F477641

General Info

Members Datasets Scaffolds Average Seq Length
725 343 691 253

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0037887|Ga0501034_0037887_3952_4785
Length 277
Sequence MTTELDQADQAASAEAAVLVHDESRVRTLTLNRPDALNACNEALYDALTNGLLEAAADPGIAVVLLTGAGRAFCAGTDLVEMAARVMDPDNFVEGEHGFLGLIDALTAFPKPLVIAVNGLGLGIGATILGFADLVFMSTEAKLKCPFTSLAVAPEAASSLLFPQLIGRQNATWMLLSSEWISAAEAKEMGLVWKLTEPDELLPAARQHAEHLAALPISSLVACKRVITEPLRTQIEAARQRENDAFVELLGSPANLEAFAAFAEGRKPNFVDLPGGD

Samples

Sample ID Description Type Environment
1 2643221576 Nocardioides sp. Root614 Isolate Unclassified
2 2643221590 Nocardioides sp. Root682 Isolate Unclassified
3 2643221604 Nocardioides sp. Root190 Isolate Unclassified
4 2643221615 Nocardioides sp. Root224 Isolate Unclassified
5 2643221617 Nocardioides sp. Root79 Isolate Unclassified
6 2643221620 Nocardioides sp. Root240 Isolate Unclassified
7 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
8 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
9 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
10 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
11 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
12 2738541305 Nocardioides sp. CF167 Isolate Unclassified
13 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
14 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
15 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
16 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
17 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
18 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
19 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
20 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
21 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
22 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
23 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
24 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
25 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
26 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
27 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
28 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
29 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
30 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
31 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
32 2932398195 Dietzia sp. 2505 Isolate Rhizosphere
33 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
34 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
35 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
36 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
37 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
38 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
39 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
40 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
41 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
42 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
43 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
44 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
45 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
46 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
47 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
48 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
49 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
50 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
51 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
52 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
53 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
54 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
55 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
56 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
57 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
58 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
59 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
60 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
61 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
62 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
63 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
64 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
65 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
66 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
67 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
68 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
69 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
70 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
71 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
72 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
73 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
74 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
75 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
76 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
77 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
78 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
79 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
80 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
81 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
82 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
83 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
84 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
85 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
86 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
87 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
88 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
89 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
90 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
91 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
92 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
93 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
94 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
95 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
96 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
97 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
98 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
99 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
100 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
101 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
102 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
103 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
104 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
105 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
106 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
107 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
108 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
109 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
110 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
111 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
112 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
113 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
114 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
115 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
116 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
117 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
118 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
119 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
120 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
121 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
122 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
123 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
124 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
125 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
126 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
127 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
128 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
129 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
130 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
131 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
132 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
133 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
134 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
135 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
136 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
137 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
138 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
139 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
140 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
141 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
142 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
143 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
144 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
145 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
146 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
199 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
203 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
204 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
205 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
206 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
207 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
208 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
209 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
210 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
211 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
212 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
213 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
214 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
215 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
216 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
217 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
218 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
219 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
220 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
221 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
222 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
223 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
224 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
225 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
226 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
227 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
