F477659

General Info

Members Datasets Scaffolds Average Seq Length
726 291 1452 153

Family's Representative Sequence

Representative Sequence 3300005333|Ga0070677_10001704|Ga0070677_100017045
Length 177
Sequence MAKVYSAALDLTTEPGIRPVYSVRRMRIALAADHAGFELKQQMGAYLTRQGHDVVDLGTHSTAPVDYPDSAEAVAQTIFDGHADRGVIVCGSGAGVSIAANKFPGIRAAVCHDTYTAHQAVEHDDMNVLCVGSRVIGSALACEIVDAFLRAQFSHEDRHQRRLNKIFAIERRFVVRS

Samples

Sample ID Description Type Environment
1 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
2 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
5 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
6 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
83 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
84 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
98 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
113 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
114 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
162 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
171 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
172 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
173 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
174 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
175 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
176 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
177 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
178 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
179 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
180 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
181 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
182 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
183 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
184 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
185 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
186 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
187 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
188 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
189 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
190 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
191 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
192 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
193 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
194 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
195 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
196 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
197 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
198 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
199 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
200 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
201 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
202 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
203 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
204 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
205 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
206 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
207 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
208 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
209 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
210 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
211 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
212 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
213 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
214 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
215 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
216 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
217 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
218 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
219 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
220 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
221 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
222 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
223 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
224 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
225 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
226 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
227 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
228 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
229 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
230 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
231 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
232 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
242 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
243 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
244 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
245 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
246 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
247 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
248 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
249 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
250 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
251 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
252 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
253 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
254 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
255 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
256 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
257 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
258 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
259 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
260 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
261 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
262 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
263 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
264 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
265 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
266 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
267 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
268 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
269 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
270 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
271 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
272 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
273 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
274 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
275 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
276 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
277 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
278 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
279 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
280 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
281 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
282 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
283 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
284 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
285 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
286 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
287 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
288 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
289 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
290 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
291 8055092621 Silvania confinis H4N4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.69
Metatranscriptomes 0
Isolates 3.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.28
Nodule 0.55
Rhizoplane 1.93
Rhizosphere 91.05
Stem 0
Stem Tuber 0
Unclassified 12.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070677_10001704 3300005333 Bacteria 6959
