 Ga0495590_0284536 3300046457 Bacteria 620
575 Ga0495629_0470015 3300046459 Unclassified 850
576 Ga0495651_0066239 3300046462 Bacteria 2757
577 Ga0495653_0012024 3300046463 Bacteria 7066
578 Ga0495650_0000035 3300046471 Bacteria 403799
579 Ga0495580_1082820 3300046472 Bacteria 508
580 Ga0495664_0000069 3300046477 Bacteria 49516
581 Ga0495664_0333592 3300046477 Unclassified 914
582 Ga0495584_0206547 3300046491 Bacteria 998
583 Ga0495584_0305999 3300046491 Bacteria 807
584 Ga0495596_0097358 3300046500 Bacteria 1142
585 Ga0495596_0144189 3300046500 Bacteria 925
586 Ga0495607_0561634 3300046501 Unclassified 500
587 Ga0495608_0018224 3300046511 Bacteria 4844
588 Ga0495618_0071740 3300046514 Bacteria 2203
589 Ga0495628_0106090 3300046516 Bacteria 2164
590 Ga0495630_0102649 3300046517 Bacteria 2164
591 Ga0495632_0181604 3300046519 Bacteria 964
592 Ga0495632_0433224 3300046519 Bacteria 572
593 Ga0495643_0222797 3300046522 Bacteria 894
594 Ga0495644_0148058 3300046523 Bacteria 898
595 Ga0495663_0209908 3300046525 Bacteria 682
596 Ga0495652_0026946 3300046529 Bacteria 5070
597 Ga0495654_0190959 3300046530 Bacteria 882
598 Ga0495640_0136422 3300046533 Bacteria 1584
599 Ga0495640_0399677 3300046533 Unclassified 844
600 Ga0495621_0360836 3300046539 Bacteria 611
601 Ga0495645_0616094 3300046543 Bacteria 666
602 Ga0495667_0823721 3300046559 Unclassified 572
603 Ga0495656_0184566 3300046615 Bacteria 1027
604 Ga0495656_0396217 3300046615 Bacteria 722
605 Ga0495668_0140853 3300046616 Bacteria 1320
606 Ga0495668_0181865 3300046616 Bacteria 1152
607 Ga0495634_0024025 3300046642 Bacteria 4280
608 Ga0495635_0044906 3300046663 Bacteria 3048
609 Ga0495661_0205800 3300046665 Bacteria 1028
610 Ga0495657_0098507 3300046675 Bacteria 1865
611 Ga0495599_0316205 3300046678 Bacteria 940
612 Ga0495646_0721307 3300046680 Unclassified 500
613 Ga0495613_0105629 3300046689 Bacteria 2033
614 Ga0495624_0577874 3300046690 Unclassified 670
615 Ga0495589_0226191 3300046794 Bacteria 878
616 Ga0495589_0257126 3300046794 Bacteria 815
617 Ga0495600_0134333 3300046809 Bacteria 1607
618 Ga0495581_0265042 3300047315 Bacteria 1005
619 Ga0495581_0422882 3300047315 Bacteria 776
620 Ga0495604_0031973 3300047317 Bacteria 4172
621 Ga0495604_0263779 3300047317 Unclassified 1170
622 Ga0495672_0308647 3300047320 Bacteria 747
623 Ga0495593_0491566 3300047673 Bacteria 615
624 Ga0495602_0094880 3300048088 Bacteria 2464
625 Ga0495602_0412577 3300048088 Bacteria 961
626 Ga0495602_1004575 3300048088 Unclassified 550
627 Ga0495626_0214548 3300048091 Bacteria 784
628 Ga0496100_0081004 3300048903 Bacteria 2192
629 Ga0496100_0358956 3300048903 Bacteria 1102
630 Ga0496100_0879775 3300048903 Bacteria 703
631 Ga0496101_0081517 3300048904 Bacteria 2393
632 Ga0496101_0298033 3300048904 Bacteria 1262
633 Ga0496101_0388912 3300048904 Bacteria 1098
634 Ga0496101_0483435 3300048904 Bacteria 978
635 Ga0496101_1626454 3300048904 Bacteria 502
636 Ga0496102_0031429 3300048905 Bacteria 4763
637 Ga0496102_0054462 3300048905 Bacteria 3648
638 Ga0496103_0106090 3300048906 Bacteria 1782
639 Ga0496103_0140710 3300048906 Bacteria 1543
640 Ga0496103_0186787 3300048906 Bacteria 1332
641 Ga0496104_0000034 3300048907 Bacteria 186572
642 Ga0496104_0007832 3300048907 Bacteria 9468