228 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
229 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
230 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
231 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
232 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
233 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
234 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
235 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
236 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
237 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
238 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
239 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
240 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
241 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
242 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
243 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
244 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
245 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
246 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
247 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
248 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
249 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
250 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
251 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
252 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
253 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
254 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
255 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
256 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
257 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
258 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
259 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
260 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
261 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
262 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
263 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
264 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
265 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
266 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
267 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
268 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
269 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
270 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
271 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
272 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
273 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
274 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
275 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
276 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
277 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
278 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
279 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
280 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
281 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
282 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
283 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
284 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
285 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
286 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
287 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
288 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
289 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
290 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
291 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
292 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
293 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
294 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
295 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
296 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
297 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
298 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
299 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
300 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
301 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
307 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
311 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
313 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
314 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
315 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
316 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
317 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
318 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
320 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
321 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
322 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
323 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
324 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
325 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
326 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
327 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
328 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
329 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
330 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
331 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
332 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
333 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
334 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
335 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
336 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
337 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
338 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
339 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
340 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
341 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
342 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
343 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.31
Metatranscriptomes 0
Isolates 4.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.28
Nodule 0.14
Rhizoplane 9.52
Rhizosphere 63.03
Stem 0
Stem Tuber 0
Unclassified 11.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10034751 3300001990 Bacteria 1562
2 JGI24743J22301_10002277 3300001991 Bacteria 2858
3 JGI24748J21848_1004168 3300002074 Bacteria 1655
4 JGI24744J21845_10000053 3300002077 Bacteria 13445
5 JGI24034J26672_10012446 3300002239 Bacteria 1282
6 JGI24742J22300_10001182 3300002244 Bacteria 4071
7 rootH2_10144049 3300003320 Bacteria 3070
8 rootL2_10131486 3300003322 Bacteria 2487
9 Ga0055540_1000024 3300003792 Bacteria 199164
10 Ga0055540_1001685 3300003792 Bacteria 12748
11 Ga0055540_1003063 3300003792 Bacteria 8324
12 Ga0055540_1011186 3300003792 Bacteria 2916
13 Ga0070658_10013421 3300005327 Bacteria 6573
14 Ga0070658_10043009 3300005327 Bacteria 3650
15 Ga0070658_10067970 3300005327 Bacteria 2912
16 Ga0070683_100129173 3300005329 Bacteria 2390
17 Ga0070690_100001292 3300005330 Bacteria 13002
18 Ga0070670_100409606 3300005331 Bacteria 1198
19 Ga0068869_100012633 3300005334 Bacteria 5586
20 Ga0070666_10459069 3300005335 Bacteria 920
21 Ga0070682_100001916 3300005337 Bacteria 11610
22 Ga0070682_100010417 3300005337 Bacteria 5275
23 Ga0070682_100070943 3300005337 Bacteria 2228
24 Ga0068868_100009639 3300005338 Bacteria 6966
25 Ga0068868_100183131 3300005338 Bacteria 1739
26 Ga0070660_100029280 3300005339 Bacteria 4126
27 Ga0070689_100018207 3300005340 Bacteria 5171
28 Ga0070691_10001466 3300005341 Bacteria 10121
29 Ga0070692_10160066 3300005345 Bacteria 1289
30 Ga0070668_100000358 3300005347 Bacteria 30164
31 Ga0070668_100018368 3300005347 Bacteria 5250
32 Ga0070668_100065415 3300005347 Bacteria 2820
33 Ga0070668_100136161 3300005347 Bacteria 1976
34 Ga0070669_100001662 3300005353 Bacteria 16093
35 Ga0070669_100008249 3300005353 Bacteria 7439
36 Ga0070671_100110992 3300005355 Bacteria 2304
37 Ga0070671_100160681 3300005355 Bacteria 1899
38 Ga0070671_100289776 3300005355 Bacteria 1393
39 Ga0070674_100003807 3300005356 Bacteria 8528
40 Ga0070688_100002128 3300005365 Bacteria 9979
41 Ga0070688_100027921 3300005365 Bacteria 3363
42 Ga0070659_100239859 3300005366 Bacteria 1500
43 Ga0070667_100000075 3300005367 Bacteria 120953
44 Ga0070667_100004048 3300005367 Bacteria 12396
45 Ga0070667_100010253 3300005367 Bacteria 7743
46 Ga0070667_100012854 3300005367 Bacteria 6917
47 Ga0070709_10005095 3300005434 Bacteria 7102
48 Ga0070709_10046065 3300005434 Bacteria 2710
49 Ga0070714_100350055 3300005435 Bacteria 1387
50 Ga0070714_100695337 3300005435 Bacteria 981
51 Ga0070713_100019364 3300005436 Bacteria 5194
52 Ga0070713_100350786 3300005436 Bacteria 1369
53 Ga0070710_10001540 3300005437 Bacteria 10899
54 Ga0070710_10235616 3300005437 Bacteria 1170
55 Ga0070711_100001591 3300005439 Bacteria 12506
56 Ga0070711_100063796 3300005439 Bacteria 2572
57 Ga0070700_100014110 3300005441 Bacteria 4507
58 Ga0070700_100022565 3300005441 Bacteria 3673
59 Ga0070694_100018714 3300005444 Bacteria 4399
60 Ga0070694_100061073 3300005444 Bacteria 2572
61 Ga0070663_100002640 3300005455 Bacteria 10142
62 Ga0070663_100576858 3300005455 Bacteria 943
63 Ga0070678_100001197 3300005456 Bacteria 13803
64 Ga0070662_100010769 3300005457 Bacteria 6019
65 Ga0070662_100297193 3300005457 Bacteria 1311
66 Ga0068867_100006287 3300005459 Bacteria 8400
67 Ga0070685_10057771 3300005466 Bacteria 2259
68 Ga0070685_10131527 3300005466 Bacteria 1565
69 Ga0068853_100064641 3300005539 Bacteria 3173
70 Ga0068853_100066553 3300005539 Bacteria 3129
71 Ga0070672_100459220 3300005543 Bacteria 1098
72 Ga0070686_100279959 3300005544 Bacteria 1230
73 Ga0070695_100040554 3300005545 Bacteria 2948
74 Ga0070696_100003435 3300005546 Bacteria 10555
75 Ga0070696_100127567 3300005546 Bacteria 1847
76 Ga0070693_100032667 3300005547 Bacteria 2864
77 Ga0070665_100005474 3300005548 Bacteria 13089
78 Ga0070665_100006380 3300005548 Bacteria 12021
79 Ga0070665_100259269 3300005548 Bacteria 1740
80 Ga0070665_100319577 3300005548 Bacteria 1557
81 Ga0070704_100000391 3300005549 Bacteria 20083
82 Ga0070704_100036324 3300005549 Bacteria 3357
83 Ga0068855_100113289 3300005563 Bacteria 3111
84 Ga0068855_100146922 3300005563 Bacteria 2683
85 Ga0068854_100071073 3300005578 Bacteria 2545