2 RicEn_C7209 2010549000 Bacteria 1650
3 JGI24746J21847_1004962 3300001977 Unclassified 2085
4 JGI24750J21931_1031514 3300002070 Unclassified 779
5 JGI24748J21848_1024759 3300002074 Unclassified 731
6 Ga0058692_1010703 3300003856 Bacteria 2256
7 Ga0065714_10153851 3300005288 Bacteria 1090
8 Ga0065712_10006027 3300005290 Bacteria 2886
9 Ga0065712_10083231 3300005290 Bacteria 2853
10 Ga0065712_10139486 3300005290 Bacteria 1460
11 Ga0065712_10230042 3300005290 Bacteria 1014
12 Ga0065715_10003216 3300005293 Bacteria 6801
13 Ga0065715_10091582 3300005293 Bacteria 5690
14 Ga0065715_10357900 3300005293 Bacteria 922
15 Ga0065707_10262348 3300005295 Bacteria 1079
16 Ga0065707_10587687 3300005295 Bacteria 698
17 Ga0070676_10001803 3300005328 Bacteria 10896
18 Ga0070676_10011233 3300005328 Bacteria 4870
19 Ga0070676_10029452 3300005328 Bacteria 3122
20 Ga0070683_100153201 3300005329 Bacteria 2185
21 Ga0070683_100460795 3300005329 Bacteria 1213
22 Ga0070690_100013980 3300005330 Bacteria 4759
23 Ga0070690_100015578 3300005330 Bacteria 4540
24 Ga0070690_100307723 3300005330 Bacteria 1138
25 Ga0070670_100018731 3300005331 Bacteria 5935
26 Ga0070670_100021290 3300005331 Bacteria 5578
27 Ga0070670_100118295 3300005331 Bacteria 2285
28 Ga0070670_100763984 3300005331 Unclassified 871
29 Ga0070677_10016661 3300005333 Bacteria 2619
30 Ga0070677_10019971 3300005333 Bacteria 2435
31 Ga0070677_10070904 3300005333 Bacteria 1466
32 Ga0070677_10447767 3300005333 Bacteria 690
33 Ga0070677_10456214 3300005333 Unclassified 685
34 Ga0068869_100001451 3300005334 Bacteria 14018
35 Ga0068869_100074093 3300005334 Bacteria 2526
36 Ga0070666_10038935 3300005335 Bacteria 3165
37 Ga0070666_10602350 3300005335 Bacteria 802
38 Ga0070666_10777080 3300005335 Bacteria 705
39 Ga0070666_11074445 3300005335 Unclassified 598
40 Ga0068868_100100155 3300005338 Bacteria 2344
41 Ga0068868_100139496 3300005338 Bacteria 1989
42 Ga0070689_100065087 3300005340 Bacteria 2838
43 Ga0070689_100077049 3300005340 Bacteria 2612
44 Ga0070689_100107321 3300005340 Bacteria 2217
45 Ga0070689_101234337 3300005340 Unclassified 672
46 Ga0070691_10096726 3300005341 Bacteria 1462
47 Ga0070687_100022049 3300005343 Bacteria 3005
48 Ga0070687_100135038 3300005343 Bacteria 1429
49 Ga0070661_100028138 3300005344 Bacteria 4053
50 Ga0070661_100038268 3300005344 Bacteria 3491
51 Ga0070661_100269055 3300005344 Unclassified 1319
52 Ga0070692_10047812 3300005345 Bacteria 2215
53 Ga0070668_100007025 3300005347 Bacteria 8342
54 Ga0070668_100149585 3300005347 Bacteria 1887
55 Ga0070668_100538501 3300005347 Bacteria 1015
56 Ga0070669_100017527 3300005353 Bacteria 5108
57 Ga0070669_100019575 3300005353 Bacteria 4834
58 Ga0070669_100031277 3300005353 Bacteria 3845
59 Ga0070669_100079044 3300005353 Bacteria 2445
60 Ga0070669_100102313 3300005353 Bacteria 2163
61 Ga0070669_100162736 3300005353 Unclassified 1735
62 Ga0070669_100181322 3300005353 Bacteria 1647
63 Ga0070669_100230981 3300005353 Unclassified 1466
64 Ga0070669_100612755 3300005353 Bacteria 913
65 Ga0070675_100001179 3300005354 Bacteria 18976
66 Ga0070675_100001525 3300005354 Bacteria 17133
67 Ga0070675_100001605 3300005354 Bacteria 16679
68 Ga0070675_100002993 3300005354 Bacteria 12766
69 Ga0070675_100006002 3300005354 Bacteria 9309
70 Ga0070675_100041401 3300005354 Bacteria 3763
71 Ga0070675_100084418 3300005354 Bacteria 2652
72 Ga0070675_100093838 3300005354 Bacteria 2517
73 Ga0070675_100537906 3300005354 Bacteria 1055
74 Ga0070675_100556280 3300005354 Bacteria 1038
75 Ga0070675_101164549 3300005354 Bacteria 709
76 Ga0070671_100014421 3300005355 Bacteria 6386
77 Ga0070671_100027688 3300005355 Bacteria 4666
78 Ga0070671_100838867 3300005355 Bacteria 801
79 Ga0070674_100001218 3300005356 Bacteria 13509
80 Ga0070674_100023270 3300005356 Bacteria 4007
81 Ga0070674_100203049 3300005356 Unclassified 1532
82 Ga0070674_100458571 3300005356 Unclassified 1053
83 Ga0070674_100671268 3300005356 Unclassified 883
84 Ga0070673_100005331 3300005364 Bacteria 8210
85 Ga0070673_100005380 3300005364 Bacteria 8182
86 Ga0070673_100041029 3300005364 Bacteria 3554
87 Ga0070673_100058601 3300005364 Bacteria 3045
88 Ga0070673_100061220 3300005364 Bacteria 2986
89 Ga0070673_100107103 3300005364 Bacteria 2312
90 Ga0070673_100269605 3300005364 Bacteria 1489
91 Ga0070673_100542719 3300005364 Bacteria 1055
92 Ga0070673_100770985 3300005364 Bacteria 887
93 Ga0070688_100015922 3300005365 Bacteria 4288
94 Ga0070688_100078062 3300005365 Bacteria 2135
95 Ga0070688_100143865 3300005365 Bacteria 1623
96 Ga0070659_100056589 3300005366 Bacteria 3092
97 Ga0070659_100160483 3300005366 Bacteria 1838
98 Ga0070667_100008511 3300005367 Bacteria 8505
99 Ga0070667_100145274 3300005367 Unclassified 2080
100 Ga0070703_10136695 3300005406 Bacteria 906
101 Ga0070701_10053071 3300005438 Bacteria 2109
102 Ga0070701_10213041 3300005438 Unclassified 1148
103 Ga0070701_10322737 3300005438 Unclassified 956
104 Ga0070700_100006546 3300005441 Bacteria 6231
105 Ga0070700_100040351 3300005441 Bacteria 2856
106 Ga0070700_100192320 3300005441 Bacteria 1427
107 Ga0070700_100387809 3300005441 Bacteria 1047
108 Ga0070694_100198467 3300005444 Bacteria 1494
109 Ga0070694_101285768 3300005444 Bacteria 615
110 Ga0070663_100067841 3300005455 Bacteria 2589
111 Ga0070663_100359417 3300005455 Bacteria 1181
112 Ga0070678_100002418 3300005456 Bacteria 10229
113 Ga0070678_100116757 3300005456 Bacteria 2097
114 Ga0070678_100120593 3300005456 Bacteria 2067
115 Ga0070678_100227524 3300005456 Bacteria 1553
116 Ga0070678_100431331 3300005456 Bacteria 1151
117 Ga0070662_100171368 3300005457 Bacteria 1705
118 Ga0070662_100290512 3300005457 Bacteria 1325
119 Ga0068867_100005657 3300005459 Bacteria 8863
120 Ga0068867_100049711 3300005459 Bacteria 3087
121 Ga0068867_100089462 3300005459 Bacteria 2334
122 Ga0070685_10003652 3300005466 Bacteria 7805
123 Ga0070706_101132316 3300005467 Bacteria 720
124 Ga0070707_101712296 3300005468 Bacteria 596
125 Ga0070698_100493644 3300005471 Bacteria 1162
126 Ga0070699_100010424 3300005518 Bacteria 8044
127 Ga0070699_100384682 3300005518 Bacteria 1267
128 Ga0070699_100405400 3300005518 Bacteria 1233
129 Ga0070679_100624897 3300005530 Bacteria 1020
130 Ga0070697_100070893 3300005536 Bacteria 2858
131 Ga0070697_100789195 3300005536 Bacteria 840
132 Ga0070672_100043126 3300005543 Unclassified 3476
133 Ga0070672_100048076 3300005543 Bacteria 3313
134 Ga0070672_100083932 3300005543 Bacteria 2557
135 Ga0070672_100088957 3300005543 Bacteria 2487
136 Ga0070672_100147289 3300005543 Bacteria 1946
137 Ga0070672_100432042 3300005543 Bacteria 1132
138 Ga0070672_100822524 3300005543 Bacteria 818
139 Ga0070686_100002140 3300005544 Bacteria 10884
140 Ga0070686_100102268 3300005544 Bacteria 1938
141 Ga0070695_100404924 3300005545 Bacteria 1035
142 Ga0070696_100619570 3300005546 Bacteria 874
143 Ga0070665_100000936 3300005548 Bacteria 37365
144 Ga0070665_100499857 3300005548 Unclassified 1227
145 Ga0070704_100038367 3300005549 Bacteria 3281
146 Ga0070704_100102018 3300005549 Bacteria 2164
147 Ga0070704_100469227 3300005549 Bacteria 1087
148 Ga0070664_100008661 3300005564 Bacteria 8233
149 Ga0070664_100011840 3300005564 Bacteria 7081
150 Ga0070664_100018755 3300005564 Bacteria 5691
151 Ga0070664_100023467 3300005564 Bacteria 5096
152 Ga0070664_100646018 3300005564 Unclassified 983
153 Ga0068857_100137571 3300005577 Unclassified 2206
154 Ga0068857_100535873 3300005577 Bacteria 1102
155 Ga0068854_100240643 3300005578 Bacteria 1441
156 Ga0070702_100091704 3300005615 Bacteria 1844
157 Ga0070702_100268119 3300005615 Unclassified 1166
158 Ga0068852_100470248 3300005616 Bacteria 1248
159 Ga0068859_100032983 3300005617 Bacteria 5202
160 Ga0068859_100078453 3300005617 Bacteria 3343