643 Ga0496104_0116803 3300048907 Bacteria 2560
644 Ga0496104_0179385 3300048907 Bacteria 2028
645 Ga0496104_0284167 3300048907 Bacteria 1567
646 Ga0496105_0081770 3300048908 Bacteria 2668
647 Ga0496105_0104863 3300048908 Bacteria 2334
648 Ga0496105_0132284 3300048908 Bacteria 2056
649 Ga0496105_0534923 3300048908 Bacteria 916
650 Ga0496106_0125111 3300048909 Bacteria 2012
651 Ga0496106_0257300 3300048909 Bacteria 1396
652 Ga0496106_0370955 3300048909 Bacteria 1150
653 Ga0496106_0573476 3300048909 Bacteria 905
654 Ga0496107_0182581 3300048910 Bacteria 1558
655 Ga0496107_0185623 3300048910 Bacteria 1544
656 Ga0496107_0188182 3300048910 Bacteria 1533
657 Ga0496107_0956789 3300048910 Bacteria 623
658 Ga0496108_0026049 3300048911 Bacteria 4823
659 Ga0496108_0030585 3300048911 Bacteria 4462
660 Ga0496108_0133169 3300048911 Bacteria 2137
661 Ga0496108_0137724 3300048911 Bacteria 2102
662 Ga0496108_0244604 3300048911 Bacteria 1561
663 Ga0496108_0333494 3300048911 Bacteria 1323
664 Ga0496109_0017876 3300048912 Bacteria 6222
665 Ga0496109_0220965 3300048912 Bacteria 1781
666 Ga0496109_0316105 3300048912 Bacteria 1473
667 Ga0496109_0325417 3300048912 Bacteria 1451
668 Ga0496109_0732872 3300048912 Bacteria 926
669 Ga0496110_0000784 3300048913 Bacteria 22147
670 Ga0496110_0043739 3300048913 Bacteria 3911
671 Ga0496110_0045317 3300048913 Bacteria 3844
672 Ga0496110_0387596 3300048913 Bacteria 1273
673 Ga0496110_1310083 3300048913 Bacteria 633
674 Ga0496111_0003571 3300048914 Bacteria 9636
675 Ga0496111_0032073 3300048914 Bacteria 3745
676 Ga0496111_0232592 3300048914 Bacteria 1369
677 Ga0496111_0432775 3300048914 Bacteria 971
678 Ga0496112_0002022 3300048915 Bacteria 16056
679 Ga0496112_0076989 3300048915 Bacteria 3298
680 Ga0496112_0166307 3300048915 Bacteria 2171
681 Ga0496112_0290158 3300048915 Bacteria 1582
682 Ga0496112_0471150 3300048915 Bacteria 1193
683 Ga0496112_0556804 3300048915 Bacteria 1080
684 Ga0496112_1256852 3300048915 Unclassified 656
685 Ga0496113_0037664 3300048916 Bacteria 3551
686 Ga0496113_0140250 3300048916 Bacteria 1901
687 Ga0496113_0201645 3300048916 Bacteria 1581
688 Ga0496113_0272147 3300048916 Bacteria 1354
689 Ga0496113_0647228 3300048916 Bacteria 845
690 Ga0496114_0017433 3300048917 Bacteria 5797
691 Ga0496114_0061121 3300048917 Bacteria 3150
692 Ga0496115_0082331 3300048918 Bacteria 2622
693 Ga0496115_0205184 3300048918 Bacteria 1628
694 Ga0496115_0296018 3300048918 Bacteria 1326
695 Ga0496115_0329546 3300048918 Bacteria 1247
696 Ga0496124_0211178 3300048927 Bacteria 1468
697 Ga0501033_0899235 3300049570 Bacteria 595
698 Ga0501067_0709422 3300049583 Bacteria 565
699 Ga0501076_1236090 3300049592 Bacteria 615
700 Ga0501249_050799 3300049679 Bacteria 952
701 Ga0501081_0877517 3300049743 Bacteria 676
702 nmdc:mga06r32_214296_c1 3300050510 Bacteria 1914
703 nmdc:mga06r32_769725_c1 3300050510 Bacteria 925
704 nmdc:mga08y16_104862_c1 3300050511 Bacteria 2943
705 nmdc:mga08y16_180600_c1 3300050511 Bacteria 2191
706 nmdc:mga08y16_1994448_c1 3300050511 Unclassified 530
707 nmdc:mga08y16_21770_c1 3300050511 Bacteria 6764
708 nmdc:mga0n895_150628_c1 3300050512 Bacteria 2356
709 nmdc:mga0n895_25361_c1 3300050512 Bacteria 5600
710 nmdc:mga0n895_547860_c1 3300050512 Bacteria 1163