86 Ga0068856_100019507 3300005614 Bacteria 6580
87 Ga0068856_100112546 3300005614 Bacteria 2720
88 Ga0070702_100001144 3300005615 Bacteria 10661
89 Ga0070702_100498725 3300005615 Bacteria 893
90 Ga0068852_100056443 3300005616 Bacteria 3394
91 Ga0068859_100000606 3300005617 Bacteria 35852
92 Ga0068859_100003251 3300005617 Bacteria 16545
93 Ga0068864_100046674 3300005618 Bacteria 3718
94 Ga0068866_10069786 3300005718 Bacteria 1852
95 Ga0068861_100337538 3300005719 Bacteria 1318
96 Ga0068863_100002748 3300005841 Bacteria 17410
97 Ga0068863_100051087 3300005841 Bacteria 3919
98 Ga0068858_100001109 3300005842 Bacteria 27859
99 Ga0068858_100106992 3300005842 Bacteria 2610
100 Ga0068860_100000025 3300005843 Bacteria 271553
101 Ga0068860_100000334 3300005843 Bacteria 63958
102 Ga0068860_100012429 3300005843 Bacteria 8385
103 Ga0068862_100000045 3300005844 Bacteria 155641
104 Ga0068862_100001869 3300005844 Bacteria 19086
105 Ga0068862_100186010 3300005844 Bacteria 1866
106 Ga0068862_100340792 3300005844 Bacteria 1388
107 Ga0081455_10093207 3300005937 Bacteria 2435
108 Ga0081538_10043770 3300005981 Bacteria 2804
109 Ga0070717_10406360 3300006028 Bacteria 1224
110 Ga0075365_10016378 3300006038 Bacteria 4508
111 Ga0075365_10028768 3300006038 Bacteria 3546
112 Ga0075365_10031758 3300006038 Bacteria 3389
113 Ga0075365_10035069 3300006038 Bacteria 3244
114 Ga0075365_10065345 3300006038 Bacteria 2438
115 Ga0075365_10111706 3300006038 Bacteria 1878
116 Ga0075365_10166821 3300006038 Bacteria 1536
117 Ga0075365_10345155 3300006038 Bacteria 1049
118 Ga0075368_10001245 3300006042 Bacteria 8051
119 Ga0075368_10010130 3300006042 Bacteria 3405
120 Ga0075368_10019871 3300006042 Bacteria 2539
121 Ga0075368_10031817 3300006042 Bacteria 2047
122 Ga0075363_100000597 3300006048 Bacteria 11919
123 Ga0075363_100009537 3300006048 Bacteria 4565
124 Ga0075363_100010009 3300006048 Bacteria 4480
125 Ga0075363_100025439 3300006048 Bacteria 3019
126 Ga0075363_100157541 3300006048 Bacteria 1284
127 Ga0075363_100281014 3300006048 Bacteria 963
128 Ga0075364_10004332 3300006051 Bacteria 8139
129 Ga0075364_10004468 3300006051 Bacteria 8052
130 Ga0075364_10005507 3300006051 Bacteria 7366
131 Ga0075364_10020193 3300006051 Bacteria 4189
132 Ga0075364_10052991 3300006051 Bacteria 2652
133 Ga0075364_10265141 3300006051 Bacteria 1168
134 Ga0075364_10362964 3300006051 Bacteria 987
135 Ga0070715_10030963 3300006163 Bacteria 2168
136 Ga0070715_10095474 3300006163 Bacteria 1377
137 Ga0070716_100001115 3300006173 Bacteria 11831
138 Ga0070716_100013982 3300006173 Bacteria 4104
139 Ga0070712_100313096 3300006175 Bacteria 1274
140 Ga0075362_10008504 3300006177 Bacteria 3927
141 Ga0075362_10013469 3300006177 Bacteria 3274
142 Ga0075367_10009955 3300006178 Bacteria 4982
143 Ga0075367_10015484 3300006178 Bacteria 4147
144 Ga0075367_10039158 3300006178 Bacteria 2763
145 Ga0075367_10066186 3300006178 Bacteria 2165
146 Ga0075367_10102484 3300006178 Bacteria 1751
147 Ga0075367_10389158 3300006178 Bacteria 881
148 Ga0075369_10004473 3300006186 Bacteria 5168
149 Ga0075369_10013887 3300006186 Bacteria 3207
150 Ga0075369_10054417 3300006186 Bacteria 1737
151 Ga0097621_100054694 3300006237 Bacteria 3256
152 Ga0075370_10002478 3300006353 Bacteria 8558
153 Ga0075370_10003387 3300006353 Bacteria 7575
154 Ga0075370_10022644 3300006353 Bacteria 3453
155 Ga0075370_10075269 3300006353 Bacteria 1935
156 Ga0075370_10077069 3300006353 Bacteria 1913
157 Ga0075370_10170448 3300006353 Bacteria 1279
158 Ga0068871_100205001 3300006358 Bacteria 1704
159 Ga0075428_100004846 3300006844 Bacteria 14930
160 Ga0075430_100077655 3300006846 Bacteria 2783
161 Ga0075431_100009857 3300006847 Bacteria 9591
162 Ga0075429_100156557 3300006880 Bacteria 1995
163 Ga0097620_100000606 3300006931 Bacteria 35852
164 Ga0097620_100003251 3300006931 Bacteria 16545
165 Ga0099795_10007788 3300007788 Bacteria 3016
166 Ga0105250_10151479 3300009092 Bacteria 965
167 Ga0105245_10002903 3300009098 Bacteria 15381
168 Ga0105245_10010872 3300009098 Bacteria 7919
169 Ga0105245_10211953 3300009098 Bacteria 1865
170 Ga0105245_10260707 3300009098 Bacteria 1687
171 Ga0105245_10831686 3300009098 Bacteria 962
172 Ga0105247_10000010 3300009101 Bacteria 302475
173 Ga0105247_10000366 3300009101 Bacteria 38409
174 Ga0114129_10005689 3300009147 Bacteria 17652
175 Ga0105243_10001450 3300009148 Bacteria 20829
176 Ga0105243_10060285 3300009148 Bacteria 3031
177 Ga0105243_10147680 3300009148 Bacteria 2013
178 Ga0105242_10004714 3300009176 Bacteria 10558
179 Ga0105248_10000145 3300009177 Bacteria 81917
180 Ga0105248_10002194 3300009177 Bacteria 21610
181 Ga0105248_10152352 3300009177 Bacteria 2609
182 Ga0105248_10169093 3300009177 Bacteria 2464
183 Ga0105237_10001648 3300009545 Bacteria 28966
184 Ga0105237_10025835 3300009545 Bacteria 6004
185 Ga0105237_10115873 3300009545 Bacteria 2673
186 Ga0105238_10344128 3300009551 Bacteria 1479
187 Ga0105249_10000010 3300009553 Bacteria 306939
188 Ga0105249_10039645 3300009553 Bacteria 4277
189 Ga0105249_10767213 3300009553 Bacteria 1027
190 Ga0099796_10009296 3300010159 Bacteria 2655
191 Ga0105239_10014541 3300010375 Bacteria 8731
192 Ga0105239_10020241 3300010375 Bacteria 7341
193 Ga0105239_10152069 3300010375 Bacteria 2583
194 Ga0105239_10772287 3300010375 Bacteria 1100
195 Ga0105246_10070009 3300011119 Bacteria 2466
196 Ga0157369_10128021 3300013105 Bacteria 2691
197 Ga0157369_10253713 3300013105 Bacteria 1835
198 Ga0157374_10124344 3300013296 Bacteria 2492
199 Ga0157378_10001442 3300013297 Bacteria 21432
200 Ga0157378_10169980 3300013297 Bacteria 2044
201 Ga0163162_10002768 3300013306 Bacteria 16649
202 Ga0163162_10078462 3300013306 Bacteria 3368
203 Ga0163162_10121125 3300013306 Bacteria 2721
204 Ga0157372_10009077 3300013307 Bacteria 10565
205 Ga0157375_10001272 3300013308 Bacteria 21812
206 Ga0157375_10018997 3300013308 Bacteria 6240
207 Ga0157375_10064643 3300013308 Bacteria 3643
208 Ga0163163_10238755 3300014325 Bacteria 1867
209 Ga0157380_10000302 3300014326 Bacteria 29666
210 Ga0157377_10064134 3300014745 Bacteria 2106
211 Ga0157377_10119012 3300014745 Bacteria 1598
212 Ga0157379_10002729 3300014968 Bacteria 14887
213 Ga0157379_10520261 3300014968 Bacteria 1104
214 Ga0157376_10388622 3300014969 Bacteria 1346
215 Ga0163161_10000799 3300017792 Bacteria 24668
216 Ga0213876_10003078 3300021384 Bacteria 9655
217 Ga0213876_10003966 3300021384 Bacteria 8351
218 Ga0213876_10061787 3300021384 Bacteria 1977
219 Ga0213875_10014036 3300021388 Bacteria 3917
220 Ga0213875_10111691 3300021388 Bacteria 1276
221 Ga0209673_1013423 3300025273 Bacteria 3233
222 Ga0209673_1037922 3300025273 Bacteria 1410
223 Ga0209051_1000021 3300025303 Bacteria 507633
224 Ga0209051_1000613 3300025303 Bacteria 41149
225 Ga0209051_1004881 3300025303 Bacteria 8038
226 Ga0209051_1017466 3300025303 Bacteria 3205
227 Ga0209051_1021120 3300025303 Bacteria 2783
228 Ga0209051_1033181 3300025303 Bacteria 1956
229 Ga0207682_10044059 3300025893 Bacteria 1828
230 Ga0207642_10000143 3300025899 Bacteria 20251
231 Ga0207642_10011054 3300025899 Bacteria 3206
232 Ga0207710_10000028 3300025900 Bacteria 304525
233 Ga0207710_10001961 3300025900 Bacteria 9831
234 Ga0207688_10000090 3300025901 Bacteria 35199
235 Ga0207680_10007483 3300025903 Bacteria 5328
236 Ga0207680_10027001 3300025903 Bacteria 3190
237 Ga0207647_10076037 3300025904 Bacteria 2020
238 Ga0207685_10005331 3300025905 Bacteria 3383
239 Ga0207699_10012071 3300025906 Bacteria 4386
240 Ga0207645_10027091 3300025907 Bacteria 3703
241 Ga0207705_10052540 3300025909 Bacteria 2934
242 Ga0207705_10105220 3300025909 Bacteria 2080
243 Ga0207654_10146511 3300025911 Bacteria 1511
244 Ga0207671_10007464 3300025914 Bacteria 9484
245 Ga0207671_10012164 3300025914 Bacteria 6942
246 Ga0207671_10225188 3300025914 Bacteria 1470
247 Ga0207671_10256277 3300025914 Bacteria 1376
248 Ga0207693_10000555 3300025915 Bacteria 33777
249 Ga0207693_10002064 3300025915 Bacteria 17553
250 Ga0207663_10002170 3300025916 Bacteria 9368
251 Ga0207663_10016673 3300025916 Bacteria 4080
252 Ga0207657_10023644 3300025919 Bacteria 5716
253 Ga0207657_10182161 3300025919 Bacteria 1698
254 Ga0207681_10006072 3300025923 Bacteria 7406
255 Ga0207681_10202684 3300025923 Bacteria 1524
256 Ga0207681_10363242 3300025923 Bacteria 1162
257 Ga0207694_10177770 3300025924 Bacteria 1725
258 Ga0207687_10118500 3300025927 Bacteria 1976
259 Ga0207687_10290244 3300025927 Bacteria 1314
260 Ga0207700_10059241 3300025928 Bacteria 2896
261 Ga0207664_10455722 3300025929 Bacteria 1142
262 Ga0207664_10495376 3300025929 Bacteria 1094
263 Ga0207644_10100117 3300025931 Bacteria 2176
264 Ga0207644_10117672 3300025931 Bacteria 2018
265 Ga0207690_10066555 3300025932 Bacteria 2468
266 Ga0207690_10090838 3300025932 Bacteria 2157
267 Ga0207706_10005251 3300025933 Bacteria 12080
268 Ga0207706_10016540 3300025933 Bacteria 6658
269 Ga0207686_10001099 3300025934 Bacteria 15816
270 Ga0207686_10006362 3300025934 Bacteria 6354
271 Ga0207709_10002258 3300025935 Bacteria 12252
272 Ga0207709_10020594 3300025935 Bacteria 3724
273 Ga0207709_10258903 3300025935 Bacteria 1275
274 Ga0207670_10029755 3300025936 Bacteria 3482
275 Ga0207669_10000752 3300025937 Bacteria 13994
276 Ga0207669_10135546 3300025937 Bacteria 1700
277 Ga0207704_10000393 3300025938 Bacteria 19943
278 Ga0207704_10292331 3300025938 Bacteria 1244
279 Ga0207665_10001801 3300025939 Bacteria 14436
280 Ga0207665_10003000 3300025939 Bacteria 11326
281 Ga0207691_10092066 3300025940 Bacteria 2715
282 Ga0207711_10000069 3300025941 Bacteria 115038
283 Ga0207711_10019795 3300025941 Bacteria 5609
284 Ga0207689_10022958 3300025942 Bacteria 5240
285 Ga0207661_10096794 3300025944 Bacteria 2470
286 Ga0207667_10065977 3300025949 Bacteria 3774
287 Ga0207667_10168052 3300025949 Bacteria 2254
288 Ga0207712_10000016 3300025961 Bacteria 343014
289 Ga0207668_10005693 3300025972 Bacteria 7338
290 Ga0207668_10011820 3300025972 Bacteria 5321
291 Ga0207640_10036129 3300025981 Bacteria 3099
292 Ga0207640_10085728 3300025981 Bacteria 2166
293 Ga0207658_10000237 3300025986 Bacteria 58047
294 Ga0207658_10002082 3300025986 Bacteria 14885
295 Ga0207658_10006768 3300025986 Bacteria 7806
296 Ga0207658_10191143 3300025986 Bacteria 1702
297 Ga0207677_10003455 3300026023 Bacteria 8370
298 Ga0207677_10105422 3300026023 Bacteria 2086
299 Ga0207703_10044415 3300026035 Bacteria 3571
300 Ga0207703_10054887 3300026035 Bacteria 3241