161 Ga0068859_100079161 3300005617 Bacteria 3326
162 Ga0068859_100149357 3300005617 Bacteria 2412
163 Ga0068859_100296970 3300005617 Bacteria 1709
164 Ga0068859_100695037 3300005617 Unclassified 1108
165 Ga0068859_101519377 3300005617 Bacteria 739
166 Ga0068859_101946027 3300005617 Bacteria 649
167 Ga0068864_100034893 3300005618 Bacteria 4281
168 Ga0068864_100113074 3300005618 Bacteria 2420
169 Ga0068864_100149930 3300005618 Bacteria 2112
170 Ga0068864_100179373 3300005618 Bacteria 1935
171 Ga0068864_100577556 3300005618 Bacteria 1089
172 Ga0068866_10016871 3300005718 Bacteria 3274
173 Ga0068866_10020245 3300005718 Bacteria 3046
174 Ga0068866_10088854 3300005718 Bacteria 1678
175 Ga0068861_100001769 3300005719 Bacteria 13895
176 Ga0068861_100035452 3300005719 Bacteria 3695
177 Ga0068861_100114692 3300005719 Unclassified 2164
178 Ga0068861_100167128 3300005719 Bacteria 1820
179 Ga0068861_100339224 3300005719 Bacteria 1315
180 Ga0068861_100795250 3300005719 Bacteria 887
181 Ga0068870_10000294 3300005840 Bacteria 18487
182 Ga0068870_10014325 3300005840 Bacteria 3745
183 Ga0068870_10221415 3300005840 Bacteria 1158
184 Ga0068870_10286436 3300005840 Bacteria 1035
185 Ga0068863_100012272 3300005841 Bacteria 8273
186 Ga0068863_100457180 3300005841 Bacteria 1253
187 Ga0068858_100025311 3300005842 Bacteria 5522
188 Ga0068858_101183928 3300005842 Unclassified 751
189 Ga0068860_100010293 3300005843 Bacteria 9251
190 Ga0068860_100560539 3300005843 Unclassified 1145
191 Ga0068860_102075576 3300005843 Unclassified 590
192 Ga0068862_100004508 3300005844 Bacteria 11744
193 Ga0068862_100428228 3300005844 Bacteria 1243
194 Ga0068862_100458063 3300005844 Unclassified 1203
195 Ga0068862_100504247 3300005844 Unclassified 1149
196 Ga0068862_101315279 3300005844 Bacteria 724
197 Ga0068862_101574063 3300005844 Bacteria 664
198 Ga0081455_10018672 3300005937 Bacteria 6588
199 Ga0075364_10013924 3300006051 Bacteria 4957
200 Ga0075432_10151231 3300006058 Bacteria 892
201 Ga0097621_100020236 3300006237 Bacteria 5126
202 Ga0097621_102110613 3300006237 Bacteria 539
203 Ga0068871_101066518 3300006358 Unclassified 755
204 Ga0068871_101727700 3300006358 Bacteria 594
205 Ga0075428_100001914 3300006844 Bacteria 22338
206 Ga0075428_100003245 3300006844 Bacteria 17800
207 Ga0075428_100053787 3300006844 Bacteria 4412
208 Ga0075428_100055045 3300006844 Bacteria 4360
209 Ga0075428_100301188 3300006844 Bacteria 1723
210 Ga0075428_100375660 3300006844 Bacteria 1524
211 Ga0075428_100965784 3300006844 Unclassified 903
212 Ga0075430_100008097 3300006846 Bacteria 8884
213 Ga0075430_100008767 3300006846 Bacteria 8534
214 Ga0075430_100017358 3300006846 Bacteria 6130
215 Ga0075430_100185512 3300006846 Unclassified 1730
216 Ga0075431_100020297 3300006847 Bacteria 6787
217 Ga0075431_100050732 3300006847 Bacteria 4278
218 Ga0075431_100254018 3300006847 Bacteria 1785
219 Ga0075431_100338840 3300006847 Bacteria 1513
220 Ga0075433_10003776 3300006852 Bacteria 11725
221 Ga0075433_10012257 3300006852 Bacteria 6914
222 Ga0075433_10160450 3300006852 Bacteria 2001
223 Ga0075434_100002389 3300006871 Bacteria 16482
224 Ga0075434_100004765 3300006871 Bacteria 12281
225 Ga0075434_100193277 3300006871 Unclassified 2055
226 Ga0075434_100241783 3300006871 Unclassified 1825
227 Ga0075429_100014564 3300006880 Bacteria 6815
228 Ga0075429_100017259 3300006880 Bacteria 6242
229 Ga0075429_100063369 3300006880 Unclassified 3221
230 Ga0075429_100082120 3300006880 Bacteria 2809
231 Ga0075429_100132770 3300006880 Bacteria 2178
232 Ga0075429_100186601 3300006880 Bacteria 1817
233 Ga0068865_100005969 3300006881 Bacteria 7421
234 Ga0068865_100013650 3300006881 Bacteria 5142
235 Ga0068865_100085681 3300006881 Bacteria 2273
236 Ga0068865_101106331 3300006881 Unclassified 698
237 Ga0097620_100032982 3300006931 Bacteria 5202
238 Ga0097620_100078451 3300006931 Bacteria 3343
239 Ga0097620_100079160 3300006931 Bacteria 3326
240 Ga0097620_100149357 3300006931 Bacteria 2412
241 Ga0097620_100296976 3300006931 Bacteria 1709
242 Ga0097620_100695033 3300006931 Unclassified 1108
243 Ga0097620_101519209 3300006931 Bacteria 739
244 Ga0097620_101945913 3300006931 Bacteria 649
245 Ga0079104_1000107 3300006946 Bacteria 122549
246 Ga0079104_1000113 3300006946 Bacteria 116001
247 Ga0075435_100014136 3300007076 Bacteria 5957
248 Ga0075435_101224708 3300007076 Bacteria 657
249 Ga0105251_10000273 3300009011 Bacteria 51739
250 Ga0105251_10001705 3300009011 Bacteria 18401
251 Ga0105251_10006895 3300009011 Bacteria 7127
252 Ga0105251_10077069 3300009011 Bacteria 1546
253 Ga0105251_10157986 3300009011 Bacteria 1022
254 Ga0105244_10002761 3300009036 Bacteria 13093
255 Ga0105244_10002809 3300009036 Bacteria 12928
256 Ga0105250_10000057 3300009092 Bacteria 112440
257 Ga0111539_10000065 3300009094 Bacteria 106698
258 Ga0111539_10001128 3300009094 Bacteria 35328
259 Ga0111539_10003932 3300009094 Bacteria 19530
260 Ga0111539_10010451 3300009094 Bacteria 11682
261 Ga0111539_10029612 3300009094 Bacteria 6665
262 Ga0111539_10123724 3300009094 Bacteria 3032
263 Ga0111539_10128168 3300009094 Bacteria 2972
264 Ga0111539_10132048 3300009094 Bacteria 2924
265 Ga0111539_10454386 3300009094 Bacteria 1492
266 Ga0111539_11593827 3300009094 Unclassified 757
267 Ga0111539_13426845 3300009094 Unclassified 510
268 Ga0105245_10439202 3300009098 Bacteria 1311
269 Ga0105245_10530098 3300009098 Bacteria 1197
270 Ga0105247_10121777 3300009101 Bacteria 1691
271 Ga0105247_10715924 3300009101 Bacteria 755
272 Ga0114129_10007052 3300009147 Bacteria 15997
273 Ga0114129_10013734 3300009147 Bacteria 11544
274 Ga0114129_10069282 3300009147 Bacteria 4917
275 Ga0114129_10086513 3300009147 Bacteria 4347
276 Ga0114129_10904545 3300009147 Bacteria 1118
277 Ga0114129_10948927 3300009147 Bacteria 1087
278 Ga0105243_10368431 3300009148 Bacteria 1325
279 Ga0105243_10528754 3300009148 Bacteria 1123
280 Ga0105243_12261467 3300009148 Unclassified 581
281 Ga0105242_10089084 3300009176 Bacteria 2593
282 Ga0105242_10921389 3300009176 Bacteria 876
283 Ga0105248_10132152 3300009177 Bacteria 2816
284 Ga0105248_10175637 3300009177 Bacteria 2414
285 Ga0105237_11289279 3300009545 Bacteria 737
286 Ga0105238_10018652 3300009551 Bacteria 7064
287 Ga0105249_10001042 3300009553 Bacteria 24508
288 Ga0105249_10709088 3300009553 Unclassified 1067
289 Ga0099796_10018538 3300010159 Unclassified 2093
290 Ga0105246_10066755 3300011119 Bacteria 2519
291 Ga0105246_10728112 3300011119 Bacteria 872
292 Ga0157319_1020816 3300012497 Bacteria 635
293 Ga0157315_1007777 3300012508 Bacteria 879
294 Ga0157373_10281616 3300013100 Bacteria 1178
295 Ga0157371_10069695 3300013102 Bacteria 2490
296 Ga0157370_10004416 3300013104 Bacteria 16115
297 Ga0157374_10059837 3300013296 Bacteria 3563
298 Ga0157374_10069372 3300013296 Bacteria 3319
299 Ga0157374_10888260 3300013296 Bacteria 909
300 Ga0157378_10308181 3300013297 Bacteria 1535
301 Ga0157378_12666120 3300013297 Unclassified 552
302 Ga0163162_10003027 3300013306 Bacteria 16062
303 Ga0163162_10325311 3300013306 Unclassified 1670
304 Ga0163162_12864463 3300013306 Unclassified 555
305 Ga0157375_10025152 3300013308 Bacteria 5524
306 Ga0157375_10209635 3300013308 Bacteria 2106
307 Ga0157375_10286120 3300013308 Bacteria 1811
308 Ga0157375_10924287 3300013308 Bacteria 1015
309 Ga0157375_10983940 3300013308 Bacteria 984
310 Ga0157375_11216360 3300013308 Bacteria 884
311 Ga0157375_11736685 3300013308 Bacteria 739
312 Ga0163163_10029464 3300014325 Bacteria 5281
313 Ga0163163_10050630 3300014325 Bacteria 4090
314 Ga0163163_10377985 3300014325 Bacteria 1474
315 Ga0157380_10009450 3300014326 Bacteria 6986
316 Ga0157380_10045860 3300014326 Bacteria 3433
317 Ga0157380_10069366 3300014326 Bacteria 2844
318 Ga0157380_10074956 3300014326 Bacteria 2749