711 nmdc:mga08x19_302689_c1 3300050514 Bacteria 1111
712 nmdc:mga0a205_362092_c1 3300050515 Bacteria 1317
713 nmdc:mga0a205_54445_c1 3300050515 Bacteria 3863
714 nmdc:mga0a205_629334_c1 3300050515 Bacteria 925
715 Ga0495601_1019268 3300053077 Unclassified 520
716 Ga0495612_0315905 3300053078 Unclassified 702
717 Ga0495612_0422645 3300053078 Unclassified 607
718 Ga0495595_0036039 3300053084 Bacteria 2243
719 Ga0495595_0242345 3300053084 Bacteria 902
720 Ga0500616_0063745 3300053153 Bacteria 1899
721 Ga0501084_0883075 3300054114 Bacteria 752
722 Ga0501084_1223784 3300054114 Bacteria 630
723 Ga0466962_0046547 3300061719 Bacteria 2072
724 Ga0466962_0082143 3300061719 Bacteria 1541
725 Ga0466962_0084142 3300061719 Bacteria 1522
726 Ga0530510_0403514 3300061734 Bacteria 1031
727 Ga0307405_11973103
728 JGI24737J22298_10086284
729 JGI24750J21931_1044506
730 JGI24745J21846_1002780
731 Ga0070683_100032293
732 Ga0070683_100179005
733 Ga0070683_100218571
734 Ga0070683_101290376
735 Ga0070690_100056104
736 Ga0070670_100517854
737 Ga0068869_100032448
738 Ga0068869_100089351
739 Ga0068869_100861291
740 Ga0070680_100221554
741 Ga0070682_100033351
742 Ga0070682_100062127
743 Ga0070682_100153470
744 Ga0070682_101254886
745 Ga0068868_100022537
746 Ga0068868_100034290
747 Ga0068868_100121803
748 Ga0070660_100342705
749 Ga0070689_100189216
750 Ga0070691_10029379
751 Ga0070687_100017693
752 Ga0070661_100941091
753 Ga0070692_10056057
754 Ga0070692_10180061
755 Ga0070668_100126324
756 Ga0070668_100404989
757 Ga0070669_100111769
758 Ga0070675_100189810
759 Ga0070675_100336376
760 Ga0070675_102196963
761 Ga0070671_100222593
762 Ga0070671_100752990
763 Ga0070674_100118496
764 Ga0070674_100428010
765 Ga0070673_100333355
766 Ga0070673_101673861
767 Ga0070688_100014406
768 Ga0070688_100104387
769 Ga0070659_100035785
770 Ga0070667_101479877
771 Ga0070703_10366732
772 Ga0070709_10086496
773 Ga0070709_10338431
774 Ga0070709_10804202
775 Ga0070709_10825959
776 Ga0070714_100116966
777 Ga0070714_100141828
778 Ga0070714_100777150
779 Ga0070714_100983154
780 Ga0070714_101628262
781 Ga0070714_101677373
782 Ga0070713_100047033
783 Ga0070713_100234894
784 Ga0070713_100640409
785 Ga0070713_102393053
786 Ga0070710_10049735
787 Ga0070710_10070632
788 Ga0070710_10476857
789 Ga0070710_11403234
790 Ga0070701_10053812
791 Ga0070711_100099646
792 Ga0070711_100156497
793 Ga0070711_100240498
794 Ga0070711_100328462
795 Ga0070705_100383749
796 Ga0070705_100738382
797 Ga0070705_101475208
798 Ga0070700_100439624
799 Ga0070700_100569351
800 Ga0070700_101174716
801 Ga0070694_101152760
802 Ga0070663_100163155
803 Ga0070663_100200056
804 Ga0070663_100781346
805 Ga0070678_100027600
806 Ga0070678_100120057
807 Ga0070678_101561213
808 Ga0070662_100110897
809 Ga0070662_100418238
810 Ga0068867_100353622
811 Ga0070685_10281941
812 Ga0070685_10445797
813 Ga0070679_101705429
814 Ga0070684_100029416
815 Ga0070684_102032197
816 Ga0068853_100277013
817 Ga0068853_100417688
818 Ga0068853_101659729
819 Ga0070686_100074255
820 Ga0070686_100148122
821 Ga0070695_100783761
822 Ga0070696_100617539
823 Ga0070696_100690379
824 Ga0070696_100916473
825 Ga0070693_101048747
826 Ga0070665_100086740
827 Ga0070704_100160292
828 Ga0068855_100432185
829 Ga0070664_100193090
830 Ga0070664_100320854
831 Ga0070664_100644032