301 Ga0207639_10003107 3300026041 Bacteria 11160
302 Ga0207639_10247359 3300026041 Bacteria 1553
303 Ga0207678_10003318 3300026067 Bacteria 14516
304 Ga0207678_10011227 3300026067 Bacteria 7867
305 Ga0207678_10013849 3300026067 Bacteria 7086
306 Ga0207678_10071204 3300026067 Bacteria 2981
307 Ga0207708_10006978 3300026075 Bacteria 8352
308 Ga0207702_10064757 3300026078 Bacteria 3129
309 Ga0207702_10072636 3300026078 Bacteria 2966
310 Ga0207641_10001368 3300026088 Bacteria 24140
311 Ga0207641_10025646 3300026088 Bacteria 4859
312 Ga0207648_10000349 3300026089 Bacteria 50786
313 Ga0207676_10094326 3300026095 Bacteria 2466
314 Ga0207675_100006409 3300026118 Bacteria 11147
315 Ga0207675_100014856 3300026118 Bacteria 7267
316 Ga0207683_10000040 3300026121 Bacteria 95127
317 Ga0207683_10079665 3300026121 Bacteria 2904
318 Ga0207698_10022545 3300026142 Bacteria 4379
319 Ga0209179_1031603 3300027512 Bacteria 1087
320 Ga0209813_10011469 3300027866 Bacteria 2317
321 Ga0209813_10065112 3300027866 Bacteria 1173
322 Ga0268266_10002967 3300028379 Bacteria 17501
323 Ga0268266_10005675 3300028379 Bacteria 11572
324 Ga0268266_10036703 3300028379 Bacteria 4174
325 Ga0268266_10139919 3300028379 Bacteria 2171
326 Ga0268265_10000056 3300028380 Bacteria 155720
327 Ga0268265_10005589 3300028380 Bacteria 8582
328 Ga0268264_10000053 3300028381 Bacteria 320368
329 Ga0268264_10000417 3300028381 Bacteria 60164
330 Ga0265327_10099759 3300031251 Bacteria 1403
331 Ga0307413_10069929 3300031824 Bacteria 2205
332 Ga0307413_10170437 3300031824 Bacteria 1540
333 Ga0307413_10429488 3300031824 Bacteria 1043
334 Ga0307410_10034781 3300031852 Bacteria 3267
335 Ga0307406_10307061 3300031901 Bacteria 1221
336 Ga0307407_10122973 3300031903 Bacteria 1648
337 Ga0307412_10142258 3300031911 Bacteria 1759
338 Ga0307409_100017089 3300031995 Bacteria 4823
339 Ga0307409_100041086 3300031995 Bacteria 3451
340 Ga0307416_100215746 3300032002 Bacteria 1835
341 Ga0307416_100659608 3300032002 Bacteria 1132
342 Ga0307416_101085556 3300032002 Bacteria 905
343 Ga0307411_10019423 3300032005 Bacteria 3926
344 Ga0307411_10209697 3300032005 Bacteria 1503
345 Ga0307415_100035856 3300032126 Bacteria 3244
346 Ga0307415_100062369 3300032126 Bacteria 2585
347 Ga0373952_0085084 3300035092 Bacteria 813
348 Ga0373939_0022264 3300035114 Bacteria 1745
349 Ga0373960_0036861 3300035121 Bacteria 1395
350 Ga0373961_0051478 3300035241 Bacteria 1223
351 Ga0373931_0045619 3300035691 Bacteria 2315
352 Ga0373931_0093273 3300035691 Bacteria 1681
353 Ga0373935_0555988 3300035692 Bacteria 837
354 Ga0316582_0012630 3300036647 Bacteria 4721
355 Ga0395900_0057306 3300037418 Bacteria 4011
356 Ga0395900_0300231 3300037418 Bacteria 1592
357 Ga0395898_0050328 3300037466 Bacteria 4078
358 Ga0395898_0275014 3300037466 Bacteria 1606
359 Ga0395905_0049703 3300037471 Bacteria 3930
360 Ga0395905_0278405 3300037471 Bacteria 1559
361 Ga0436364_0142680 3300037853 Bacteria 13599
362 Ga0436364_0329205 3300037853 Bacteria 2715
363 Ga0436364_0527008 3300037853 Bacteria 3944
364 Ga0436364_0604589 3300037853 Bacteria 10148
365 Ga0395901_0299200 3300038443 Bacteria 1668
366 Ga0436365_0329583 3300039437 Bacteria 52503
367 Ga0436365_0462461 3300039437 Bacteria 11131
368 Ga0436365_0662080 3300039437 Bacteria 5680
369 Ga0436365_0715051 3300039437 Bacteria 48440
370 Ga0436365_0809829 3300039437 Bacteria 1773
371 Ga0436365_1490253 3300039437 Bacteria 9196
372 Ga0436362_0868766 3300039453 Bacteria 1536
373 Ga0439461_0000774 3300041410 Bacteria 4688
374 Ga0439466_0003695 3300041411 Bacteria 5906
375 Ga0439466_0005991 3300041411 Bacteria 4627
376 Ga0439466_0007929 3300041411 Bacteria 4005
377 Ga0439465_0000439 3300041413 Bacteria 12169
378 Ga0439465_0001000 3300041413 Bacteria 9013
379 Ga0439465_0004076 3300041413 Bacteria 4756
380 Ga0439465_0011408 3300041413 Bacteria 2789
381 Ga0451793_1527126 3300041452 Bacteria 1187
382 Ga0451800_0101687 3300041459 Bacteria 1576
383 Ga0451833_1375940 3300041491 Bacteria 1321
384 Ga0451841_1098966 3300041498 Bacteria 1163
385 Ga0451843_0775765 3300041509 Bacteria 2348
386 Ga0451853_3507486 3300041512 Bacteria 1028
387 Ga0439431_0001548 3300041997 Bacteria 5093
388 Ga0439431_0003707 3300041997 Bacteria 3376
389 Ga0439431_0031811 3300041997 Bacteria 1313
390 Ga0439442_007871 3300042002 Bacteria 2151
391 Ga0439445_0023205 3300042004 Bacteria 1569
392 Ga0439445_0030949 3300042004 Bacteria 1389
393 Ga0439432_012691 3300042006 Bacteria 2877
394 Ga0439434_0000539 3300042435 Bacteria 10813
395 Ga0439459_0006870 3300042438 Bacteria 1908
396 Ga0466972_0003077 3300044658 Bacteria 8265
397 Ga0466972_0003083 3300044658 Bacteria 8256
398 Ga0466972_0003605 3300044658 Bacteria 7699
399 Ga0466972_0019824 3300044658 Bacteria 3363
400 Ga0466972_0083631 3300044658 Bacteria 1518
401 Ga0466965_0001504 3300044683 Bacteria 9446
402 Ga0466965_0007700 3300044683 Bacteria 4956
403 Ga0466965_0015322 3300044683 Bacteria 3642
404 Ga0466965_0019122 3300044683 Bacteria 3289
405 Ga0466965_0055260 3300044683 Bacteria 1975
406 Ga0466965_0099532 3300044683 Bacteria 1486
407 Ga0466966_0005329 3300044684 Bacteria 8458
408 Ga0466966_0008984 3300044684 Bacteria 6623
409 Ga0466966_0033633 3300044684 Bacteria 3319
410 Ga0466966_0131190 3300044684 Bacteria 1534
411 Ga0466961_0003903 3300044693 Bacteria 9322
412 Ga0466961_0029368 3300044693 Bacteria 3535
413 Ga0466961_0055195 3300044693 Bacteria 2533
414 Ga0466963_0034126 3300044694 Bacteria 3309
415 Ga0466964_0056249 3300044706 Bacteria 1626
416 Ga0466971_0008487 3300044719 Bacteria 4480
417 Ga0466971_0026763 3300044719 Bacteria 2580
418 Ga0466971_0032310 3300044719 Bacteria 2345
419 Ga0466971_0077539 3300044719 Bacteria 1513
420 Ga0466968_0001680 3300044735 Bacteria 7977
421 Ga0466968_0003136 3300044735 Bacteria 6100
422 Ga0466968_0008896 3300044735 Bacteria 3853
423 Ga0466968_0061591 3300044735 Bacteria 1619
424 Ga0466968_0120096 3300044735 Bacteria 1188
425 Ga0466970_0008022 3300044765 Bacteria 5300
426 Ga0466970_0078052 3300044765 Bacteria 1786
427 Ga0466970_0079569 3300044765 Bacteria 1769
428 Ga0466957_0004906 3300044842 Bacteria 7488
429 Ga0466957_0006947 3300044842 Bacteria 6401
430 Ga0466957_0042990 3300044842 Bacteria 2734
431 Ga0466957_0153895 3300044842 Bacteria 1489
432 Ga0466957_0485003 3300044842 Bacteria 855
433 Ga0466960_0000196 3300044901 Bacteria 20894
434 Ga0466960_0000388 3300044901 Bacteria 15073
435 Ga0466960_0001147 3300044901 Bacteria 9509
436 Ga0466960_0122136 3300044901 Bacteria 1365
437 Ga0466960_0129642 3300044901 Bacteria 1329
438 Ga0466959_0001357 3300045049 Bacteria 14938
439 Ga0466959_0002337 3300045049 Bacteria 12107
440 Ga0466959_0003100 3300045049 Bacteria 10773
441 Ga0466959_0017663 3300045049 Bacteria 5230
442 Ga0466959_0072859 3300045049 Bacteria 2485
443 Ga0466958_0019584 3300045836 Bacteria 3940
444 Ga0466958_0051352 3300045836 Bacteria 2496
445 Ga0466958_0099092 3300045836 Bacteria 1810
446 Ga0466967_0001060 3300045976 Bacteria 15161
447 Ga0466967_0003093 3300045976 Bacteria 10702
448 Ga0466967_0003987 3300045976 Bacteria 9832
449 Ga0466967_0023553 3300045976 Bacteria 5049
450 Ga0466967_0023877 3300045976 Bacteria 5018
451 Ga0466967_0032737 3300045976 Bacteria 4394
452 Ga0466967_0125613 3300045976 Bacteria 2376
453 Ga0466967_0166095 3300045976 Bacteria 2074
454 Ga0466967_0205356 3300045976 Bacteria 1867
455 Ga0466967_0501739 3300045976 Bacteria 1191
456 Ga0495638_0006330 3300046460 Bacteria 8628
457 Ga0495638_0096789 3300046460 Bacteria 1771
458 Ga0495582_0064951 3300046473 Bacteria 2016
459 Ga0495639_0017325 3300046475 Bacteria 3129
460 Ga0495594_0045363 3300046499 Bacteria 2413
461 Ga0495608_0144126 3300046511 Bacteria 1520
462 Ga0495648_0000628 3300046524 Bacteria 37663
463 Ga0495667_0314143 3300046559 Bacteria 992
464 Ga0495668_0008297 3300046616 Bacteria 6507
465 Ga0495658_0165704 3300046683 Bacteria 1365
466 Ga0495669_0003085 3300046684 Bacteria 6850
467 Ga0495613_0208294 3300046689 Bacteria 1376
468 Ga0495624_0046221 3300046690 Bacteria 2769
469 Ga0495649_0120509 3300046694 Bacteria 1388
470 Ga0495649_0126004 3300046694 Bacteria 1353
471 Ga0495581_0141405 3300047315 Bacteria 1404
472 Ga0495672_0008575 3300047320 Bacteria 7524
473 Ga0495672_0024723 3300047320 Bacteria 3864
474 Ga0495672_0030035 3300047320 Bacteria 3415
475 Ga0495676_0041533 3300047321 Bacteria 3784
476 Ga0495673_0002027 3300047469 Bacteria 14878
477 Ga0495593_0026483 3300047673 Bacteria 3201
478 Ga0495614_0131684 3300048089 Bacteria 1107
479 Ga0496100_0000099 3300048903 Bacteria 49748
480 Ga0496100_0005195 3300048903 Bacteria 6986
481 Ga0496100_0009828 3300048903 Bacteria 5390
482 Ga0496100_0055044 3300048903 Bacteria 2598
483 Ga0496100_0142140 3300048903 Bacteria 1702
484 Ga0496101_0000066 3300048904 Bacteria 122196
485 Ga0496101_0000074 3300048904 Bacteria 113105
486 Ga0496101_0002316 3300048904 Bacteria 11658
487 Ga0496101_0038619 3300048904 Bacteria 3391
488 Ga0496101_0060971 3300048904 Bacteria 2738
489 Ga0496101_0132603 3300048904 Bacteria 1893
490 Ga0496101_0270294 3300048904 Bacteria 1327
491 Ga0496102_0000035 3300048905 Bacteria 213557
492 Ga0496102_0000070 3300048905 Bacteria 155087
493 Ga0496102_0000600 3300048905 Bacteria 37655
494 Ga0496102_0004697 3300048905 Bacteria 11558
495 Ga0496102_0008806 3300048905 Bacteria 8658
496 Ga0496102_0124712 3300048905 Bacteria 2407
497 Ga0496102_0146132 3300048905 Bacteria 2219
498 Ga0496103_0000028 3300048906 Bacteria 213660
499 Ga0496103_0000381 3300048906 Bacteria 39710
500 Ga0496103_0000477 3300048906 Bacteria 33721
501 Ga0496103_0000667 3300048906 Bacteria 25794
502 Ga0496103_0023011 3300048906 Bacteria 3756
503 Ga0496104_0026704 3300048907 Bacteria 5335
504 Ga0496104_0078845 3300048907 Bacteria 3139
505 Ga0496104_0485058 3300048907 Bacteria 1147
506 Ga0496105_0049701 3300048908 Bacteria 3463
507 Ga0496105_0049975 3300048908 Bacteria 3454
508 Ga0496106_0002066 3300048909 Bacteria 15061
509 Ga0496106_0010257 3300048909 Bacteria 6926
510 Ga0496106_0010815 3300048909 Bacteria 6746
511 Ga0496106_0153804 3300048909 Bacteria 1815
512 Ga0496107_0001051 3300048910 Bacteria 16518
513 Ga0496107_0002661 3300048910 Bacteria 11698
514 Ga0496107_0012907 3300048910 Bacteria 5839
515 Ga0496107_0028337 3300048910 Bacteria 3979
516 Ga0496107_0047928 3300048910 Bacteria 3077
517 Ga0496108_0000802 3300048911 Bacteria 24400
518 Ga0496108_0027767 3300048911 Bacteria 4678
519 Ga0496108_0050142 3300048911 Bacteria 3494
520 Ga0496109_0000160 3300048912 Bacteria 66073