319 Ga0157380_10095697 3300014326 Unclassified 2461
320 Ga0157380_10110572 3300014326 Bacteria 2308
321 Ga0157380_10217281 3300014326 Bacteria 1708
322 Ga0157380_10427951 3300014326 Bacteria 1264
323 Ga0157380_11038230 3300014326 Bacteria 855
324 Ga0157380_11800383 3300014326 Bacteria 671
325 Ga0157377_10004519 3300014745 Bacteria 6421
326 Ga0157377_10044839 3300014745 Unclassified 2467
327 Ga0157377_10108759 3300014745 Bacteria 1663
328 Ga0157377_10123198 3300014745 Bacteria 1574
329 Ga0157377_10223128 3300014745 Unclassified 1208
330 Ga0157379_10003743 3300014968 Bacteria 12937
331 Ga0157379_10131137 3300014968 Bacteria 2256
332 Ga0157376_10705222 3300014969 Bacteria 1015
333 Ga0157376_11878163 3300014969 Bacteria 636
334 Ga0163161_10006354 3300017792 Bacteria 8176
335 Ga0213876_10383765 3300021384 Unclassified 747
336 Ga0207673_1030846 3300025290 Bacteria 742
337 Ga0207697_10000085 3300025315 Bacteria 41401
338 Ga0207697_10089054 3300025315 Bacteria 1307
339 Ga0207696_1000049 3300025711 Bacteria 281296
340 Ga0207655_1001063 3300025728 Bacteria 27348
341 Ga0207655_1006353 3300025728 Bacteria 7843
342 Ga0207713_1000105 3300025735 Bacteria 138195
343 Ga0207713_1000111 3300025735 Bacteria 133625
344 Ga0207713_1020893 3300025735 Bacteria 3154
345 Ga0207713_1098683 3300025735 Bacteria 1012
346 Ga0207713_1223296 3300025735 Bacteria 567
347 Ga0207653_10215231 3300025885 Bacteria 728
348 Ga0207653_10222722 3300025885 Bacteria 717
349 Ga0207682_10005915 3300025893 Bacteria 4950
350 Ga0207682_10021779 3300025893 Bacteria 2522
351 Ga0207682_10067630 3300025893 Bacteria 1508
352 Ga0207682_10174524 3300025893 Bacteria 979
353 Ga0207642_10038792 3300025899 Unclassified 2064
354 Ga0207710_10065406 3300025900 Bacteria 1657
355 Ga0207688_10000477 3300025901 Bacteria 19238
356 Ga0207688_10013379 3300025901 Bacteria 4457
357 Ga0207688_10129377 3300025901 Bacteria 1479
358 Ga0207688_10196070 3300025901 Bacteria 1209
359 Ga0207680_10067608 3300025903 Bacteria 2202
360 Ga0207680_10294839 3300025903 Bacteria 1129
361 Ga0207680_10365300 3300025903 Bacteria 1015
362 Ga0207647_10263199 3300025904 Bacteria 987
363 Ga0207645_10003970 3300025907 Bacteria 11042
364 Ga0207645_10051127 3300025907 Bacteria 2640
365 Ga0207645_10117354 3300025907 Bacteria 1726
366 Ga0207645_10435744 3300025907 Bacteria 884
367 Ga0207643_10000621 3300025908 Bacteria 22386
368 Ga0207643_10016413 3300025908 Bacteria 4040
369 Ga0207643_10062822 3300025908 Bacteria 2122
370 Ga0207643_10079881 3300025908 Bacteria 1894
371 Ga0207643_10170537 3300025908 Bacteria 1313
372 Ga0207662_10026171 3300025918 Bacteria 3364
373 Ga0207662_10090519 3300025918 Bacteria 1881
374 Ga0207662_10144691 3300025918 Bacteria 1508
375 Ga0207662_10158149 3300025918 Bacteria 1446
376 Ga0207649_10013216 3300025920 Bacteria 4607
377 Ga0207646_11312930 3300025922 Bacteria 631
378 Ga0207681_10010515 3300025923 Bacteria 5668
379 Ga0207681_10015267 3300025923 Bacteria 4788
380 Ga0207681_10056309 3300025923 Bacteria 2681
381 Ga0207681_10062868 3300025923 Bacteria 2558
382 Ga0207681_10146646 3300025923 Bacteria 1764
383 Ga0207681_10246435 3300025923 Bacteria 1393
384 Ga0207681_10294491 3300025923 Bacteria 1282
385 Ga0207681_10388804 3300025923 Bacteria 1124
386 Ga0207681_10509707 3300025923 Bacteria 986
387 Ga0207650_10013100 3300025925 Bacteria 5736
388 Ga0207650_10025991 3300025925 Bacteria 4173
389 Ga0207650_10042734 3300025925 Bacteria 3325
390 Ga0207659_10000692 3300025926 Bacteria 20033
391 Ga0207659_10002253 3300025926 Bacteria 11480
392 Ga0207659_10002334 3300025926 Bacteria 11293
393 Ga0207659_10005341 3300025926 Bacteria 7783
394 Ga0207659_10005376 3300025926 Bacteria 7758
395 Ga0207659_10009720 3300025926 Bacteria 6015
396 Ga0207659_10059269 3300025926 Bacteria 2751
397 Ga0207659_10614617 3300025926 Bacteria 927
398 Ga0207687_10524784 3300025927 Bacteria 991
399 Ga0207644_10023860 3300025931 Bacteria 4195
400 Ga0207644_10041012 3300025931 Bacteria 3273
401 Ga0207690_10929727 3300025932 Unclassified 722
402 Ga0207706_10020983 3300025933 Bacteria 5867
403 Ga0207706_10067256 3300025933 Bacteria 3152
404 Ga0207706_11007238 3300025933 Bacteria 700
405 Ga0207686_10008848 3300025934 Bacteria 5445
406 Ga0207709_10000279 3300025935 Bacteria 58969
407 Ga0207709_10107108 3300025935 Bacteria 1861
408 Ga0207709_11219072 3300025935 Unclassified 620
409 Ga0207670_10020894 3300025936 Bacteria 4030
410 Ga0207670_10102115 3300025936 Bacteria 2050
411 Ga0207670_10123319 3300025936 Unclassified 1887
412 Ga0207670_10402231 3300025936 Bacteria 1095
413 Ga0207669_10006212 3300025937 Bacteria 5439
414 Ga0207669_10023277 3300025937 Bacteria 3306
415 Ga0207669_10026241 3300025937 Bacteria 3165
416 Ga0207669_10703087 3300025937 Bacteria 831
417 Ga0207669_10937624 3300025937 Bacteria 725
418 Ga0207669_10941425 3300025937 Bacteria 723
419 Ga0207704_10033092 3300025938 Bacteria 2936
420 Ga0207691_10011647 3300025940 Bacteria 8443
421 Ga0207691_10013433 3300025940 Bacteria 7839
422 Ga0207691_10014601 3300025940 Bacteria 7486
423 Ga0207691_10024570 3300025940 Bacteria 5667
424 Ga0207691_10042244 3300025940 Bacteria 4204
425 Ga0207691_10128406 3300025940 Bacteria 2241
426 Ga0207691_10384175 3300025940 Bacteria 1198
427 Ga0207711_10524783 3300025941 Bacteria 1104
428 Ga0207689_10000730 3300025942 Bacteria 31588
429 Ga0207689_10001141 3300025942 Bacteria 25628
430 Ga0207689_10429191 3300025942 Unclassified 1103
431 Ga0207679_10060645 3300025945 Bacteria 2812
432 Ga0207679_10135080 3300025945 Unclassified 1985
433 Ga0207679_10201060 3300025945 Unclassified 1664
434 Ga0207679_10204814 3300025945 Bacteria 1650
435 Ga0207679_10445404 3300025945 Unclassified 1148
436 Ga0207651_10010034 3300025960 Bacteria 5224
437 Ga0207651_10019391 3300025960 Bacteria 4074
438 Ga0207651_10143677 3300025960 Bacteria 1847
439 Ga0207651_10155988 3300025960 Bacteria 1783
440 Ga0207651_10279215 3300025960 Bacteria 1379
441 Ga0207651_10296033 3300025960 Bacteria 1344
442 Ga0207651_10500287 3300025960 Unclassified 1050
443 Ga0207651_10737438 3300025960 Bacteria 870
444 Ga0207712_11172752 3300025961 Unclassified 685
445 Ga0207712_11298353 3300025961 Bacteria 650
446 Ga0207668_10071060 3300025972 Bacteria 2485
447 Ga0207668_10075524 3300025972 Bacteria 2423
448 Ga0207668_10273445 3300025972 Bacteria 1382
449 Ga0207668_11065095 3300025972 Bacteria 724
450 Ga0207658_10009526 3300025986 Bacteria 6594
451 Ga0207658_10137717 3300025986 Bacteria 1971
452 Ga0207677_10127989 3300026023 Bacteria 1922
453 Ga0207677_10254377 3300026023 Bacteria 1428
454 Ga0207677_10430273 3300026023 Bacteria 1126
455 Ga0207703_10130310 3300026035 Bacteria 2171
456 Ga0207703_10898755 3300026035 Unclassified 848
457 Ga0207678_10062622 3300026067 Bacteria 3197
458 Ga0207708_10004080 3300026075 Bacteria 10735
459 Ga0207708_10028056 3300026075 Bacteria 4263
460 Ga0207708_10102407 3300026075 Bacteria 2217
461 Ga0207708_10193451 3300026075 Bacteria 1620
462 Ga0207708_10325607 3300026075 Bacteria 1255
463 Ga0207641_10007106 3300026088 Bacteria 9351
464 Ga0207641_10437609 3300026088 Bacteria 1262
465 Ga0207641_11311625 3300026088 Bacteria 724
466 Ga0207648_10004031 3300026089 Bacteria 15246
467 Ga0207648_10017303 3300026089 Bacteria 6566
468 Ga0207648_10065561 3300026089 Bacteria 3166
469 Ga0207648_10239740 3300026089 Bacteria 1614
470 Ga0207676_10014347 3300026095 Bacteria 5699
471 Ga0207676_10052910 3300026095 Bacteria 3176
472 Ga0207676_10074447 3300026095 Bacteria 2736
473 Ga0207676_10118025 3300026095 Bacteria 2232
474 Ga0207674_10190798 3300026116 Bacteria 1999
475 Ga0207674_10260550 3300026116 Bacteria 1681
476 Ga0207674_10384615 3300026116 Unclassified 1357
477 Ga0207675_100011628 3300026118 Bacteria 8229
478 Ga0207675_100019821 3300026118 Bacteria 6277