832 Ga0068857_100194874
833 Ga0068857_100659794
834 Ga0068854_100287822
835 Ga0068854_100331727
836 Ga0068856_100003626
837 Ga0068856_100029968
838 Ga0068856_100292479
839 Ga0068856_100416762
840 Ga0068856_100542821
841 Ga0070702_100021061
842 Ga0070702_100042928
843 Ga0070702_100092428
844 Ga0070702_100693957
845 Ga0068852_100055996
846 Ga0068852_100080088
847 Ga0068852_100202853
848 Ga0068859_100116392
849 Ga0068859_100138482
850 Ga0068859_100220635
851 Ga0068859_100378222
852 Ga0068864_100108930
853 Ga0068864_100537270
854 Ga0068866_10024030
855 Ga0068866_10027790
856 Ga0068866_10692546
857 Ga0068861_100157187
858 Ga0068861_100167001
859 Ga0068851_10217353
860 Ga0068863_100396848
861 Ga0068863_100488233
862 Ga0068858_100811034
863 Ga0068858_101140382
864 Ga0068860_100198286
865 Ga0068860_100849443
866 Ga0068860_101134304
867 Ga0068860_102746214
868 Ga0068862_100089343
869 Ga0081538_10001995
870 Ga0081538_10055768
871 Ga0070717_10756422
872 Ga0070717_11048135
873 Ga0070717_11472441
874 Ga0070717_11958195
875 Ga0075363_100098785
876 Ga0075432_10354065
877 Ga0070715_10824052
878 Ga0070716_100152807
879 Ga0070716_100780102
880 Ga0070712_100018968
881 Ga0070712_100138211
882 Ga0070712_100265484
883 Ga0070712_100272480
884 Ga0070712_100809538
885 Ga0097621_100863370
886 Ga0068871_100573504
887 Ga0075428_100444121
888 Ga0075431_100460437
889 Ga0075431_101365882
890 Ga0075433_10293207
891 Ga0075433_10538451
892 Ga0075433_10921601
893 Ga0075434_100096488
894 Ga0075434_100162624
895 Ga0075434_100229258
896 Ga0068865_100382137
897 Ga0068865_100712831
898 Ga0068865_100912085
899 Ga0075436_100746830
900 Ga0097620_100116398
901 Ga0097620_100138483
902 Ga0097620_100220633
903 Ga0097620_100378228
904 Ga0105251_10203747
905 Ga0105251_10262998
906 Ga0105240_10047079
907 Ga0105240_10336170
908 Ga0111539_10023359
909 Ga0111539_10064360
910 Ga0111539_11054863
911 Ga0105245_10010610
912 Ga0105245_10025471
913 Ga0105245_10028772
914 Ga0105247_10084694
915 Ga0105247_10275878
916 Ga0105243_10007928
917 Ga0105243_10252011
918 Ga0105243_10794510
919 Ga0105242_11010479
920 Ga0105242_11214336
921 Ga0105242_11300941
922 Ga0105248_10350585
923 Ga0105237_10336445
924 Ga0105237_10427427
925 Ga0105237_11916543
926 Ga0105238_10141464
927 Ga0105238_10554936
928 Ga0105249_10021570
929 Ga0105249_10404838
930 Ga0105249_10427586
931 Ga0105239_10040711
932 Ga0105239_10344391
933 Ga0105239_12633449
934 Ga0105246_10064650
935 Ga0105246_10245456
936 Ga0157345_1051217
937 Ga0157371_11069932
938 Ga0157370_12080731
939 Ga0157369_10407860
940 Ga0157369_11624057
941 Ga0157374_10042410
942 Ga0157374_10115920
943 Ga0157378_10194241
944 Ga0163162_10221680
945 Ga0163162_10732834
946 Ga0157375_10057404
947 Ga0157375_10856983
948 Ga0163163_10050367
949 Ga0163163_10275137
950 Ga0163163_10854622
951 Ga0157380_10014936
952 Ga0182008_10493775
953 Ga0157377_10024865
954 Ga0157377_10104156
955 Ga0157377_10531455
956 Ga0157379_10093013
957 Ga0157379_10535906
958 Ga0157379_11119781
959 Ga0163161_10082551
960 Ga0163161_10303229
961 Ga0206356_11276845
962 Ga0213873_10004743
963 Ga0213873_10150634
964 Ga0213874_10004176
965 Ga0213874_10005903
966 Ga0213874_10243115
967 Ga0213876_10001544
968 Ga0213876_10016766
969 Ga0213876_10018801
970 Ga0213876_10019979