521 Ga0496109_0005948 3300048912 Bacteria 10238
522 Ga0496109_0007855 3300048912 Bacteria 9037
523 Ga0496109_0150578 3300048912 Bacteria 2178
524 Ga0496109_0202851 3300048912 Bacteria 1865
525 Ga0496110_0130988 3300048913 Bacteria 2265
526 Ga0496110_0177249 3300048913 Bacteria 1935
527 Ga0496111_0016907 3300048914 Bacteria 5035
528 Ga0496111_0269813 3300048914 Bacteria 1262
529 Ga0496112_0008839 3300048915 Bacteria 9037
530 Ga0496112_0041494 3300048915 Bacteria 4503
531 Ga0496112_0047543 3300048915 Bacteria 4209
532 Ga0496112_0104600 3300048915 Bacteria 2801
533 Ga0496112_0363354 3300048915 Bacteria 1389
534 Ga0496113_0031777 3300048916 Bacteria 3834
535 Ga0496113_0114204 3300048916 Bacteria 2105
536 Ga0496113_0125836 3300048916 Bacteria 2007
537 Ga0496114_0001610 3300048917 Bacteria 17143
538 Ga0496114_0002368 3300048917 Bacteria 14350
539 Ga0496114_0004619 3300048917 Bacteria 10700
540 Ga0496114_0136658 3300048917 Bacteria 2120
541 Ga0496114_0549975 3300048917 Bacteria 1020
542 Ga0496115_0009272 3300048918 Bacteria 7313
543 Ga0496115_0021794 3300048918 Bacteria 4953
544 Ga0496115_0028041 3300048918 Bacteria 4410
545 Ga0496115_0459054 3300048918 Bacteria 1028
546 Ga0496116_0000090 3300048919 Bacteria 212651
547 Ga0496117_0000051 3300048920 Bacteria 285716
548 Ga0496117_0001117 3300048920 Bacteria 40451
549 Ga0496117_0025666 3300048920 Bacteria 4627
550 Ga0496118_0000043 3300048921 Bacteria 285716
551 Ga0496118_0000272 3300048921 Bacteria 91016
552 Ga0496118_0004850 3300048921 Bacteria 15670
553 Ga0496118_0034057 3300048921 Bacteria 4165
554 Ga0496119_0000559 3300048922 Bacteria 50341
555 Ga0496119_0004410 3300048922 Bacteria 14028
556 Ga0496119_0016323 3300048922 Bacteria 5658
557 Ga0496120_0001323 3300048923 Bacteria 30586
558 Ga0496120_0015370 3300048923 Bacteria 5054
559 Ga0496120_0034583 3300048923 Bacteria 3026
560 Ga0496121_0000014 3300048924 Bacteria 609379
561 Ga0496121_0000080 3300048924 Bacteria 230195
562 Ga0496121_0002543 3300048924 Bacteria 27647
563 Ga0496122_0000097 3300048925 Bacteria 199223
564 Ga0496122_0033470 3300048925 Bacteria 4226
565 Ga0496123_0029402 3300048926 Bacteria 4046
566 Ga0496123_0037691 3300048926 Bacteria 3410
567 Ga0496124_0000019 3300048927 Bacteria 436995
568 Ga0496124_0195055 3300048927 Bacteria 1546
569 Ga0496125_0000014 3300048928 Bacteria 610124
570 Ga0496125_0010205 3300048928 Bacteria 9521
571 Ga0496125_0162429 3300048928 Bacteria 1515
572 Ga0496126_0000017 3300048929 Bacteria 610676
573 Ga0496126_0001251 3300048929 Bacteria 41100
574 Ga0496126_0035353 3300048929 Bacteria 4684
575 Ga0496126_0059304 3300048929 Bacteria 3446
576 Ga0496126_0348160 3300048929 Bacteria 1212
577 Ga0501032_0009488 3300049569 Bacteria 7053
578 Ga0501032_0330946 3300049569 Bacteria 982
579 Ga0501033_0005242 3300049570 Bacteria 10291
580 Ga0501034_0015666 3300049571 Bacteria 7784
581 Ga0501034_0037887 3300049571 Bacteria 4883
582 Ga0501034_0059563 3300049571 Bacteria 3835
583 Ga0501034_0098340 3300049571 Bacteria 2922
584 Ga0501034_0285927 3300049571 Bacteria 1588
585 Ga0501034_0346917 3300049571 Bacteria 1414
586 Ga0501034_0431254 3300049571 Bacteria 1238
587 Ga0501036_0213288 3300049572 Bacteria 1622
588 Ga0501036_0485487 3300049572 Bacteria 1028
589 Ga0501037_0000434 3300049573 Bacteria 34407
590 Ga0501037_0011193 3300049573 Bacteria 6603
591 Ga0501037_0058868 3300049573 Bacteria 2803
592 Ga0501038_0012184 3300049574 Bacteria 7850
593 Ga0501039_0002790 3300049575 Bacteria 13049
594 Ga0501043_0061911 3300049579 Bacteria 2938
595 Ga0501043_0217784 3300049579 Bacteria 1478
596 Ga0501043_0333361 3300049579 Bacteria 1155
597 Ga0501046_0011358 3300049580 Bacteria 7620
598 Ga0501047_0002023 3300049581 Bacteria 19406
599 Ga0501047_0007852 3300049581 Bacteria 10054
600 Ga0501047_0022160 3300049581 Bacteria 6104
601 Ga0501047_0319834 3300049581 Bacteria 1392
602 Ga0501047_0609553 3300049581 Bacteria 913
603 Ga0501048_0019214 3300049582 Bacteria 5017
604 Ga0501069_0042281 3300049585 Bacteria 2521
605 Ga0501069_0223094 3300049585 Bacteria 1096
606 Ga0501070_0006875 3300049586 Bacteria 9677
607 Ga0501070_0019114 3300049586 Bacteria 5746
608 Ga0501070_0063913 3300049586 Bacteria 3049
609 Ga0501070_0164745 3300049586 Bacteria 1827
610 Ga0501070_0172841 3300049586 Bacteria 1779
611 Ga0501070_0334328 3300049586 Bacteria 1231
612 Ga0501071_0144602 3300049587 Bacteria 1772
613 Ga0501072_0013982 3300049588 Bacteria 6150
614 Ga0501080_0018162 3300049742 Bacteria 6510
615 Ga0501080_0093009 3300049742 Bacteria 2800
616 Ga0501080_0253631 3300049742 Bacteria 1604
617 Ga0501080_0294953 3300049742 Bacteria 1472
618 Ga0501083_0036359 3300049744 Bacteria 3359
619 Ga0501035_0002184 3300049822 Bacteria 19411
620 Ga0501035_0005928 3300049822 Bacteria 11503
621 Ga0501044_0000498 3300049823 Bacteria 47714
622 Ga0501044_0002158 3300049823 Bacteria 22557
623 Ga0501044_0051682 3300049823 Bacteria 4237
624 Ga0501044_0209673 3300049823 Bacteria 1903
625 nmdc:mga03683_72136_c1 3300050489 Bacteria 1478
626 nmdc:mga03n38_112684_c1 3300050490 Bacteria 1327
627 nmdc:mga03n38_1531_c1 3300050490 Bacteria 6690
628 nmdc:mga03n38_226870_c1 3300050490 Bacteria 977
629 nmdc:mga03n38_24393_c1 3300050490 Bacteria 2473
630 nmdc:mga03n38_2523_c1 3300050490 Bacteria 5677
631 nmdc:mga03n38_51520_c1 3300050490 Bacteria 1839
632 nmdc:mga03n38_68444_c1 3300050490 Bacteria 1637
633 nmdc:mga03n38_69778_c1 3300050490 Bacteria 1624
634 nmdc:mga03n38_78819_c1 3300050490 Bacteria 1543
635 nmdc:mga03n38_83420_c1 3300050490 Bacteria 1507
636 nmdc:mga00v17_161264_c1 3300050491 Bacteria 1444
637 nmdc:mga00v17_2413_c1 3300050491 Bacteria 9570
638 nmdc:mga00v17_286612_c1 3300050491 Bacteria 1069
639 nmdc:mga00v17_3084_c1 3300050491 Bacteria 8568
640 nmdc:mga00v17_337218_c1 3300050491 Bacteria 980
641 nmdc:mga00v17_60682_c1 3300050491 Bacteria 2323
642 nmdc:mga00v17_610_c1 3300050491 Bacteria 9214
643 nmdc:mga00v17_7742_c2 3300050491 Bacteria 1545
644 nmdc:mga00v17_78484_c1 3300050491 Bacteria 2057
645 nmdc:mga00v17_89944_c1 3300050491 Bacteria 1927
646 nmdc:mga00v17_97515_c1 3300050491 Bacteria 1853
647 nmdc:mga0yw44_130534_c1 3300050492 Bacteria 1626
648 nmdc:mga0yw44_14712_c1 3300050492 Bacteria 4165
649 nmdc:mga0yw44_15867_c1 3300050492 Bacteria 4051
650 nmdc:mga0yw44_15876_c1 3300050492 Bacteria 4050
651 nmdc:mga0yw44_27183_c1 3300050492 Bacteria 3275
652 nmdc:mga0yw44_276618_c1 3300050492 Bacteria 1121
653 nmdc:mga0yw44_30717_c1 3300050492 Bacteria 3117
654 nmdc:mga0yw44_34572_c1 3300050492 Bacteria 2962
655 nmdc:mga0yw44_3579_c1 3300050492 Bacteria 6926
656 nmdc:mga0yw44_379501_c1 3300050492 Bacteria 954
657 nmdc:mga0yw44_64568_c1 3300050492 Bacteria 2253
658 nmdc:mga0yw44_87803_c1 3300050492 Bacteria 1960
659 nmdc:mga06z11_111279_c1 3300050494 Bacteria 1517
660 nmdc:mga06z11_256899_c1 3300050494 Bacteria 1030
661 nmdc:mga06z11_31398_c1 3300050494 Bacteria 2580
662 nmdc:mga06z11_57800_c1 3300050494 Bacteria 2010
663 nmdc:mga04h51_21258_c1 3300050495 Bacteria 1950
664 nmdc:mga07m45_110949_c1 3300050496 Bacteria 1580
665 nmdc:mga07m45_245785_c1 3300050496 Bacteria 1041
666 nmdc:mga07m45_41367_c1 3300050496 Bacteria 2581
667 nmdc:mga07m45_84516_c1 3300050496 Bacteria 1815
668 nmdc:mga05p37_112745_c1 3300050507 Bacteria 3344
669 nmdc:mga0qj67_28056_c1 3300050509 Bacteria 4367
670 nmdc:mga06r32_5670_c1 3300050510 Bacteria 11237
671 nmdc:mga0sz30_32770_c1 3300050516 Bacteria 1073
672 nmdc:mga0sz30_49651_c1 3300050516 Bacteria 1778
673 nmdc:mga0sz30_64339_c1 3300050516 Bacteria 1571
674 nmdc:mga0sz30_6965_c1 3300050516 Bacteria 4225
675 nmdc:mga0sz30_89985_c1 3300050516 Bacteria 1335
676 Ga0495601_0250421 3300053077 Bacteria 1157
677 Ga0500635_0045829 3300053080 Bacteria 1481
678 Ga0500643_005328 3300053087 Bacteria 5563
679 Ga0500643_009356 3300053087 Bacteria 3750
680 Ga0500644_0000014 3300053088 Bacteria 109650
681 Ga0500644_0072434 3300053088 Bacteria 1245
682 Ga0500641_0019573 3300053096 Bacteria 2560
683 Ga0500556_0001691 3300053104 Bacteria 8473
684 Ga0500593_000305 3300053117 Bacteria 19941
685 Ga0500652_014947 3300053131 Bacteria 2789
686 Ga0500652_048020 3300053131 Bacteria 1736
687 Ga0500573_0063602 3300053140 Bacteria 2111
688 Ga0500588_0038768 3300053146 Bacteria 1423
689 Ga0500604_0021109 3300053151 Bacteria 1839
690 Ga0500645_000006 3300053730 Bacteria 276677
691 Ga0466962_0010692 3300061719 Bacteria 4415

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005327 Ga0070658_10013421 Ga0070658_100134212 209
2 3300009098 Ga0105245_10260707 Ga0105245_102607072 209
3 3300025927 Ga0207687_10290244 Ga0207687_102902442 209
4 3300046684 Ga0495669_0003085 Ga0495669_0003085_1701_2492 221
5 3300050492 nmdc:mga0yw44_14712_c1 nmdc:mga0yw44_14712_c1_2081_2863 222
6 3300025909 Ga0207705_10105220 Ga0207705_101052202 226
7 3300025937 Ga0207669_10135546 Ga0207669_101355463 230
8 3300048907 Ga0496104_0485058 Ga0496104_0485058_380_1087 231
9 3300048911 Ga0496108_0027767 Ga0496108_0027767_2640_3347 231
10 3300048912 Ga0496109_0007855 Ga0496109_0007855_3969_4676 231
11 3300048913 Ga0496110_0177249 Ga0496110_0177249_890_1597 231
12 3300048915 Ga0496112_0008839 Ga0496112_0008839_6319_7026 231
13 3300049823 Ga0501044_0051682 Ga0501044_0051682_3440_4156 231
14 3300050490 nmdc:mga03n38_1531_c1 nmdc:mga03n38_1531_c1_1358_2065 231
15 3300050490 nmdc:mga03n38_226870_c1 nmdc:mga03n38_226870_c1_40_747 231
16 3300006038 Ga0075365_10016378 Ga0075365_100163786 234
17 3300006038 Ga0075365_10031758 Ga0075365_100317583 234
18 3300006038 Ga0075365_10065345 Ga0075365_100653452 234
19 3300050491 nmdc:mga00v17_286612_c1 nmdc:mga00v17_286612_c1_43_828 234
20 3300050492 nmdc:mga0yw44_3579_c1 nmdc:mga0yw44_3579_c1_5479_6264 234
21 3300053088 Ga0500644_0072434 Ga0500644_0072434_298_1083 234
22 3300053151 Ga0500604_0021109 Ga0500604_0021109_397_1179 234
23 3300005435 Ga0070714_100350055 Ga0070714_1003500552 235
24 3300025929 Ga0207664_10455722 Ga0207664_104557222 235
25 3300049579 Ga0501043_0217784 Ga0501043_0217784_649_1401 235
26 3300049742 Ga0501080_0093009 Ga0501080_0093009_463_1245 235
27 3300048927 Ga0496124_0195055 Ga0496124_0195055_517_1302 236
28 3300049588 Ga0501072_0013982 Ga0501072_0013982_1430_2212 237
29 3300006038 Ga0075365_10111706 Ga0075365_101117062 238
30 3300006042 Ga0075368_10019871 Ga0075368_100198712 238
31 3300006048 Ga0075363_100025439 Ga0075363_1000254393 238
32 3300006051 Ga0075364_10052991 Ga0075364_100529913 238
33 3300006178 Ga0075367_10039158 Ga0075367_100391583 238