479 Ga0207675_100063425 3300026118 Bacteria 3452
480 Ga0207675_100065951 3300026118 Bacteria 3383
481 Ga0207675_100230078 3300026118 Bacteria 1788
482 Ga0207683_10001698 3300026121 Bacteria 19704
483 Ga0207683_10045500 3300026121 Bacteria 3838
484 Ga0207683_10065930 3300026121 Bacteria 3192
485 Ga0207683_10344897 3300026121 Bacteria 1366
486 Ga0207683_10590181 3300026121 Unclassified 1028
487 Ga0207698_10067048 3300026142 Bacteria 2829
488 Ga0209281_1000121 3300027111 Bacteria 205883
489 Ga0209281_1000220 3300027111 Bacteria 122558
490 Ga0209371_1000046 3300027312 Bacteria 306549
491 Ga0209995_1043435 3300027471 Bacteria 760
492 Ga0209983_1021183 3300027665 Bacteria 1358
493 Ga0209974_10034958 3300027876 Unclassified 1668
494 Ga0207428_10000345 3300027907 Bacteria 60424
495 Ga0207428_10000936 3300027907 Bacteria 32455
496 Ga0207428_10001419 3300027907 Bacteria 25210
497 Ga0207428_10021344 3300027907 Bacteria 5484
498 Ga0207428_10198661 3300027907 Bacteria 1509
499 Ga0207428_10208783 3300027907 Unclassified 1468
500 Ga0207428_10445993 3300027907 Bacteria 944
501 Ga0207428_10825286 3300027907 Unclassified 658
502 Ga0268266_10000179 3300028379 Bacteria 112622
503 Ga0268266_10128409 3300028379 Bacteria 2265
504 Ga0268265_10020045 3300028380 Bacteria 4660
505 Ga0268265_10370622 3300028380 Bacteria 1314
506 Ga0268265_10390580 3300028380 Bacteria 1283
507 Ga0268265_10405794 3300028380 Unclassified 1261
508 Ga0268265_10636131 3300028380 Unclassified 1024
509 Ga0268265_11168192 3300028380 Bacteria 766
510 Ga0268264_10034170 3300028381 Bacteria 4181
511 Ga0268264_10086550 3300028381 Bacteria 2692
512 Ga0268264_11251891 3300028381 Unclassified 752
513 Ga0268264_11504774 3300028381 Unclassified 684
514 Ga0268256_1000012 3300030500 Bacteria 794553
515 Ga0265316_10005214 3300031344 Bacteria 12709
516 Ga0307408_100043399 3300031548 Bacteria 3199
517 Ga0316576_10522118 3300031727 Bacteria 872
518 Ga0307405_10007377 3300031731 Bacteria 5493
519 Ga0307405_10062237 3300031731 Bacteria 2362
520 Ga0307413_10000281 3300031824 Bacteria 15624
521 Ga0307413_10003677 3300031824 Bacteria 6515
522 Ga0307410_10001116 3300031852 Bacteria 11737
523 Ga0307410_10037158 3300031852 Bacteria 3178
524 Ga0307410_10602543 3300031852 Unclassified 916
525 Ga0307406_10025196 3300031901 Bacteria 3559
526 Ga0307407_10000476 3300031903 Bacteria 12313
527 Ga0307407_10003129 3300031903 Bacteria 6698
528 Ga0307412_11372604 3300031911 Bacteria 638
529 Ga0307412_12024752 3300031911 Bacteria 533
530 Ga0307409_100034031 3300031995 Bacteria 3716
531 Ga0307409_100533910 3300031995 Bacteria 1148
532 Ga0307409_102521853 3300031995 Unclassified 543
533 Ga0307416_100005491 3300032002 Bacteria 7790
534 Ga0307416_100515664 3300032002 Unclassified 1263
535 Ga0307414_10005544 3300032004 Bacteria 6960
536 Ga0307414_10274610 3300032004 Bacteria 1413
537 Ga0307414_10438564 3300032004 Unclassified 1143
538 Ga0307414_11478359 3300032004 Bacteria 632
539 Ga0307411_10004778 3300032005 Bacteria 6559
540 Ga0307411_10038452 3300032005 Bacteria 3018
541 Ga0307411_10058683 3300032005 Bacteria 2548
542 Ga0307411_10082164 3300032005 Bacteria 2221
543 Ga0307411_11240261 3300032005 Bacteria 677
544 Ga0307415_100053252 3300032126 Bacteria 2756
545 Ga0307415_100230738 3300032126 Bacteria 1490
546 Ga0316583_10016559 3300032133 Bacteria 2653
547 Ga0373958_0000446 3300034819 Bacteria 5048
548 Ga0373959_0081535 3300034820 Bacteria 746
549 Ga0373940_0021496 3300035088 Bacteria 1649
550 Ga0373941_0063958 3300035115 Bacteria 1204
551 Ga0316574_0154085 3300035398 Bacteria 1481
552 Ga0436365_0951881 3300039437 Unclassified 1591
553 Ga0436365_1565946 3300039437 Bacteria 4038
554 Ga0439450_047153 3300042008 Bacteria 1015
555 Ga0439452_000127 3300042010 Bacteria 58547
556 Ga0450923_100480 3300042125 Bacteria 667
557 Ga0450890_011237 3300042127 Bacteria 1155
558 Ga0439446_0124927 3300042156 Bacteria 831
559 Ga0439435_0016335 3300042436 Unclassified 1860
560 Ga0439444_0034805 3300042437 Bacteria 963
561 Ga0439464_0000268 3300042439 Bacteria 9702
562 Ga0439464_0035573 3300042439 Bacteria 1407
563 Ga0450918_034876 3300042531 Bacteria 894
564 Ga0439440_0133066 3300042993 Bacteria 701
565 Ga0466963_0026723 3300044694 Bacteria 3693
566 Ga0466964_0093290 3300044706 Bacteria 1314
567 Ga0466957_0095199 3300044842 Bacteria 1870
568 Ga0451576_0039560 3300045051 Bacteria 4991
569 Ga0466967_0484594 3300045976 Bacteria 1212
570 Ga0495650_0012587 3300046471 Bacteria 4541
571 Ga0495580_0702650 3300046472 Bacteria 662
572 Ga0495598_0010801 3300046537 Bacteria 2197
573 Ga0495621_0164547 3300046539 Bacteria 879
574 Ga0495658_0872520 3300046683 Unclassified 575
575 Ga0495671_0035129 3300046692 Bacteria 2547
576 Ga0495679_031093 3300047446 Bacteria 1725
577 Ga0496104_0056842 3300048907 Bacteria 3702
578 Ga0496105_0183214 3300048908 Bacteria 1714
579 Ga0496108_0267844 3300048911 Bacteria 1487
580 Ga0496109_0119298 3300048912 Bacteria 2456
581 Ga0496110_0474136 3300048913 Bacteria 1140
582 Ga0496112_0725412 3300048915 Unclassified 921
583 Ga0496113_0155747 3300048916 Bacteria 1804
584 Ga0496116_0000854 3300048919 Bacteria 38099
585 Ga0496116_0286995 3300048919 Bacteria 793
586 Ga0496116_0421600 3300048919 Bacteria 582
587 Ga0496117_0014636 3300048920 Bacteria 6746
588 Ga0496117_0019737 3300048920 Bacteria 5523
589 Ga0496117_0091762 3300048920 Bacteria 1952
590 Ga0496117_0092891 3300048920 Bacteria 1937
591 Ga0496118_0014184 3300048921 Bacteria 7473
592 Ga0496118_0027919 3300048921 Bacteria 4766
593 Ga0496119_0001986 3300048922 Bacteria 23211
594 Ga0496119_0003423 3300048922 Bacteria 16479
595 Ga0496119_0004874 3300048922 Bacteria 13139
596 Ga0496119_0039265 3300048922 Bacteria 3043
597 Ga0496120_0001616 3300048923 Bacteria 26133
598 Ga0496120_0001967 3300048923 Bacteria 22449
599 Ga0496120_0010047 3300048923 Bacteria 6644
600 Ga0496120_0030080 3300048923 Bacteria 3306
601 Ga0496121_0055686 3300048924 Bacteria 3292
602 Ga0496121_0333953 3300048924 Bacteria 1015
603 Ga0496122_0000726 3300048925 Bacteria 64443
604 Ga0496122_0014742 3300048925 Bacteria 7536
605 Ga0496122_0064596 3300048925 Bacteria 2661
606 Ga0496122_0380652 3300048925 Bacteria 724
607 Ga0496123_0000371 3300048926 Bacteria 84281
608 Ga0496123_0018262 3300048926 Bacteria 5585
609 Ga0496123_0078233 3300048926 Bacteria 2027
610 Ga0496124_0132695 3300048927 Bacteria 1976
611 Ga0496124_0173426 3300048927 Bacteria 1667
612 Ga0496124_0335135 3300048927 Bacteria 1077
613 Ga0496125_0002592 3300048928 Bacteria 23222
614 Ga0496125_0035821 3300048928 Bacteria 4345
615 Ga0496126_0002346 3300048929 Bacteria 25880
616 Ga0496126_0023911 3300048929 Bacteria 5908
617 Ga0496126_0069617 3300048929 Bacteria 3138
618 Ga0496126_0282821 3300048929 Bacteria 1373
619 Ga0496126_0466698 3300048929 Bacteria 1014
620 Ga0496126_0475067 3300048929 Bacteria 1002
621 Ga0501031_0433610 3300049568 Bacteria 849
622 Ga0501032_0336641 3300049569 Bacteria 973
623 Ga0501038_0082234 3300049574 Bacteria 2712
624 Ga0501040_0054284 3300049576 Bacteria 2747
625 Ga0501041_0241320 3300049577 Unclassified 1136
626 Ga0501041_0612176 3300049577 Bacteria 695
627 Ga0501042_0036839 3300049578 Bacteria 3471
628 Ga0501043_0304440 3300049579 Bacteria 1217
629 Ga0501046_0039552 3300049580 Bacteria 3776
630 Ga0501048_0067007 3300049582 Bacteria 2538
631 Ga0501071_0132168 3300049587 Bacteria 1855
632 Ga0501072_0089143 3300049588 Bacteria 2448
633 Ga0501074_0103590 3300049590 Bacteria 2037
634 Ga0501074_1309443 3300049590 Bacteria 508
635 Ga0501075_0009791 3300049591 Bacteria 6717
636 Ga0501075_0242918 3300049591 Bacteria 1373
637 Ga0501075_0378828 3300049591 Bacteria 1079
638 Ga0501075_0922201 3300049591 Bacteria 664
639 Ga0501076_0058919 3300049592 Bacteria 3054
640 Ga0501076_0797822 3300049592 Bacteria 779
641 Ga0501077_0015193 3300049593 Bacteria 4843