971 Ga0213876_10059971
972 Ga0213876_10067929
973 Ga0213876_10082410
974 Ga0213876_10110720
975 Ga0213876_10315159
976 Ga0213875_10006593
977 Ga0213875_10009721
978 Ga0213875_10072650
979 Ga0213875_10152753
980 Ga0207692_10075585
981 Ga0207692_10138381
982 Ga0207642_10069704
983 Ga0207642_10095632
984 Ga0207642_10212674
985 Ga0207642_10428971
986 Ga0207710_10395327
987 Ga0207688_10007211
988 Ga0207688_10012838
989 Ga0207688_10108405
990 Ga0207680_10265253
991 Ga0207647_10114653
992 Ga0207647_10138314
993 Ga0207699_10108625
994 Ga0207643_10480247
995 Ga0207671_10260719
996 Ga0207693_10005756
997 Ga0207693_10382821
998 Ga0207663_10063422
999 Ga0207663_10113009
1000 Ga0207660_10277369
1001 Ga0207662_10011133
1002 Ga0207657_10050330
1003 Ga0207657_10328026
1004 Ga0207649_10497107
1005 Ga0207652_10899568
1006 Ga0207681_10682263
1007 Ga0207694_10419620
1008 Ga0207694_10484465
1009 Ga0207650_10330619
1010 Ga0207659_10026572
1011 Ga0207659_10313500
1012 Ga0207687_10016823
1013 Ga0207687_10208847
1014 Ga0207687_10284434
1015 Ga0207687_11098530
1016 Ga0207700_10054061
1017 Ga0207700_10677006
1018 Ga0207664_10753546
1019 Ga0207664_11474607
1020 Ga0207664_11737989
1021 Ga0207664_11911014
1022 Ga0207644_10052163
1023 Ga0207644_11231014
1024 Ga0207690_10211365
1025 Ga0207706_10047059
1026 Ga0207706_10121093
1027 Ga0207709_10049263
1028 Ga0207709_10059297
1029 Ga0207709_10068027
1030 Ga0207670_10025897
1031 Ga0207670_10156497
1032 Ga0207669_10461957
1033 Ga0207704_11003394
1034 Ga0207665_10207706
1035 Ga0207691_10139578
1036 Ga0207711_10138997
1037 Ga0207711_10324794
1038 Ga0207689_10017383
1039 Ga0207689_10021161
1040 Ga0207689_10595399
1041 Ga0207661_10141188
1042 Ga0207661_10552908
1043 Ga0207661_10947323
1044 Ga0207661_12025954
1045 Ga0207679_10113250
1046 Ga0207679_10146296
1047 Ga0207712_10052768
1048 Ga0207640_10143071
1049 Ga0207640_10286672
1050 Ga0207640_10319678
1051 Ga0207640_10417378
1052 Ga0207677_10287797
1053 Ga0207677_10561622
1054 Ga0207703_10328883
1055 Ga0207703_10682414
1056 Ga0207639_10094479
1057 Ga0207639_10766989
1058 Ga0207678_10003114
1059 Ga0207678_10103678
1060 Ga0207678_10215948
1061 Ga0207678_10275147
1062 Ga0207708_10000226
1063 Ga0207708_10013877
1064 Ga0207708_10280321
1065 Ga0207702_10029142
1066 Ga0207702_10080973
1067 Ga0207702_10138348
1068 Ga0207702_10239970
1069 Ga0207702_11473013
1070 Ga0207702_11967837
1071 Ga0207641_11871868
1072 Ga0207648_10056116
1073 Ga0207648_10405801
1074 Ga0207676_10292175
1075 Ga0207676_10888308
1076 Ga0207674_10029139
1077 Ga0207674_10042131
1078 Ga0207675_100020263
1079 Ga0207675_100080394
1080 Ga0207675_100088886
1081 Ga0207675_100202044
1082 Ga0207683_10004568
1083 Ga0207683_10084090
1084 Ga0207683_10170604
1085 Ga0207683_11505716
1086 Ga0207698_10021222
1087 Ga0207698_10070279
1088 Ga0207698_10156456
1089 Ga0207428_10012948
1090 Ga0207428_10130068
1091 Ga0207428_10566395
1092 Ga0207428_10645978
1093 Ga0207428_10888346
1094 Ga0268266_10075048
1095 Ga0268264_10743463
1096 Ga0268264_10868429
1097 Ga0268264_11368024
1098 Ga0268264_11894974
1099 Ga0265337_1001237
1100 Ga0265326_10001628
1101 Ga0265319_1001701
1102 Ga0265318_10005258
1103 Ga0265322_10003590
1104 Ga0265336_10000001
1105 Ga0265338_10000228
1106 Ga0265338_10085638
1107 Ga0265324_10003753