34 3300049571 Ga0501034_0431254 Ga0501034_0431254_373_1143 238
35 3300049586 Ga0501070_0172841 Ga0501070_0172841_415_1185 238
36 3300049742 Ga0501080_0253631 Ga0501080_0253631_241_1011 238
37 3300050490 nmdc:mga03n38_83420_c1 nmdc:mga03n38_83420_c1_352_1137 238
38 3300050491 nmdc:mga00v17_60682_c1 nmdc:mga00v17_60682_c1_806_1591 238
39 3300050492 nmdc:mga0yw44_27183_c1 nmdc:mga0yw44_27183_c1_1949_2734 238
40 3300005843 Ga0068860_100000334 Ga0068860_10000033458 239
41 3300028381 Ga0268264_10000417 Ga0268264_1000041736 239
42 3300050492 nmdc:mga0yw44_276618_c1 nmdc:mga0yw44_276618_c1_276_1061 241
43 3300050492 nmdc:mga0yw44_30717_c1 nmdc:mga0yw44_30717_c1_2239_3012 241
44 3300005539 Ga0068853_100066553 Ga0068853_1000665535 242
45 3300026041 Ga0207639_10247359 Ga0207639_102473592 242
46 3300049587 Ga0501071_0144602 Ga0501071_0144602_124_906 242
47 3300005327 Ga0070658_10043009 Ga0070658_100430093 243
48 3300031995 Ga0307409_100017089 Ga0307409_1000170891 243
49 3300032002 Ga0307416_100215746 Ga0307416_1002157462 243
50 3300032005 Ga0307411_10209697 Ga0307411_102096972 243
51 3300032126 Ga0307415_100062369 Ga0307415_1000623692 243
52 3300048917 Ga0496114_0549975 Ga0496114_0549975_159_962 243
53 3300050492 nmdc:mga0yw44_15876_c1 nmdc:mga0yw44_15876_c1_2910_3695 243
54 iso_pu_bacteria 2932398195 2932398404 243
55 3300053140 Ga0500573_0063602 Ga0500573_0063602_38_820 244
56 3300005436 Ga0070713_100019364 Ga0070713_1000193644 245
57 3300005437 Ga0070710_10235616 Ga0070710_102356162 245
58 3300006028 Ga0070717_10406360 Ga0070717_104063602 245
59 3300009148 Ga0105243_10147680 Ga0105243_101476803 245
60 3300025928 Ga0207700_10059241 Ga0207700_100592412 245
61 3300025935 Ga0207709_10258903 Ga0207709_102589032 245
62 3300039437 Ga0436365_0809829 Ga0436365_0809829_954_1712 245
63 3300039453 Ga0436362_0868766 Ga0436362_0868766_593_1351 245
64 iso_pu_bacteria 2902799365 2902799554 245
65 iso_pu_bacteria 2643221715 2644634139 246
66 iso_pu_bacteria 2738541274 2738704334 246
67 iso_pu_bacteria 2738543028 2739331183 246
68 iso_pu_bacteria 2902810491 2902811702 246
69 3300048903 Ga0496100_0055044 Ga0496100_0055044_1458_2204 247
70 3300048915 Ga0496112_0363354 Ga0496112_0363354_82_828 247
71 3300048916 Ga0496113_0114204 Ga0496113_0114204_829_1575 247
72 3300048925 Ga0496122_0033470 Ga0496122_0033470_1614_2360 247
73 3300048926 Ga0496123_0037691 Ga0496123_0037691_1627_2373 247
74 3300048928 Ga0496125_0162429 Ga0496125_0162429_548_1294 247
75 3300049823 Ga0501044_0209673 Ga0501044_0209673_335_1084 247
76 iso_pu_bacteria 2643221576 2643889839 247
77 iso_pu_bacteria 2643221590 2643958895 247
78 iso_pu_bacteria 2643221604 2644033954 247
79 iso_pu_bacteria 2643221615 2644089355 247
80 iso_pu_bacteria 2643221617 2644099468 247
81 iso_pu_bacteria 2643221620 2644116339 247
82 iso_pu_bacteria 2643221657 2644319200 247
83 iso_pu_bacteria 2643221687 2644485509 247
84 iso_pu_bacteria 2738541305 2738867557 247
85 iso_pu_bacteria 2738543005 2739206710 247
86 iso_pu_bacteria 2738543011 2739240266 247
87 iso_pu_bacteria 2744054611 2744954737 247
88 iso_pu_bacteria 2773857762 2774392511 247
89 iso_pu_bacteria 2808606439 2809196293 247
90 iso_pu_bacteria 2811994874 2812331803 247
91 iso_pu_bacteria 2811994878 2812351545 247
92 iso_pu_bacteria 2842134933 2842139875 247
93 iso_pu_bacteria 2855386786 2855386941 247
94 iso_pu_bacteria 2889300758 2889302821 247
95 iso_pu_bacteria 2902792274 2902798122 247
96 iso_pu_bacteria 2902837492 2902837980 247
97 iso_pu_bacteria 2928142448 2928145922 247
98 iso_pu_bacteria 2929212328 2929215900 247
99 iso_pu_bacteria 2939743619 2939748028 247
100 3300005329 Ga0070683_100129173 Ga0070683_1001291733 248
101 3300013105 Ga0157369_10253713 Ga0157369_102537133 248
102 3300025944 Ga0207661_10096794 Ga0207661_100967943 248
103 3300044694 Ga0466963_0034126 Ga0466963_0034126_2414_3163 248
104 3300044719 Ga0466971_0032310 Ga0466971_0032310_1535_2284 248
105 3300044901 Ga0466960_0000388 Ga0466960_0000388_107_856 248
106 3300045976 Ga0466967_0003093 Ga0466967_0003093_2308_3057 248
107 3300045976 Ga0466967_0003987 Ga0466967_0003987_6246_6995 248
108 3300045976 Ga0466967_0023877 Ga0466967_0023877_670_1419 248
109 3300048905 Ga0496102_0008806 Ga0496102_0008806_3191_3940 248
110 3300048921 Ga0496118_0000272 Ga0496118_0000272_58238_58987 248
111 3300049569 Ga0501032_0009488 Ga0501032_0009488_3416_4165 248
112 3300049570 Ga0501033_0005242 Ga0501033_0005242_3866_4615 248
113 3300049571 Ga0501034_0015666 Ga0501034_0015666_6706_7455 248
114 3300049572 Ga0501036_0213288 Ga0501036_0213288_434_1183 248
115 3300049573 Ga0501037_0011193 Ga0501037_0011193_5096_5845 248
116 3300049579 Ga0501043_0061911 Ga0501043_0061911_538_1287 248
117 3300049580 Ga0501046_0011358 Ga0501046_0011358_3939_4688 248
118 3300049581 Ga0501047_0002023 Ga0501047_0002023_15999_16748 248
119 3300049582 Ga0501048_0019214 Ga0501048_0019214_905_1654 248
120 3300049585 Ga0501069_0042281 Ga0501069_0042281_1206_1955 248
121 3300049586 Ga0501070_0006875 Ga0501070_0006875_3514_4263 248
122 3300049742 Ga0501080_0018162 Ga0501080_0018162_3004_3753 248
123 3300049744 Ga0501083_0036359 Ga0501083_0036359_2286_3035 248
124 3300049822 Ga0501035_0002184 Ga0501035_0002184_13510_14259 248
125 3300049823 Ga0501044_0002158 Ga0501044_0002158_15991_16740 248
126 3300013306 Ga0163162_10121125 Ga0163162_101211252 249
127 3300031824 Ga0307413_10429488 Ga0307413_104294881 249
128 3300039437 Ga0436365_0715051 Ga0436365_0715051_16686_17438 249
129 3300041452 Ga0451793_1527126 Ga0451793_1527126_386_1147 249
130 3300044719 Ga0466971_0026763 Ga0466971_0026763_1450_2202 249
131 3300045976 Ga0466967_0501739 Ga0466967_0501739_364_1158 249
132 3300046694 Ga0495649_0126004 Ga0495649_0126004_373_1125 249
133 3300049573 Ga0501037_0000434 Ga0501037_0000434_20702_21460 249
134 3300049574 Ga0501038_0012184 Ga0501038_0012184_6563_7321 249
135 3300049575 Ga0501039_0002790 Ga0501039_0002790_5707_6465 249
136 3300049581 Ga0501047_0022160 Ga0501047_0022160_3953_4735 249
137 3300049586 Ga0501070_0019114 Ga0501070_0019114_2046_2804 249
138 iso_pu_bacteria 2891968417 2891970848 249
139 3300003792 Ga0055540_1000024 Ga0055540_1000024128 250
140 3300005335 Ga0070666_10459069 Ga0070666_104590691 250
141 3300005367 Ga0070667_100010253 Ga0070667_1000102532 250
142 3300005435 Ga0070714_100695337 Ga0070714_1006953371 250
143 3300005436 Ga0070713_100350786 Ga0070713_1003507861 250
144 3300005614 Ga0068856_100019507 Ga0068856_1000195076 250
145 3300005614 Ga0068856_100112546 Ga0068856_1001125463 250
146 3300005616 Ga0068852_100056443 Ga0068852_1000564433 250
147 3300006038 Ga0075365_10035069 Ga0075365_100350692 250
148 3300006038 Ga0075365_10166821 Ga0075365_101668213 250
149 3300006042 Ga0075368_10031817 Ga0075368_100318172 250
150 3300006048 Ga0075363_100010009 Ga0075363_1000100094 250
151 3300006048 Ga0075363_100281014 Ga0075363_1002810141 250
152 3300006051 Ga0075364_10004332 Ga0075364_100043325 250
153 3300006051 Ga0075364_10005507 Ga0075364_100055077 250
154 3300006051 Ga0075364_10362964 Ga0075364_103629641 250
155 3300006177 Ga0075362_10013469 Ga0075362_100134693 250
156 3300006178 Ga0075367_10015484 Ga0075367_100154842 250
157 3300006186 Ga0075369_10054417 Ga0075369_100544172 250
158 3300006353 Ga0075370_10003387 Ga0075370_100033877 250
159 3300006353 Ga0075370_10170448 Ga0075370_101704482 250
160 3300009098 Ga0105245_10010872 Ga0105245_100108726 250
161 3300009098 Ga0105245_10211953 Ga0105245_102119533 250
162 3300009545 Ga0105237_10115873 Ga0105237_101158734 250
163 3300010375 Ga0105239_10014541 Ga0105239_100145418 250
164 3300013306 Ga0163162_10078462 Ga0163162_100784623 250
165 3300021384 Ga0213876_10003078 Ga0213876_100030783 250
166 3300021384 Ga0213876_10003966 Ga0213876_100039663 250
167 3300021384 Ga0213876_10061787 Ga0213876_100617872 250
168 3300021388 Ga0213875_10111691 Ga0213875_101116912 250
169 3300025303 Ga0209051_1000021 Ga0209051_1000021127 250
170 3300025303 Ga0209051_1017466 Ga0209051_10174665 250
171 3300025903 Ga0207680_10007483 Ga0207680_100074834 250
172 3300025914 Ga0207671_10012164 Ga0207671_100121649 250
173 3300025929 Ga0207664_10495376 Ga0207664_104953762 250
174 3300025949 Ga0207667_10065977 Ga0207667_100659772 250
175 3300025986 Ga0207658_10006768 Ga0207658_100067682 250
176 3300025986 Ga0207658_10191143 Ga0207658_101911432 250
177 3300026023 Ga0207677_10105422 Ga0207677_101054223 250
178 3300026078 Ga0207702_10064757 Ga0207702_100647572 250
179 3300026078 Ga0207702_10072636 Ga0207702_100726362 250
180 3300026142 Ga0207698_10022545 Ga0207698_100225454 250
181 3300027866 Ga0209813_10065112 Ga0209813_100651122 250
182 3300031251 Ga0265327_10099759 Ga0265327_100997592 250
183 3300031901 Ga0307406_10307061 Ga0307406_103070611 250
184 3300037471 Ga0395905_0278405 Ga0395905_0278405_676_1458 250
185 3300037853 Ga0436364_0329205 Ga0436364_0329205_1882_2637 250
186 3300037853 Ga0436364_0527008 Ga0436364_0527008_2326_3081 250
187 3300037853 Ga0436364_0604589 Ga0436364_0604589_4563_5318 250
188 3300039437 Ga0436365_0329583 Ga0436365_0329583_32259_33014 250
189 3300039437 Ga0436365_0462461 Ga0436365_0462461_5471_6253 250
190 3300039437 Ga0436365_1490253 Ga0436365_1490253_2526_3281 250
191 3300041410 Ga0439461_0000774 Ga0439461_0000774_2370_3125 250
192 3300041411 Ga0439466_0003695 Ga0439466_0003695_588_1370 250
193 3300041413 Ga0439465_0001000 Ga0439465_0001000_6943_7698 250
194 3300041491 Ga0451833_1375940 Ga0451833_1375940_278_1045 250
195 3300041997 Ga0439431_0003707 Ga0439431_0003707_571_1353 250
196 3300042435 Ga0439434_0000539 Ga0439434_0000539_363_1118 250
197 3300044658 Ga0466972_0003083 Ga0466972_0003083_6702_7457 250
198 3300044683 Ga0466965_0007700 Ga0466965_0007700_153_908 250
199 3300044683 Ga0466965_0015322 Ga0466965_0015322_55_822 250
200 3300044684 Ga0466966_0008984 Ga0466966_0008984_3052_3807 250
201 3300044693 Ga0466961_0029368 Ga0466961_0029368_1623_2378 250
202 3300044719 Ga0466971_0077539 Ga0466971_0077539_94_849 250
203 3300044735 Ga0466968_0001680 Ga0466968_0001680_3121_3876 250
204 3300044735 Ga0466968_0003136 Ga0466968_0003136_2618_3373 250
205 3300044765 Ga0466970_0079569 Ga0466970_0079569_215_970 250
206 3300044842 Ga0466957_0042990 Ga0466957_0042990_820_1575 250
207 3300044842 Ga0466957_0485003 Ga0466957_0485003_78_833 250
208 3300044901 Ga0466960_0001147 Ga0466960_0001147_1442_2197 250
209 3300045049 Ga0466959_0001357 Ga0466959_0001357_1245_2000 250