642 Ga0501077_0472641 3300049593 Bacteria 803
643 Ga0501202_009257 3300049652 Unclassified 1808
644 Ga0501209_183744 3300049656 Bacteria 639
645 Ga0501230_029022 3300049667 Bacteria 1020
646 Ga0501246_048480 3300049676 Unclassified 526
647 Ga0501247_034864 3300049677 Bacteria 701
648 Ga0501258_022530 3300049687 Unclassified 750
649 Ga0501079_1475745 3300049741 Unclassified 535
650 Ga0501081_0001556 3300049743 Bacteria 14107
651 Ga0501283_135030 3300049779 Unclassified 503
652 Ga0501035_0180313 3300049822 Bacteria 1820
653 nmdc:mga05p37_102700_c1 3300050507 Bacteria 3520
654 nmdc:mga05p37_12086_c1 3300050507 Bacteria 10305
655 nmdc:mga05p37_1218360_c1 3300050507 Unclassified 776
656 nmdc:mga05p37_248276_c1 3300050507 Bacteria 2136
657 nmdc:mga05p37_253725_c1 3300050507 Bacteria 2108
658 nmdc:mga05p37_406774_c1 3300050507 Bacteria 1588
659 nmdc:mga05p37_49819_c1 3300050507 Bacteria 5151
660 nmdc:mga05p37_65850_c1 3300050507 Bacteria 4457
661 nmdc:mga09592_104658_c1 3300050508 Bacteria 2425
662 nmdc:mga09592_126849_c1 3300050508 Unclassified 2194
663 nmdc:mga09592_269428_c1 3300050508 Bacteria 1477
664 nmdc:mga09592_2939_c1 3300050508 Bacteria 13808
665 nmdc:mga09592_3519_c1 3300050508 Bacteria 12655
666 nmdc:mga09592_435821_c1 3300050508 Unclassified 1131
667 nmdc:mga09592_491204_c1 3300050508 Bacteria 1057
668 nmdc:mga09592_55672_c1 3300050508 Bacteria 3342
669 nmdc:mga09592_67022_c1 3300050508 Bacteria 3044
670 nmdc:mga0qj67_258809_c1 3300050509 Bacteria 1412
671 nmdc:mga0qj67_293166_c1 3300050509 Bacteria 1318
672 nmdc:mga0qj67_33112_c1 3300050509 Bacteria 4032
673 nmdc:mga0qj67_3596_c1 3300050509 Bacteria 11187
674 nmdc:mga0qj67_43434_c1 3300050509 Bacteria 3540
675 nmdc:mga0qj67_67785_c1 3300050509 Unclassified 2843
676 nmdc:mga06r32_1265990_c1 3300050510 Bacteria 682
677 nmdc:mga06r32_180607_c1 3300050510 Bacteria 2096
678 nmdc:mga06r32_23370_c1 3300050510 Bacteria 5718
679 nmdc:mga06r32_596059_c1 3300050510 Bacteria 1076
680 nmdc:mga06r32_88268_c1 3300050510 Archaea 3027
681 nmdc:mga06r32_98953_c2 3300050510 Bacteria 1483
682 nmdc:mga08y16_1091333_c1 3300050511 Bacteria 774
683 nmdc:mga08y16_1706_c1 3300050511 Bacteria 22281
684 nmdc:mga08y16_22565_c1 3300050511 Bacteria 6646
685 nmdc:mga08y16_325461_c1 3300050511 Bacteria 1582
686 nmdc:mga08y16_3381_c1 3300050511 Bacteria 16532
687 nmdc:mga08y16_365845_c1 3300050511 Bacteria 1480
688 nmdc:mga08y16_381231_c1 3300050511 Unclassified 1095
689 nmdc:mga08y16_655_c1 3300050511 Bacteria 32531
690 nmdc:mga08y16_73712_c1 3300050511 Unclassified 3557
691 nmdc:mga0n895_21708_c1 3300050512 Bacteria 6008
692 nmdc:mga0n895_6535_c1 3300050512 Bacteria 9921
693 nmdc:mga0rr50_1036980_c1 3300050513 Bacteria 698
694 nmdc:mga0rr50_28569_c1 3300050513 Bacteria 3922
695 nmdc:mga0a205_1056_c1 3300050515 Bacteria 22922
696 nmdc:mga0a205_3281_c1 3300050515 Bacteria 14393
697 nmdc:mga0a205_577_c1 3300050515 Bacteria 29054
698 nmdc:mga0a205_60114_c1 3300050515 Bacteria 3670
699 Ga0495619_0552465 3300053085 Unclassified 790
700 Ga0501084_0051977 3300054114 Bacteria 3429
701 Ga0501084_1243032 3300054114 Bacteria 625
702 Ga0530510_0668847 3300061734 Bacteria 791
703 2555261640 2554235234 Bacteria 5762085
704 2601535543 2600255256 Bacteria 5597742
705 2601541580 2600255257 Bacteria 5597196
706 2601759870 2600255310 Bacteria 5600903
707 2601762338 2600255311 Bacteria 5598766
708 2603640911 2602042046 Bacteria 5483348
709 2671105671 2667528172 Bacteria 5170840
710 2671586716 2671180115 Bacteria 5353919
711 2723602020 2721755693 Bacteria 6126117
712 2730138092 2728369359 Bacteria 5621728
713 2753812430 2751185905 Bacteria 6142767
714 2765587108 2765235842 Bacteria 4799256
715 2813731015 2811995292 Bacteria 5303342
716 2814698638 2814123068 Bacteria 5687681
717 2823378335 2823373977 Bacteria 4779415
718 2889278094 2889276214 Bacteria 5979355
719 2908671146 2908669403 Bacteria 5740494
720 2919113192 2919108558 Bacteria 5897419
721 2971826097 2971820967 Bacteria 5823634
722 2974314014 2974310843 Bacteria 4947816
723 2996712652 2996706504 Bacteria 5757485
724 3006973354 3006969106 Bacteria 4739423
725 8018405566 8018405270 Bacteria 4978981
726 8055094725 8055092621 Bacteria 4873875
727 Ga0070677_10001704
728 RicEn_C7209
729 JGI24746J21847_1004962
730 JGI24750J21931_1031514
731 JGI24748J21848_1024759
732 Ga0058692_1010703
733 Ga0065714_10153851
734 Ga0065712_10006027
735 Ga0065712_10083231
736 Ga0065712_10139486
737 Ga0065712_10230042
738 Ga0065715_10003216
739 Ga0065715_10091582
740 Ga0065715_10357900
741 Ga0065707_10262348
742 Ga0065707_10587687
743 Ga0070676_10001803
744 Ga0070676_10011233
745 Ga0070676_10029452
746 Ga0070683_100153201
747 Ga0070683_100460795
748 Ga0070690_100013980
749 Ga0070690_100015578
750 Ga0070690_100307723
751 Ga0070670_100018731
752 Ga0070670_100021290
753 Ga0070670_100118295
754 Ga0070670_100763984
755 Ga0070677_10016661
756 Ga0070677_10019971
757 Ga0070677_10070904
758 Ga0070677_10447767
759 Ga0070677_10456214
760 Ga0068869_100001451
761 Ga0068869_100074093
762 Ga0070666_10038935
763 Ga0070666_10602350
764 Ga0070666_10777080
765 Ga0070666_11074445
766 Ga0068868_100100155
767 Ga0068868_100139496
768 Ga0070689_100065087
769 Ga0070689_100077049
770 Ga0070689_100107321
771 Ga0070689_101234337
772 Ga0070691_10096726
773 Ga0070687_100022049
774 Ga0070687_100135038
775 Ga0070661_100028138
776 Ga0070661_100038268
777 Ga0070661_100269055
778 Ga0070692_10047812
779 Ga0070668_100007025
780 Ga0070668_100149585
781 Ga0070668_100538501
782 Ga0070669_100017527
783 Ga0070669_100019575
784 Ga0070669_100031277
785 Ga0070669_100079044
786 Ga0070669_100102313
787 Ga0070669_100162736
788 Ga0070669_100181322
789 Ga0070669_100230981
790 Ga0070669_100612755
791 Ga0070675_100001179
792 Ga0070675_100001525
793 Ga0070675_100001605
794 Ga0070675_100002993
795 Ga0070675_100006002
796 Ga0070675_100041401
797 Ga0070675_100084418
798 Ga0070675_100093838
799 Ga0070675_100537906
800 Ga0070675_100556280
801 Ga0070675_101164549
802 Ga0070671_100014421
803 Ga0070671_100027688
804 Ga0070671_100838867
805 Ga0070674_100001218
806 Ga0070674_100023270
807 Ga0070674_100203049
808 Ga0070674_100458571
809 Ga0070674_100671268
810 Ga0070673_100005331
811 Ga0070673_100005380
812 Ga0070673_100041029
813 Ga0070673_100058601
814 Ga0070673_100061220
815 Ga0070673_100107103
816 Ga0070673_100269605
817 Ga0070673_100542719
818 Ga0070673_100770985
819 Ga0070688_100015922
820 Ga0070688_100078062
821 Ga0070688_100143865
822 Ga0070659_100056589
823 Ga0070659_100160483
824 Ga0070667_100008511
825 Ga0070667_100145274
826 Ga0070703_10136695
827 Ga0070701_10053071
828 Ga0070701_10213041
829 Ga0070701_10322737
830 Ga0070700_100006546
831 Ga0070700_100040351
832 Ga0070700_100192320
833 Ga0070700_100387809
834 Ga0070694_100198467
835 Ga0070694_101285768
836 Ga0070663_100067841
837 Ga0070663_100359417
838 Ga0070678_100002418
839 Ga0070678_100116757
840 Ga0070678_100120593
841 Ga0070678_100227524
842 Ga0070678_100431331
843 Ga0070662_100171368
844 Ga0070662_100290512
845 Ga0068867_100005657
846 Ga0068867_100049711
847 Ga0068867_100089462
848 Ga0070685_10003652
849 Ga0070706_101132316
850 Ga0070707_101712296
851 Ga0070698_100493644
852 Ga0070699_100010424
853 Ga0070699_100384682
854 Ga0070699_100405400
855 Ga0070679_100624897
856 Ga0070697_100070893
857 Ga0070697_100789195
858 Ga0070672_100043126
859 Ga0070672_100048076
860 Ga0070672_100083932
861 Ga0070672_100088957
862 Ga0070672_100147289
863 Ga0070672_100432042
864 Ga0070672_100822524
865 Ga0070686_100002140
866 Ga0070686_100102268
867 Ga0070695_100404924
868 Ga0070696_100619570
869 Ga0070665_100000936
870 Ga0070665_100499857
871 Ga0070704_100038367
872 Ga0070704_100102018
873 Ga0070704_100469227
874 Ga0070664_100008661
875 Ga0070664_100011840