1108 Ga0265330_10133475
1109 Ga0265320_10089192
1110 Ga0265325_10146347
1111 Ga0265340_10000005
1112 Ga0265339_10040215
1113 Ga0265327_10047682
1114 Ga0265327_10181911
1115 Ga0265316_10774927
1116 Ga0307408_100861491
1117 Ga0265342_10105901
1118 Ga0307410_10037815
1119 Ga0307410_10720229
1120 Ga0307406_10039098
1121 Ga0307406_10445968
1122 Ga0307407_10051461
1123 Ga0307409_100030383
1124 Ga0307409_101305067
1125 Ga0307409_101801954
1126 Ga0307416_100039676
1127 Ga0307416_100172531
1128 Ga0307414_10428312
1129 Ga0307415_100031677
1130 Ga0307415_100586773
1131 Ga0307415_100676845
1132 Ga0307415_101174414
1133 Ga0307415_101699825
1134 Ga0373958_0039645
1135 Ga0373952_0067919
1136 Ga0373932_0105400
1137 Ga0373956_0277059
1138 Ga0373960_0128849
1139 Ga0373931_0300892
1140 Ga0373933_0020968
1141 Ga0373933_0636503
1142 Ga0373937_0038067
1143 Ga0395899_0646126
1144 Ga0395900_0013411
1145 Ga0395898_0000955
1146 Ga0395898_0304826
1147 Ga0395898_0642318
1148 Ga0436364_0314628
1149 Ga0436364_0400719
1150 Ga0436364_0419681
1151 Ga0436364_0442633
1152 Ga0436364_0738192
1153 Ga0436364_0799253
1154 Ga0436364_0829896
1155 Ga0436364_0896740
1156 Ga0436364_0922578
1157 Ga0395901_0218472
1158 Ga0395901_0436596
1159 Ga0395901_1126584
1160 Ga0436365_0026833
1161 Ga0436365_0083670
1162 Ga0436365_0483533
1163 Ga0436365_0669023
1164 Ga0436365_0728165
1165 Ga0436365_0863062
1166 Ga0436365_0974012
1167 Ga0436365_1050938
1168 Ga0436365_1111719
1169 Ga0436365_1219695
1170 Ga0436365_1258586
1171 Ga0436365_1508964
1172 Ga0436365_1547668
1173 Ga0436365_1551735
1174 Ga0436365_1558474
1175 Ga0436365_1564126
1176 Ga0436365_1666267
1177 Ga0436360_0250102
1178 Ga0436361_0099371
1179 Ga0436363_0296521
1180 Ga0436363_0362406
1181 Ga0436363_0391877
1182 Ga0436363_0435659
1183 Ga0436363_0557853
1184 Ga0436363_0678117
1185 Ga0436363_0996692
1186 Ga0436363_1057956
1187 Ga0436363_1066234
1188 Ga0436363_1066858
1189 Ga0436363_1077534
1190 Ga0436363_1093983
1191 Ga0436363_1138834
1192 Ga0436363_1242862
1193 Ga0436363_1338018
1194 Ga0436362_0429893
1195 Ga0436362_0498550
1196 Ga0436362_0627932
1197 Ga0436362_0668156
1198 Ga0436362_0732498
1199 Ga0451853_0303467
1200 Ga0439448_0036046
1201 Ga0439455_0104455
1202 Ga0439463_091031
1203 Ga0466969_0013906
1204 Ga0466969_0078369
1205 Ga0466969_0147620
1206 Ga0466969_0213393
1207 Ga0466969_0258186
1208 Ga0466969_0507499
1209 Ga0466972_0159164
1210 Ga0466965_0145527
1211 Ga0466965_0435420
1212 Ga0466965_0470109
1213 Ga0466966_0045008
1214 Ga0466966_0109193
1215 Ga0466966_0112283
1216 Ga0466966_0121140
1217 Ga0466966_0132737
1218 Ga0466966_0178082
1219 Ga0466966_0324248
1220 Ga0466966_0565812
1221 Ga0466966_0602683
1222 Ga0466966_0611001
1223 Ga0466961_0055193
1224 Ga0466961_0191634
1225 Ga0466961_0197762
1226 Ga0466961_0671420
1227 Ga0466963_0022007
1228 Ga0466963_0045514
1229 Ga0466963_0046733
1230 Ga0466963_0150129
1231 Ga0466963_0258202
1232 Ga0466963_0340232
1233 Ga0466963_0762896
1234 Ga0466963_0860412
1235 Ga0466963_1135734
1236 Ga0466963_1234958
1237 Ga0466964_0037197
1238 Ga0466964_0147940
1239 Ga0466971_0003070
1240 Ga0466971_0052597
1241 Ga0466971_0120852
1242 Ga0466971_0386108
1243 Ga0466971_0649226
1244 Ga0466968_0056800
1245 Ga0466968_0060642
1246 Ga0466968_0093126
1247 Ga0466968_0204314