210 3300045049 Ga0466959_0017663 Ga0466959_0017663_2069_2824 250
211 3300045976 Ga0466967_0023553 Ga0466967_0023553_2412_3167 250
212 3300045976 Ga0466967_0205356 Ga0466967_0205356_525_1292 250
213 3300046460 Ga0495638_0096789 Ga0495638_0096789_133_888 250
214 3300047320 Ga0495672_0024723 Ga0495672_0024723_998_1753 250
215 3300048903 Ga0496100_0000099 Ga0496100_0000099_9133_9903 250
216 3300048904 Ga0496101_0000074 Ga0496101_0000074_41442_42212 250
217 3300048906 Ga0496103_0000381 Ga0496103_0000381_10714_11484 250
218 3300048910 Ga0496107_0012907 Ga0496107_0012907_5024_5794 250
219 3300048911 Ga0496108_0000802 Ga0496108_0000802_22185_22955 250
220 3300048911 Ga0496108_0050142 Ga0496108_0050142_2347_3102 250
221 3300048912 Ga0496109_0000160 Ga0496109_0000160_50655_51425 250
222 3300048914 Ga0496111_0016907 Ga0496111_0016907_2658_3428 250
223 3300048917 Ga0496114_0002368 Ga0496114_0002368_11169_11939 250
224 3300048918 Ga0496115_0021794 Ga0496115_0021794_2853_3623 250
225 3300048918 Ga0496115_0459054 Ga0496115_0459054_208_963 250
226 3300048920 Ga0496117_0025666 Ga0496117_0025666_3639_4409 250
227 3300048921 Ga0496118_0034057 Ga0496118_0034057_1404_2174 250
228 3300048922 Ga0496119_0004410 Ga0496119_0004410_11743_12513 250
229 3300048923 Ga0496120_0034583 Ga0496120_0034583_259_1029 250
230 3300048924 Ga0496121_0000014 Ga0496121_0000014_77320_78090 250
231 3300048925 Ga0496122_0000097 Ga0496122_0000097_77313_78083 250
232 3300048926 Ga0496123_0029402 Ga0496123_0029402_944_1714 250
233 3300048927 Ga0496124_0000019 Ga0496124_0000019_77320_78090 250
234 3300048928 Ga0496125_0000014 Ga0496125_0000014_77320_78090 250
235 3300048929 Ga0496126_0000017 Ga0496126_0000017_532587_533357 250
236 3300048929 Ga0496126_0059304 Ga0496126_0059304_1063_1818 250
237 3300049571 Ga0501034_0059563 Ga0501034_0059563_276_1058 250
238 3300049579 Ga0501043_0333361 Ga0501043_0333361_223_978 250
239 3300050490 nmdc:mga03n38_24393_c1 nmdc:mga03n38_24393_c1_1540_2295 250
240 3300050490 nmdc:mga03n38_78819_c1 nmdc:mga03n38_78819_c1_527_1282 250
241 3300050491 nmdc:mga00v17_161264_c1 nmdc:mga00v17_161264_c1_447_1202 250
242 3300050491 nmdc:mga00v17_2413_c1 nmdc:mga00v17_2413_c1_8724_9479 250
243 3300050491 nmdc:mga00v17_3084_c1 nmdc:mga00v17_3084_c1_507_1262 250
244 3300050491 nmdc:mga00v17_610_c1 nmdc:mga00v17_610_c1_1009_1764 250
245 3300050491 nmdc:mga00v17_7742_c2 nmdc:mga00v17_7742_c2_469_1224 250
246 3300050492 nmdc:mga0yw44_64568_c1 nmdc:mga0yw44_64568_c1_105_860 250
247 3300050494 nmdc:mga06z11_111279_c1 nmdc:mga06z11_111279_c1_569_1324 250
248 3300050494 nmdc:mga06z11_256899_c1 nmdc:mga06z11_256899_c1_84_839 250
249 3300050495 nmdc:mga04h51_21258_c1 nmdc:mga04h51_21258_c1_856_1611 250
250 3300050496 nmdc:mga07m45_110949_c1 nmdc:mga07m45_110949_c1_695_1450 250
251 3300050516 nmdc:mga0sz30_32770_c1 nmdc:mga0sz30_32770_c1_235_990 250
252 3300050516 nmdc:mga0sz30_64339_c1 nmdc:mga0sz30_64339_c1_254_1009 250
253 3300053087 Ga0500643_005328 Ga0500643_005328_3569_4324 250
254 3300053131 Ga0500652_048020 Ga0500652_048020_339_1094 250
255 3300053146 Ga0500588_0038768 Ga0500588_0038768_108_863 250
256 3300053730 Ga0500645_000006 Ga0500645_000006_65947_66702 250
257 iso_pu_bacteria 2738541264 2738665368 250
258 iso_pu_bacteria 2738541356 2739144502 250
259 3300001990 JGI24737J22298_10034751 JGI24737J22298_100347512 251
260 3300001991 JGI24743J22301_10002277 JGI24743J22301_100022773 251
261 3300002074 JGI24748J21848_1004168 JGI24748J21848_10041682 251
262 3300002077 JGI24744J21845_10000053 JGI24744J21845_100000538 251
263 3300002239 JGI24034J26672_10012446 JGI24034J26672_100124462 251
264 3300002244 JGI24742J22300_10001182 JGI24742J22300_100011822 251
265 3300003320 rootH2_10144049 rootH2_101440494 251
266 3300003322 rootL2_10131486 rootL2_101314862 251
267 3300003792 Ga0055540_1001685 Ga0055540_100168510 251
268 3300003792 Ga0055540_1003063 Ga0055540_10030638 251
269 3300003792 Ga0055540_1011186 Ga0055540_10111861 251
270 3300005327 Ga0070658_10067970 Ga0070658_100679702 251
271 3300005330 Ga0070690_100001292 Ga0070690_1000012927 251
272 3300005331 Ga0070670_100409606 Ga0070670_1004096061 251
273 3300005334 Ga0068869_100012633 Ga0068869_1000126334 251
274 3300005337 Ga0070682_100001916 Ga0070682_1000019168 251
275 3300005337 Ga0070682_100010417 Ga0070682_1000104176 251
276 3300005337 Ga0070682_100070943 Ga0070682_1000709432 251
277 3300005338 Ga0068868_100009639 Ga0068868_1000096396 251
278 3300005338 Ga0068868_100183131 Ga0068868_1001831312 251
279 3300005339 Ga0070660_100029280 Ga0070660_1000292802 251
280 3300005340 Ga0070689_100018207 Ga0070689_1000182076 251
281 3300005341 Ga0070691_10001466 Ga0070691_100014666 251
282 3300005345 Ga0070692_10160066 Ga0070692_101600662 251
283 3300005347 Ga0070668_100000358 Ga0070668_10000035820 251
284 3300005347 Ga0070668_100018368 Ga0070668_1000183685 251
285 3300005347 Ga0070668_100065415 Ga0070668_1000654152 251
286 3300005347 Ga0070668_100136161 Ga0070668_1001361611 251
287 3300005353 Ga0070669_100001662 Ga0070669_1000016626 251
288 3300005353 Ga0070669_100008249 Ga0070669_1000082493 251
289 3300005355 Ga0070671_100110992 Ga0070671_1001109924 251
290 3300005355 Ga0070671_100160681 Ga0070671_1001606812 251
291 3300005355 Ga0070671_100289776 Ga0070671_1002897762 251
292 3300005356 Ga0070674_100003807 Ga0070674_1000038078 251
293 3300005365 Ga0070688_100002128 Ga0070688_1000021288 251
294 3300005365 Ga0070688_100027921 Ga0070688_1000279212 251
295 3300005366 Ga0070659_100239859 Ga0070659_1002398592 251
296 3300005367 Ga0070667_100000075 Ga0070667_10000007538 251
297 3300005367 Ga0070667_100004048 Ga0070667_10000404810 251
298 3300005367 Ga0070667_100012854 Ga0070667_1000128546 251
299 3300005434 Ga0070709_10005095 Ga0070709_100050952 251
300 3300005434 Ga0070709_10046065 Ga0070709_100460655 251
301 3300005437 Ga0070710_10001540 Ga0070710_100015403 251
302 3300005439 Ga0070711_100001591 Ga0070711_1000015919 251
303 3300005439 Ga0070711_100063796 Ga0070711_1000637962 251
304 3300005441 Ga0070700_100014110 Ga0070700_1000141106 251
305 3300005441 Ga0070700_100022565 Ga0070700_1000225653 251
306 3300005444 Ga0070694_100018714 Ga0070694_1000187146 251
307 3300005444 Ga0070694_100061073 Ga0070694_1000610732 251
308 3300005455 Ga0070663_100002640 Ga0070663_1000026408 251
309 3300005455 Ga0070663_100576858 Ga0070663_1005768581 251
310 3300005456 Ga0070678_100001197 Ga0070678_1000011974 251
311 3300005457 Ga0070662_100010769 Ga0070662_1000107696 251
312 3300005457 Ga0070662_100297193 Ga0070662_1002971931 251
313 3300005459 Ga0068867_100006287 Ga0068867_1000062874 251
314 3300005466 Ga0070685_10057771 Ga0070685_100577712 251
315 3300005466 Ga0070685_10131527 Ga0070685_101315272 251
316 3300005539 Ga0068853_100064641 Ga0068853_1000646414 251
317 3300005543 Ga0070672_100459220 Ga0070672_1004592201 251
318 3300005544 Ga0070686_100279959 Ga0070686_1002799592 251
319 3300005545 Ga0070695_100040554 Ga0070695_1000405545 251
320 3300005546 Ga0070696_100003435 Ga0070696_1000034356 251
321 3300005546 Ga0070696_100127567 Ga0070696_1001275672 251
322 3300005547 Ga0070693_100032667 Ga0070693_1000326674 251
323 3300005548 Ga0070665_100005474 Ga0070665_1000054747 251
324 3300005548 Ga0070665_100006380 Ga0070665_1000063808 251
325 3300005548 Ga0070665_100259269 Ga0070665_1002592692 251
326 3300005548 Ga0070665_100319577 Ga0070665_1003195772 251
327 3300005549 Ga0070704_100000391 Ga0070704_10000039116 251
328 3300005549 Ga0070704_100036324 Ga0070704_1000363245 251
329 3300005563 Ga0068855_100113289 Ga0068855_1001132892 251
330 3300005563 Ga0068855_100146922 Ga0068855_1001469224 251
331 3300005578 Ga0068854_100071073 Ga0068854_1000710733 251
332 3300005615 Ga0070702_100001144 Ga0070702_1000011449 251
333 3300005615 Ga0070702_100498725 Ga0070702_1004987251 251
334 3300005617 Ga0068859_100000606 Ga0068859_10000060618 251
335 3300005617 Ga0068859_100003251 Ga0068859_1000032518 251
336 3300005618 Ga0068864_100046674 Ga0068864_1000466742 251
337 3300005718 Ga0068866_10069786 Ga0068866_100697862 251
338 3300005719 Ga0068861_100337538 Ga0068861_1003375382 251
339 3300005841 Ga0068863_100002748 Ga0068863_1000027482 251
340 3300005841 Ga0068863_100051087 Ga0068863_1000510876 251
341 3300005842 Ga0068858_100001109 Ga0068858_1000011098 251
342 3300005842 Ga0068858_100106992 Ga0068858_1001069922 251
343 3300005843 Ga0068860_100000025 Ga0068860_100000025153 251
344 3300005843 Ga0068860_100012429 Ga0068860_1000124298 251
345 3300005844 Ga0068862_100000045 Ga0068862_100000045153 251
346 3300005844 Ga0068862_100001869 Ga0068862_10000186913 251
347 3300005844 Ga0068862_100186010 Ga0068862_1001860102 251
348 3300005844 Ga0068862_100340792 Ga0068862_1003407922 251
349 3300005937 Ga0081455_10093207 Ga0081455_100932074 251
350 3300005981 Ga0081538_10043770 Ga0081538_100437704 251
351 3300006038 Ga0075365_10028768 Ga0075365_100287683 251
352 3300006038 Ga0075365_10345155 Ga0075365_103451552 251
353 3300006042 Ga0075368_10001245 Ga0075368_100012456 251
354 3300006042 Ga0075368_10010130 Ga0075368_100101304 251
355 3300006048 Ga0075363_100000597 Ga0075363_1000005979 251
356 3300006048 Ga0075363_100009537 Ga0075363_1000095372 251
357 3300006048 Ga0075363_100157541 Ga0075363_1001575412 251
358 3300006051 Ga0075364_10004468 Ga0075364_100044682 251
359 3300006051 Ga0075364_10020193 Ga0075364_100201935 251
360 3300006051 Ga0075364_10265141 Ga0075364_102651411 251
361 3300006163 Ga0070715_10030963 Ga0070715_100309632 251
362 3300006163 Ga0070715_10095474 Ga0070715_100954742 251
363 3300006173 Ga0070716_100001115 Ga0070716_1000011156 251
364 3300006173 Ga0070716_100013982 Ga0070716_1000139822 251
365 3300006175 Ga0070712_100313096 Ga0070712_1003130962 251
366 3300006177 Ga0075362_10008504 Ga0075362_100085043 251
367 3300006178 Ga0075367_10009955 Ga0075367_100099554 251
368 3300006178 Ga0075367_10066186 Ga0075367_100661863 251
369 3300006178 Ga0075367_10102484 Ga0075367_101024842 251
370 3300006178 Ga0075367_10389158 Ga0075367_103891582 251
371 3300006186 Ga0075369_10004473 Ga0075369_100044735 251
372 3300006186 Ga0075369_10013887 Ga0075369_100138873 251
373 3300006237 Ga0097621_100054694 Ga0097621_1000546943 251
374 3300006353 Ga0075370_10002478 Ga0075370_100024787 251
375 3300006353 Ga0075370_10022644 Ga0075370_100226442 251
376 3300006353 Ga0075370_10075269 Ga0075370_100752692 251
377 3300006353 Ga0075370_10077069 Ga0075370_100770691 251
378 3300006358 Ga0068871_100205001 Ga0068871_1002050013 251