876 Ga0070664_100018755
877 Ga0070664_100023467
878 Ga0070664_100646018
879 Ga0068857_100137571
880 Ga0068857_100535873
881 Ga0068854_100240643
882 Ga0070702_100091704
883 Ga0070702_100268119
884 Ga0068852_100470248
885 Ga0068859_100032983
886 Ga0068859_100078453
887 Ga0068859_100079161
888 Ga0068859_100149357
889 Ga0068859_100296970
890 Ga0068859_100695037
891 Ga0068859_101519377
892 Ga0068859_101946027
893 Ga0068864_100034893
894 Ga0068864_100113074
895 Ga0068864_100149930
896 Ga0068864_100179373
897 Ga0068864_100577556
898 Ga0068866_10016871
899 Ga0068866_10020245
900 Ga0068866_10088854
901 Ga0068861_100001769
902 Ga0068861_100035452
903 Ga0068861_100114692
904 Ga0068861_100167128
905 Ga0068861_100339224
906 Ga0068861_100795250
907 Ga0068870_10000294
908 Ga0068870_10014325
909 Ga0068870_10221415
910 Ga0068870_10286436
911 Ga0068863_100012272
912 Ga0068863_100457180
913 Ga0068858_100025311
914 Ga0068858_101183928
915 Ga0068860_100010293
916 Ga0068860_100560539
917 Ga0068860_102075576
918 Ga0068862_100004508
919 Ga0068862_100428228
920 Ga0068862_100458063
921 Ga0068862_100504247
922 Ga0068862_101315279
923 Ga0068862_101574063
924 Ga0081455_10018672
925 Ga0075364_10013924
926 Ga0075432_10151231
927 Ga0097621_100020236
928 Ga0097621_102110613
929 Ga0068871_101066518
930 Ga0068871_101727700
931 Ga0075428_100001914
932 Ga0075428_100003245
933 Ga0075428_100053787
934 Ga0075428_100055045
935 Ga0075428_100301188
936 Ga0075428_100375660
937 Ga0075428_100965784
938 Ga0075430_100008097
939 Ga0075430_100008767
940 Ga0075430_100017358
941 Ga0075430_100185512
942 Ga0075431_100020297
943 Ga0075431_100050732
944 Ga0075431_100254018
945 Ga0075431_100338840
946 Ga0075433_10003776
947 Ga0075433_10012257
948 Ga0075433_10160450
949 Ga0075434_100002389
950 Ga0075434_100004765
951 Ga0075434_100193277
952 Ga0075434_100241783
953 Ga0075429_100014564
954 Ga0075429_100017259
955 Ga0075429_100063369
956 Ga0075429_100082120
957 Ga0075429_100132770
958 Ga0075429_100186601
959 Ga0068865_100005969
960 Ga0068865_100013650
961 Ga0068865_100085681
962 Ga0068865_101106331
963 Ga0097620_100032982
964 Ga0097620_100078451
965 Ga0097620_100079160
966 Ga0097620_100149357
967 Ga0097620_100296976
968 Ga0097620_100695033
969 Ga0097620_101519209
970 Ga0097620_101945913
971 Ga0079104_1000107
972 Ga0079104_1000113
973 Ga0075435_100014136
974 Ga0075435_101224708
975 Ga0105251_10000273
976 Ga0105251_10001705
977 Ga0105251_10006895
978 Ga0105251_10077069
979 Ga0105251_10157986
980 Ga0105244_10002761
981 Ga0105244_10002809
982 Ga0105250_10000057
983 Ga0111539_10000065
984 Ga0111539_10001128
985 Ga0111539_10003932
986 Ga0111539_10010451
987 Ga0111539_10029612
988 Ga0111539_10123724
989 Ga0111539_10128168
990 Ga0111539_10132048
991 Ga0111539_10454386
992 Ga0111539_11593827
993 Ga0111539_13426845
994 Ga0105245_10439202
995 Ga0105245_10530098
996 Ga0105247_10121777
997 Ga0105247_10715924
998 Ga0114129_10007052
999 Ga0114129_10013734
1000 Ga0114129_10069282
1001 Ga0114129_10086513
1002 Ga0114129_10904545
1003 Ga0114129_10948927
1004 Ga0105243_10368431
1005 Ga0105243_10528754
1006 Ga0105243_12261467
1007 Ga0105242_10089084
1008 Ga0105242_10921389
1009 Ga0105248_10132152
1010 Ga0105248_10175637
1011 Ga0105237_11289279
1012 Ga0105238_10018652
1013 Ga0105249_10001042
1014 Ga0105249_10709088
1015 Ga0099796_10018538
1016 Ga0105246_10066755
1017 Ga0105246_10728112
1018 Ga0157319_1020816
1019 Ga0157315_1007777
1020 Ga0157373_10281616
1021 Ga0157371_10069695
1022 Ga0157370_10004416
1023 Ga0157374_10059837
1024 Ga0157374_10069372
1025 Ga0157374_10888260
1026 Ga0157378_10308181
1027 Ga0157378_12666120
1028 Ga0163162_10003027
1029 Ga0163162_10325311
1030 Ga0163162_12864463
1031 Ga0157375_10025152
1032 Ga0157375_10209635
1033 Ga0157375_10286120
1034 Ga0157375_10924287
1035 Ga0157375_10983940
1036 Ga0157375_11216360
1037 Ga0157375_11736685
1038 Ga0163163_10029464
1039 Ga0163163_10050630
1040 Ga0163163_10377985
1041 Ga0157380_10009450
1042 Ga0157380_10045860
1043 Ga0157380_10069366
1044 Ga0157380_10074956
1045 Ga0157380_10095697
1046 Ga0157380_10110572
1047 Ga0157380_10217281
1048 Ga0157380_10427951
1049 Ga0157380_11038230
1050 Ga0157380_11800383
1051 Ga0157377_10004519
1052 Ga0157377_10044839
1053 Ga0157377_10108759
1054 Ga0157377_10123198
1055 Ga0157377_10223128
1056 Ga0157379_10003743
1057 Ga0157379_10131137
1058 Ga0157376_10705222
1059 Ga0157376_11878163
1060 Ga0163161_10006354
1061 Ga0213876_10383765
1062 Ga0207673_1030846
1063 Ga0207697_10000085
1064 Ga0207697_10089054
1065 Ga0207696_1000049
1066 Ga0207655_1001063
1067 Ga0207655_1006353
1068 Ga0207713_1000105
1069 Ga0207713_1000111
1070 Ga0207713_1020893
1071 Ga0207713_1098683
1072 Ga0207713_1223296
1073 Ga0207653_10215231
1074 Ga0207653_10222722
1075 Ga0207682_10005915
1076 Ga0207682_10021779
1077 Ga0207682_10067630
1078 Ga0207682_10174524
1079 Ga0207642_10038792
1080 Ga0207710_10065406
1081 Ga0207688_10000477
1082 Ga0207688_10013379
1083 Ga0207688_10129377
1084 Ga0207688_10196070
1085 Ga0207680_10067608
1086 Ga0207680_10294839
1087 Ga0207680_10365300
1088 Ga0207647_10263199
1089 Ga0207645_10003970
1090 Ga0207645_10051127
1091 Ga0207645_10117354
1092 Ga0207645_10435744
1093 Ga0207643_10000621
1094 Ga0207643_10016413
1095 Ga0207643_10062822
1096 Ga0207643_10079881
1097 Ga0207643_10170537
1098 Ga0207662_10026171
1099 Ga0207662_10090519
1100 Ga0207662_10144691
1101 Ga0207662_10158149
1102 Ga0207649_10013216
1103 Ga0207646_11312930
1104 Ga0207681_10010515
1105 Ga0207681_10015267
1106 Ga0207681_10056309
1107 Ga0207681_10062868
1108 Ga0207681_10146646
1109 Ga0207681_10246435
1110 Ga0207681_10294491
1111 Ga0207681_10388804
1112 Ga0207681_10509707
1113 Ga0207650_10013100
1114 Ga0207650_10025991
1115 Ga0207650_10042734
1116 Ga0207659_10000692
1117 Ga0207659_10002253
1118 Ga0207659_10002334
1119 Ga0207659_10005341
1120 Ga0207659_10005376
1121 Ga0207659_10009720
1122 Ga0207659_10059269
1123 Ga0207659_10614617
1124 Ga0207687_10524784
1125 Ga0207644_10023860
1126 Ga0207644_10041012
1127 Ga0207690_10929727
1128 Ga0207706_10020983
1129 Ga0207706_10067256
1130 Ga0207706_11007238
1131 Ga0207686_10008848
1132 Ga0207709_10000279
1133 Ga0207709_10107108
1134 Ga0207709_11219072
1135 Ga0207670_10020894
1136 Ga0207670_10102115
1137 Ga0207670_10123319
1138 Ga0207670_10402231
1139 Ga0207669_10006212
1140 Ga0207669_10023277
1141 Ga0207669_10026241
1142 Ga0207669_10703087
1143 Ga0207669_10937624
1144 Ga0207669_10941425
1145 Ga0207704_10033092
1146 Ga0207691_10011647
1147 Ga0207691_10013433
1148 Ga0207691_10014601
1149 Ga0207691_10024570
1150 Ga0207691_10042244
1151 Ga0207691_10128406
1152 Ga0207691_10384175
1153 Ga0207711_10524783
1154 Ga0207689_10000730
1155 Ga0207689_10001141
1156 Ga0207689_10429191
1157 Ga0207679_10060645
1158 Ga0207679_10135080
1159 Ga0207679_10201060
1160 Ga0207679_10204814
1161 Ga0207679_10445404
1162 Ga0207651_10010034
1163 Ga0207651_10019391
1164 Ga0207651_10143677
1165 Ga0207651_10155988
1166 Ga0207651_10279215
1167 Ga0207651_10296033
1168 Ga0207651_10500287
1169 Ga0207651_10737438
1170 Ga0207712_11172752
1171 Ga0207712_11298353
1172 Ga0207668_10071060
1173 Ga0207668_10075524
1174 Ga0207668_10273445
1175 Ga0207668_11065095
1176 Ga0207658_10009526
1177 Ga0207658_10137717
1178 Ga0207677_10127989
1179 Ga0207677_10254377
1180 Ga0207677_10430273
1181 Ga0207703_10130310
1182 Ga0207703_10898755
1183 Ga0207678_10062622
1184 Ga0207708_10004080
1185 Ga0207708_10028056
1186 Ga0207708_10102407
1187 Ga0207708_10193451
1188 Ga0207708_10325607
1189 Ga0207641_10007106
1190 Ga0207641_10437609
1191 Ga0207641_11311625
1192 Ga0207648_10004031
1193 Ga0207648_10017303
1194 Ga0207648_10065561
1195 Ga0207648_10239740
1196 Ga0207676_10014347
1197 Ga0207676_10052910
1198 Ga0207676_10074447
1199 Ga0207676_10118025
1200 Ga0207674_10190798
1201 Ga0207674_10260550