1248 Ga0466968_0383550
1249 Ga0466968_0394658
1250 Ga0466968_0409321
1251 Ga0466968_0515460
1252 Ga0466968_0578422
1253 Ga0466970_0049590
1254 Ga0466970_0216906
1255 Ga0466970_0698688
1256 Ga0466957_0019957
1257 Ga0466957_0547161
1258 Ga0466957_0944795
1259 Ga0466960_0000044
1260 Ga0466960_0018607
1261 Ga0466960_0025367
1262 Ga0466960_0243102
1263 Ga0466960_0668273
1264 Ga0466959_0005116
1265 Ga0466959_0024774
1266 Ga0466959_0086797
1267 Ga0466959_0111203
1268 Ga0466959_0138087
1269 Ga0466959_0161369
1270 Ga0466959_0336363
1271 Ga0466959_0375226
1272 Ga0466959_0651842
1273 Ga0466958_0006698
1274 Ga0466958_0007453
1275 Ga0466958_0014679
1276 Ga0466958_0031293
1277 Ga0466958_0066399
1278 Ga0466958_0067614
1279 Ga0466958_0083088
1280 Ga0466958_0166540
1281 Ga0466958_0362905
1282 Ga0466958_0514012
1283 Ga0466958_0769108
1284 Ga0466967_0003569
1285 Ga0466967_0074272
1286 Ga0466967_0086837
1287 Ga0466967_0190597
1288 Ga0466967_0271209
1289 Ga0466967_0297277
1290 Ga0466967_0376745
1291 Ga0466967_0406549
1292 Ga0466967_0599605
1293 Ga0466967_0799976
1294 Ga0466967_0861275
1295 Ga0466967_0933913
1296 Ga0466967_1003995
1297 Ga0466967_1208786
1298 Ga0466967_1785764
1299 Ga0495592_0116512
1300 Ga0495590_0284536
1301 Ga0495629_0470015
1302 Ga0495651_0066239
1303 Ga0495653_0012024
1304 Ga0495650_0000035
1305 Ga0495580_1082820
1306 Ga0495664_0000069
1307 Ga0495664_0333592
1308 Ga0495584_0206547
1309 Ga0495584_0305999
1310 Ga0495596_0097358
1311 Ga0495596_0144189
1312 Ga0495607_0561634
1313 Ga0495608_0018224
1314 Ga0495618_0071740
1315 Ga0495628_0106090
1316 Ga0495630_0102649
1317 Ga0495632_0181604
1318 Ga0495632_0433224
1319 Ga0495643_0222797
1320 Ga0495644_0148058
1321 Ga0495663_0209908
1322 Ga0495652_0026946
1323 Ga0495654_0190959
1324 Ga0495640_0136422
1325 Ga0495640_0399677
1326 Ga0495621_0360836
1327 Ga0495645_0616094
1328 Ga0495667_0823721
1329 Ga0495656_0184566
1330 Ga0495656_0396217
1331 Ga0495668_0140853
1332 Ga0495668_0181865
1333 Ga0495634_0024025
1334 Ga0495635_0044906
1335 Ga0495661_0205800
1336 Ga0495657_0098507
1337 Ga0495599_0316205
1338 Ga0495646_0721307
1339 Ga0495613_0105629
1340 Ga0495624_0577874
1341 Ga0495589_0226191
1342 Ga0495589_0257126
1343 Ga0495600_0134333
1344 Ga0495581_0265042
1345 Ga0495581_0422882
1346 Ga0495604_0031973
1347 Ga0495604_0263779
1348 Ga0495672_0308647
1349 Ga0495593_0491566
1350 Ga0495602_0094880
1351 Ga0495602_0412577
1352 Ga0495602_1004575
1353 Ga0495626_0214548
1354 Ga0496100_0081004
1355 Ga0496100_0358956
1356 Ga0496100_0879775
1357 Ga0496101_0081517
1358 Ga0496101_0298033
1359 Ga0496101_0388912
1360 Ga0496101_0483435
1361 Ga0496101_1626454
1362 Ga0496102_0031429
1363 Ga0496102_0054462
1364 Ga0496103_0106090
1365 Ga0496103_0140710
1366 Ga0496103_0186787
1367 Ga0496104_0000034
1368 Ga0496104_0007832
1369 Ga0496104_0116803
1370 Ga0496104_0179385
1371 Ga0496104_0284167
1372 Ga0496105_0081770
1373 Ga0496105_0104863
1374 Ga0496105_0132284
1375 Ga0496105_0534923
1376 Ga0496106_0125111
1377 Ga0496106_0257300
1378 Ga0496106_0370955
1379 Ga0496106_0573476
1380 Ga0496107_0182581
1381 Ga0496107_0185623
1382 Ga0496107_0188182
1383 Ga0496107_0956789
1384 Ga0496108_0026049
1385 Ga0496108_0030585
1386 Ga0496108_0133169
1387 Ga0496108_0137724
1388 Ga0496108_0244604
1389 Ga0496108_0333494
1390 Ga0496109_0017876
1391 Ga0496109_0220965
1392 Ga0496109_0316105
1393 Ga0496109_0325417
1394 Ga0496109_0732872
1395 Ga0496110_0000784
1396 Ga0496110_0043739
1397 Ga0496110_0045317
1398 Ga0496110_0387596
1399 Ga0496110_1310083
1400 Ga0496111_0003571
1401 Ga0496111_0032073
1402 Ga0496111_0232592
1403 Ga0496111_0432775
1404 Ga0496112_0002022
1405 Ga0496112_0076989
1406 Ga0496112_0166307
1407 Ga0496112_0290158
1408 Ga0496112_0471150
1409 Ga0496112_0556804
1410 Ga0496112_1256852
1411 Ga0496113_0037664
1412 Ga0496113_0140250
1413 Ga0496113_0201645
1414 Ga0496113_0272147
1415 Ga0496113_0647228
1416 Ga0496114_0017433
1417 Ga0496114_0061121
1418 Ga0496115_0082331
1419 Ga0496115_0205184
1420 Ga0496115_0296018
1421 Ga0496115_0329546
1422 Ga0496124_0211178
1423 Ga0501033_0899235
1424 Ga0501067_0709422
1425 Ga0501076_1236090
1426 Ga0501249_050799
1427 Ga0501081_0877517
1428 nmdc:mga06r32_214296_c1
1429 nmdc:mga06r32_769725_c1
1430 nmdc:mga08y16_104862_c1
1431 nmdc:mga08y16_180600_c1
1432 nmdc:mga08y16_1994448_c1
1433 nmdc:mga08y16_21770_c1
1434 nmdc:mga0n895_150628_c1
1435 nmdc:mga0n895_25361_c1
1436 nmdc:mga0n895_547860_c1
1437 nmdc:mga08x19_302689_c1
1438 nmdc:mga0a205_362092_c1
1439 nmdc:mga0a205_54445_c1
1440 nmdc:mga0a205_629334_c1
1441 Ga0495601_1019268
1442 Ga0495612_0315905
1443 Ga0495612_0422645
1444 Ga0495595_0036039
1445 Ga0495595_0242345
1446 Ga0500616_0063745
1447 Ga0501084_0883075
1448 Ga0501084_1223784
1449 Ga0466962_0046547
1450 Ga0466962_0082143
1451 Ga0466962_0084142
1452 Ga0530510_0403514

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1lrz-assembly1.cif.gz_A x-ray crystal structure of staphylococcus aureus fema 0.8591 28 86
1qu7-assembly1.cif.gz_B four helical-bundle structure of the cytoplasmic domain of a serine chemotaxis receptor 0.8563 26 80
4fi5-assembly1.cif.gz_A crystal structure of the n-terminal domain of hantaan virus strain 76-118 nucleoprotein 0.8538 22 87
6s1k-assembly1.cif.gz_E e. coli core signaling unit, carrying qqqq receptor mutation 0.8442 26 93
6s1k-assembly1.cif.gz_I e. coli core signaling unit, carrying qqqq receptor mutation 0.8441 26 93
ID Description Score Start End Superfamily
af_A0A0B4JCU6_1_139_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.8923 26 83 1.20.140.150
af_P02942_216_518_1.10.287.950 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Methyl-accepting chemotaxis protein 0.872 26 80 1.10.287.950
1qu7B00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Methyl-accepting chemotaxis protein 0.8563 26 80 1.10.287.950
af_Q75L87_1_294_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.8483 28 83 1.20.140.150
3tklB01 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.8285 20 87 1.20.58.90
ID Description Score Start End GO Terms
AF-A0A1E5TMV8-F1-model_v4 deleted 0.8724 23 92
AF-A0A538EC71-F1-model_v4 DUF3618 domain-containing protein 0.8321 10 89 GO:0016020
AF-A0A657BBN7-F1-model_v4 Membrane fusion protein biotin-lipoyl like domain-containing protein 0.8209 26 90 GO:0015562
GO:1990281
AF-A0A655PDY2-F1-model_v4 Agglutination protein 0.8136 25 96 GO:0009279
GO:0015288
GO:0015562
GO:1990281
AF-A0A381XGK3-F1-model_v4 Membrane fusion protein biotin-lipoyl like domain-containing protein 0.8098 25 90 GO:0015562
GO:1990281

Map