1202 Ga0207674_10384615
1203 Ga0207675_100011628
1204 Ga0207675_100019821
1205 Ga0207675_100063425
1206 Ga0207675_100065951
1207 Ga0207675_100230078
1208 Ga0207683_10001698
1209 Ga0207683_10045500
1210 Ga0207683_10065930
1211 Ga0207683_10344897
1212 Ga0207683_10590181
1213 Ga0207698_10067048
1214 Ga0209281_1000121
1215 Ga0209281_1000220
1216 Ga0209371_1000046
1217 Ga0209995_1043435
1218 Ga0209983_1021183
1219 Ga0209974_10034958
1220 Ga0207428_10000345
1221 Ga0207428_10000936
1222 Ga0207428_10001419
1223 Ga0207428_10021344
1224 Ga0207428_10198661
1225 Ga0207428_10208783
1226 Ga0207428_10445993
1227 Ga0207428_10825286
1228 Ga0268266_10000179
1229 Ga0268266_10128409
1230 Ga0268265_10020045
1231 Ga0268265_10370622
1232 Ga0268265_10390580
1233 Ga0268265_10405794
1234 Ga0268265_10636131
1235 Ga0268265_11168192
1236 Ga0268264_10034170
1237 Ga0268264_10086550
1238 Ga0268264_11251891
1239 Ga0268264_11504774
1240 Ga0268256_1000012
1241 Ga0265316_10005214
1242 Ga0307408_100043399
1243 Ga0316576_10522118
1244 Ga0307405_10007377
1245 Ga0307405_10062237
1246 Ga0307413_10000281
1247 Ga0307413_10003677
1248 Ga0307410_10001116
1249 Ga0307410_10037158
1250 Ga0307410_10602543
1251 Ga0307406_10025196
1252 Ga0307407_10000476
1253 Ga0307407_10003129
1254 Ga0307412_11372604
1255 Ga0307412_12024752
1256 Ga0307409_100034031
1257 Ga0307409_100533910
1258 Ga0307409_102521853
1259 Ga0307416_100005491
1260 Ga0307416_100515664
1261 Ga0307414_10005544
1262 Ga0307414_10274610
1263 Ga0307414_10438564
1264 Ga0307414_11478359
1265 Ga0307411_10004778
1266 Ga0307411_10038452
1267 Ga0307411_10058683
1268 Ga0307411_10082164
1269 Ga0307411_11240261
1270 Ga0307415_100053252
1271 Ga0307415_100230738
1272 Ga0316583_10016559
1273 Ga0373958_0000446
1274 Ga0373959_0081535
1275 Ga0373940_0021496
1276 Ga0373941_0063958
1277 Ga0316574_0154085
1278 Ga0436365_0951881
1279 Ga0436365_1565946
1280 Ga0439450_047153
1281 Ga0439452_000127
1282 Ga0450923_100480
1283 Ga0450890_011237
1284 Ga0439446_0124927
1285 Ga0439435_0016335
1286 Ga0439444_0034805
1287 Ga0439464_0000268
1288 Ga0439464_0035573
1289 Ga0450918_034876
1290 Ga0439440_0133066
1291 Ga0466963_0026723
1292 Ga0466964_0093290
1293 Ga0466957_0095199
1294 Ga0451576_0039560
1295 Ga0466967_0484594
1296 Ga0495650_0012587
1297 Ga0495580_0702650
1298 Ga0495598_0010801
1299 Ga0495621_0164547
1300 Ga0495658_0872520
1301 Ga0495671_0035129
1302 Ga0495679_031093
1303 Ga0496104_0056842
1304 Ga0496105_0183214
1305 Ga0496108_0267844
1306 Ga0496109_0119298
1307 Ga0496110_0474136
1308 Ga0496112_0725412
1309 Ga0496113_0155747
1310 Ga0496116_0000854
1311 Ga0496116_0286995
1312 Ga0496116_0421600
1313 Ga0496117_0014636
1314 Ga0496117_0019737
1315 Ga0496117_0091762
1316 Ga0496117_0092891
1317 Ga0496118_0014184
1318 Ga0496118_0027919
1319 Ga0496119_0001986
1320 Ga0496119_0003423
1321 Ga0496119_0004874
1322 Ga0496119_0039265
1323 Ga0496120_0001616
1324 Ga0496120_0001967
1325 Ga0496120_0010047
1326 Ga0496120_0030080
1327 Ga0496121_0055686
1328 Ga0496121_0333953
1329 Ga0496122_0000726
1330 Ga0496122_0014742
1331 Ga0496122_0064596
1332 Ga0496122_0380652
1333 Ga0496123_0000371
1334 Ga0496123_0018262
1335 Ga0496123_0078233
1336 Ga0496124_0132695
1337 Ga0496124_0173426
1338 Ga0496124_0335135
1339 Ga0496125_0002592
1340 Ga0496125_0035821
1341 Ga0496126_0002346
1342 Ga0496126_0023911
1343 Ga0496126_0069617
1344 Ga0496126_0282821
1345 Ga0496126_0466698
1346 Ga0496126_0475067
1347 Ga0501031_0433610
1348 Ga0501032_0336641
1349 Ga0501038_0082234
1350 Ga0501040_0054284
1351 Ga0501041_0241320
1352 Ga0501041_0612176
1353 Ga0501042_0036839
1354 Ga0501043_0304440
1355 Ga0501046_0039552
1356 Ga0501048_0067007
1357 Ga0501071_0132168
1358 Ga0501072_0089143
1359 Ga0501074_0103590
1360 Ga0501074_1309443
1361 Ga0501075_0009791
1362 Ga0501075_0242918
1363 Ga0501075_0378828
1364 Ga0501075_0922201
1365 Ga0501076_0058919
1366 Ga0501076_0797822
1367 Ga0501077_0015193
1368 Ga0501077_0472641
1369 Ga0501202_009257
1370 Ga0501209_183744
1371 Ga0501230_029022
1372 Ga0501246_048480
1373 Ga0501247_034864
1374 Ga0501258_022530
1375 Ga0501079_1475745
1376 Ga0501081_0001556
1377 Ga0501283_135030
1378 Ga0501035_0180313
1379 nmdc:mga05p37_102700_c1
1380 nmdc:mga05p37_12086_c1
1381 nmdc:mga05p37_1218360_c1
1382 nmdc:mga05p37_248276_c1
1383 nmdc:mga05p37_253725_c1
1384 nmdc:mga05p37_406774_c1
1385 nmdc:mga05p37_49819_c1
1386 nmdc:mga05p37_65850_c1
1387 nmdc:mga09592_104658_c1
1388 nmdc:mga09592_126849_c1
1389 nmdc:mga09592_269428_c1
1390 nmdc:mga09592_2939_c1
1391 nmdc:mga09592_3519_c1
1392 nmdc:mga09592_435821_c1
1393 nmdc:mga09592_491204_c1
1394 nmdc:mga09592_55672_c1
1395 nmdc:mga09592_67022_c1
1396 nmdc:mga0qj67_258809_c1
1397 nmdc:mga0qj67_293166_c1
1398 nmdc:mga0qj67_33112_c1
1399 nmdc:mga0qj67_3596_c1
1400 nmdc:mga0qj67_43434_c1
1401 nmdc:mga0qj67_67785_c1
1402 nmdc:mga06r32_1265990_c1
1403 nmdc:mga06r32_180607_c1
1404 nmdc:mga06r32_23370_c1
1405 nmdc:mga06r32_596059_c1
1406 nmdc:mga06r32_88268_c1
1407 nmdc:mga06r32_98953_c2
1408 nmdc:mga08y16_1091333_c1
1409 nmdc:mga08y16_1706_c1
1410 nmdc:mga08y16_22565_c1
1411 nmdc:mga08y16_325461_c1
1412 nmdc:mga08y16_3381_c1
1413 nmdc:mga08y16_365845_c1
1414 nmdc:mga08y16_381231_c1
1415 nmdc:mga08y16_655_c1
1416 nmdc:mga08y16_73712_c1
1417 nmdc:mga0n895_21708_c1
1418 nmdc:mga0n895_6535_c1
1419 nmdc:mga0rr50_1036980_c1
1420 nmdc:mga0rr50_28569_c1
1421 nmdc:mga0a205_1056_c1
1422 nmdc:mga0a205_3281_c1
1423 nmdc:mga0a205_577_c1
1424 nmdc:mga0a205_60114_c1
1425 Ga0495619_0552465
1426 Ga0501084_0051977
1427 Ga0501084_1243032
1428 Ga0530510_0668847
1429 2555261640
1430 2601535543
1431 2601541580
1432 2601759870
1433 2601762338
1434 2603640911
1435 2671105671
1436 2671586716
1437 2723602020
1438 2730138092
1439 2753812430
1440 2765587108
1441 2813731015
1442 2814698638
1443 2823378335
1444 2889278094
1445 2908671146
1446 2919113192
1447 2971826097
1448 2974314014
1449 2996712652
1450 3006973354
1451 8018405566
1452 8055094725

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02502

LacAB_rpiB

Ribose/Galactose Isomerase

28

166

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ph4-assembly1.cif.gz_A clostridium thermocellum ribose-5-phosphate isomerase b with d-allose 0.993 3 146
2vvr-assembly1.cif.gz_A crystal structure of the h99n mutant of ribose-5-phosphate isomerase b from e. coli soaked with ribose 5-phosphate 0.9922 1 147
1nn4-assembly1.cif.gz_A structural genomics, rpib/alsb 0.9917 1 146
2vvr-assembly1.cif.gz_A crystal structure of the h99n mutant of ribose-5-phosphate isomerase b from e. coli soaked with ribose 5-phosphate 0.9856 1 147
1o1x-assembly1.cif.gz_A crystal structure of a ribose 5-phosphate isomerase rpib (tm1080) from thermotoga maritima at 1.90 a resolution 0.9785 2 143
ID Description Score Start End Superfamily
1nn4D00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9918 1 147 3.40.1400.10
1o1xA00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9753 2 143 3.40.1400.10
3s5pB00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9695 2 130 3.40.1400.10
6fxsA00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9644 1 144 3.40.1400.10
4lfkB00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9599 3 149 3.40.1400.10
ID Description Score Start End GO Terms
AF-A0A2W4MLN9-F1-model_v4 Ribose 5-phosphate isomerase B 0.9976 3 145 GO:0004725
GO:0005975
GO:0016861
AF-A0A835KZ10-F1-model_v4 Ribose-5-phosphate isomerase 0.9975 3 145 GO:0005975
GO:0016857
AF-A0A3M2AKR7-F1-model_v4 Ribose 5-phosphate isomerase B (EC 5.3.1.6) 0.9963 3 145 GO:0004751
GO:0005975
AF-A0A1G0SL72-F1-model_v4 Ribose 5-phosphate isomerase B 0.996 3 145 GO:0004751
GO:0009052
GO:0019316
AF-D1AKE7-F1-model_v4 Sugar-phosphate isomerase, RpiB/LacA/LacB family (EC 5.3.1.26) 0.9959 3 143 GO:0004751
GO:0009052
GO:0019316
GO:0050044

Map