379 3300006844 Ga0075428_100004846 Ga0075428_1000048467 251
380 3300006846 Ga0075430_100077655 Ga0075430_1000776552 251
381 3300006847 Ga0075431_100009857 Ga0075431_1000098573 251
382 3300006880 Ga0075429_100156557 Ga0075429_1001565572 251
383 3300006931 Ga0097620_100000606 Ga0097620_10000060618 251
384 3300006931 Ga0097620_100003251 Ga0097620_1000032518 251
385 3300007788 Ga0099795_10007788 Ga0099795_100077883 251
386 3300009092 Ga0105250_10151479 Ga0105250_101514792 251
387 3300009098 Ga0105245_10002903 Ga0105245_1000290314 251
388 3300009098 Ga0105245_10831686 Ga0105245_108316862 251
389 3300009101 Ga0105247_10000010 Ga0105247_10000010181 251
390 3300009101 Ga0105247_10000366 Ga0105247_1000036633 251
391 3300009147 Ga0114129_10005689 Ga0114129_1000568917 251
392 3300009148 Ga0105243_10001450 Ga0105243_1000145013 251
393 3300009148 Ga0105243_10060285 Ga0105243_100602855 251
394 3300009176 Ga0105242_10004714 Ga0105242_100047142 251
395 3300009177 Ga0105248_10000145 Ga0105248_1000014551 251
396 3300009177 Ga0105248_10002194 Ga0105248_1000219411 251
397 3300009177 Ga0105248_10152352 Ga0105248_101523523 251
398 3300009177 Ga0105248_10169093 Ga0105248_101690932 251
399 3300009545 Ga0105237_10001648 Ga0105237_1000164816 251
400 3300009545 Ga0105237_10025835 Ga0105237_100258357 251
401 3300009551 Ga0105238_10344128 Ga0105238_103441282 251
402 3300009553 Ga0105249_10000010 Ga0105249_10000010176 251
403 3300009553 Ga0105249_10039645 Ga0105249_100396455 251
404 3300009553 Ga0105249_10767213 Ga0105249_107672132 251
405 3300010159 Ga0099796_10009296 Ga0099796_100092962 251
406 3300010375 Ga0105239_10020241 Ga0105239_100202415 251
407 3300010375 Ga0105239_10152069 Ga0105239_101520692 251
408 3300010375 Ga0105239_10772287 Ga0105239_107722872 251
409 3300011119 Ga0105246_10070009 Ga0105246_100700095 251
410 3300013105 Ga0157369_10128021 Ga0157369_101280214 251
411 3300013296 Ga0157374_10124344 Ga0157374_101243444 251
412 3300013297 Ga0157378_10001442 Ga0157378_1000144212 251
413 3300013297 Ga0157378_10169980 Ga0157378_101699802 251
414 3300013306 Ga0163162_10002768 Ga0163162_1000276810 251
415 3300013307 Ga0157372_10009077 Ga0157372_100090778 251
416 3300013308 Ga0157375_10001272 Ga0157375_1000127214 251
417 3300013308 Ga0157375_10018997 Ga0157375_100189974 251
418 3300013308 Ga0157375_10064643 Ga0157375_100646436 251
419 3300014325 Ga0163163_10238755 Ga0163163_102387552 251
420 3300014326 Ga0157380_10000302 Ga0157380_1000030221 251
421 3300014745 Ga0157377_10064134 Ga0157377_100641342 251
422 3300014745 Ga0157377_10119012 Ga0157377_101190122 251
423 3300014968 Ga0157379_10002729 Ga0157379_100027291 251
424 3300014968 Ga0157379_10520261 Ga0157379_105202612 251
425 3300014969 Ga0157376_10388622 Ga0157376_103886222 251
426 3300017792 Ga0163161_10000799 Ga0163161_1000079911 251
427 3300021388 Ga0213875_10014036 Ga0213875_100140363 251
428 3300025273 Ga0209673_1013423 Ga0209673_10134233 251
429 3300025273 Ga0209673_1037922 Ga0209673_10379222 251
430 3300025303 Ga0209051_1000613 Ga0209051_100061312 251
431 3300025303 Ga0209051_1004881 Ga0209051_10048816 251
432 3300025303 Ga0209051_1021120 Ga0209051_10211201 251
433 3300025303 Ga0209051_1033181 Ga0209051_10331813 251
434 3300025893 Ga0207682_10044059 Ga0207682_100440593 251
435 3300025899 Ga0207642_10000143 Ga0207642_1000014313 251
436 3300025899 Ga0207642_10011054 Ga0207642_100110543 251
437 3300025900 Ga0207710_10000028 Ga0207710_10000028183 251
438 3300025900 Ga0207710_10001961 Ga0207710_100019618 251
439 3300025901 Ga0207688_10000090 Ga0207688_1000009027 251
440 3300025903 Ga0207680_10027001 Ga0207680_100270015 251
441 3300025904 Ga0207647_10076037 Ga0207647_100760372 251
442 3300025905 Ga0207685_10005331 Ga0207685_100053312 251
443 3300025906 Ga0207699_10012071 Ga0207699_100120713 251
444 3300025907 Ga0207645_10027091 Ga0207645_100270913 251
445 3300025909 Ga0207705_10052540 Ga0207705_100525402 251
446 3300025911 Ga0207654_10146511 Ga0207654_101465112 251
447 3300025914 Ga0207671_10007464 Ga0207671_100074647 251
448 3300025914 Ga0207671_10225188 Ga0207671_102251882 251
449 3300025914 Ga0207671_10256277 Ga0207671_102562772 251
450 3300025915 Ga0207693_10000555 Ga0207693_100005558 251
451 3300025915 Ga0207693_10002064 Ga0207693_100020649 251
452 3300025916 Ga0207663_10002170 Ga0207663_100021708 251
453 3300025916 Ga0207663_10016673 Ga0207663_100166735 251
454 3300025919 Ga0207657_10023644 Ga0207657_100236445 251
455 3300025919 Ga0207657_10182161 Ga0207657_101821612 251
456 3300025923 Ga0207681_10006072 Ga0207681_100060725 251
457 3300025923 Ga0207681_10202684 Ga0207681_102026842 251
458 3300025923 Ga0207681_10363242 Ga0207681_103632422 251
459 3300025924 Ga0207694_10177770 Ga0207694_101777703 251
460 3300025927 Ga0207687_10118500 Ga0207687_101185002 251
461 3300025931 Ga0207644_10100117 Ga0207644_101001172 251
462 3300025931 Ga0207644_10117672 Ga0207644_101176722 251
463 3300025932 Ga0207690_10066555 Ga0207690_100665552 251
464 3300025932 Ga0207690_10090838 Ga0207690_100908383 251
465 3300025933 Ga0207706_10005251 Ga0207706_100052516 251
466 3300025933 Ga0207706_10016540 Ga0207706_100165406 251
467 3300025934 Ga0207686_10001099 Ga0207686_100010998 251
468 3300025934 Ga0207686_10006362 Ga0207686_100063626 251
469 3300025935 Ga0207709_10002258 Ga0207709_100022588 251
470 3300025935 Ga0207709_10020594 Ga0207709_100205943 251
471 3300025936 Ga0207670_10029755 Ga0207670_100297552 251
472 3300025937 Ga0207669_10000752 Ga0207669_100007529 251
473 3300025938 Ga0207704_10000393 Ga0207704_100003937 251
474 3300025938 Ga0207704_10292331 Ga0207704_102923312 251
475 3300025939 Ga0207665_10001801 Ga0207665_100018019 251
476 3300025939 Ga0207665_10003000 Ga0207665_100030006 251
477 3300025940 Ga0207691_10092066 Ga0207691_100920664 251
478 3300025941 Ga0207711_10000069 Ga0207711_1000006923 251
479 3300025941 Ga0207711_10019795 Ga0207711_100197953 251
480 3300025942 Ga0207689_10022958 Ga0207689_100229583 251
481 3300025949 Ga0207667_10168052 Ga0207667_101680523 251
482 3300025961 Ga0207712_10000016 Ga0207712_10000016177 251
483 3300025972 Ga0207668_10005693 Ga0207668_100056935 251
484 3300025972 Ga0207668_10011820 Ga0207668_100118204 251
485 3300025981 Ga0207640_10036129 Ga0207640_100361292 251
486 3300025981 Ga0207640_10085728 Ga0207640_100857283 251
487 3300025986 Ga0207658_10000237 Ga0207658_1000023718 251
488 3300025986 Ga0207658_10002082 Ga0207658_100020829 251
489 3300026023 Ga0207677_10003455 Ga0207677_100034554 251
490 3300026035 Ga0207703_10044415 Ga0207703_100444152 251
491 3300026035 Ga0207703_10054887 Ga0207703_100548873 251
492 3300026041 Ga0207639_10003107 Ga0207639_100031076 251
493 3300026067 Ga0207678_10003318 Ga0207678_1000331815 251
494 3300026067 Ga0207678_10011227 Ga0207678_100112277 251
495 3300026067 Ga0207678_10013849 Ga0207678_100138492 251
496 3300026067 Ga0207678_10071204 Ga0207678_100712044 251
497 3300026075 Ga0207708_10006978 Ga0207708_100069787 251
498 3300026088 Ga0207641_10001368 Ga0207641_1000136829 251
499 3300026088 Ga0207641_10025646 Ga0207641_100256463 251
500 3300026089 Ga0207648_10000349 Ga0207648_1000034924 251
501 3300026095 Ga0207676_10094326 Ga0207676_100943262 251
502 3300026118 Ga0207675_100006409 Ga0207675_10000640911 251
503 3300026118 Ga0207675_100014856 Ga0207675_1000148562 251
504 3300026121 Ga0207683_10000040 Ga0207683_1000004055 251
505 3300026121 Ga0207683_10079665 Ga0207683_100796653 251
506 3300027512 Ga0209179_1031603 Ga0209179_10316031 251
507 3300027866 Ga0209813_10011469 Ga0209813_100114693 251
508 3300028379 Ga0268266_10002967 Ga0268266_100029673 251
509 3300028379 Ga0268266_10005675 Ga0268266_100056758 251
510 3300028379 Ga0268266_10036703 Ga0268266_100367034 251
511 3300028379 Ga0268266_10139919 Ga0268266_101399192 251
512 3300028380 Ga0268265_10000056 Ga0268265_10000056147 251
513 3300028380 Ga0268265_10005589 Ga0268265_100055896 251
514 3300028381 Ga0268264_10000053 Ga0268264_10000053177 251
515 3300031824 Ga0307413_10069929 Ga0307413_100699292 251
516 3300031824 Ga0307413_10170437 Ga0307413_101704371 251
517 3300031852 Ga0307410_10034781 Ga0307410_100347812 251
518 3300031903 Ga0307407_10122973 Ga0307407_101229731 251
519 3300031911 Ga0307412_10142258 Ga0307412_101422582 251
520 3300031995 Ga0307409_100041086 Ga0307409_1000410862 251
521 3300032002 Ga0307416_100659608 Ga0307416_1006596081 251
522 3300032002 Ga0307416_101085556 Ga0307416_1010855561 251
523 3300032005 Ga0307411_10019423 Ga0307411_100194232 251
524 3300032126 Ga0307415_100035856 Ga0307415_1000358562 251
525 3300035092 Ga0373952_0085084 Ga0373952_0085084_20_778 251
526 3300035114 Ga0373939_0022264 Ga0373939_0022264_729_1487 251
527 3300035121 Ga0373960_0036861 Ga0373960_0036861_187_945 251
528 3300035241 Ga0373961_0051478 Ga0373961_0051478_338_1096 251
529 3300035691 Ga0373931_0045619 Ga0373931_0045619_588_1349 251
530 3300035691 Ga0373931_0093273 Ga0373931_0093273_306_1064 251
531 3300035692 Ga0373935_0555988 Ga0373935_0555988_55_822 251
532 3300036647 Ga0316582_0012630 Ga0316582_0012630_57_815 251
533 3300037418 Ga0395900_0057306 Ga0395900_0057306_1053_1838 251
534 3300037418 Ga0395900_0300231 Ga0395900_0300231_787_1572 251
535 3300037466 Ga0395898_0050328 Ga0395898_0050328_2151_2936 251
536 3300037466 Ga0395898_0275014 Ga0395898_0275014_54_830 251
537 3300037471 Ga0395905_0049703 Ga0395905_0049703_2910_3695 251
538 3300037853 Ga0436364_0142680 Ga0436364_0142680_3824_4609 251
539 3300038443 Ga0395901_0299200 Ga0395901_0299200_248_1033 251
540 3300039437 Ga0436365_0662080 Ga0436365_0662080_4738_5523 251
541 3300041411 Ga0439466_0005991 Ga0439466_0005991_74_859 251
542 3300041411 Ga0439466_0007929 Ga0439466_0007929_129_896 251
543 3300041413 Ga0439465_0000439 Ga0439465_0000439_8246_9013 251
544 3300041413 Ga0439465_0004076 Ga0439465_0004076_1991_2752 251
545 3300041413 Ga0439465_0011408 Ga0439465_0011408_639_1433 251
546 3300041459 Ga0451800_0101687 Ga0451800_0101687_638_1405 251
547 3300041498 Ga0451841_1098966 Ga0451841_1098966_305_1069 251
548 3300041509 Ga0451843_0775765 Ga0451843_0775765_262_1080 251
549 3300041512 Ga0451853_3507486 Ga0451853_3507486_218_982 251
550 3300041997 Ga0439431_0001548 Ga0439431_0001548_2607_3392 251
551 3300041997 Ga0439431_0031811 Ga0439431_0031811_444_1268 251
552 3300042002 Ga0439442_007871 Ga0439442_007871_736_1521 251
553 3300042004 Ga0439445_0023205 Ga0439445_0023205_404_1171 251
554 3300042004 Ga0439445_0030949 Ga0439445_0030949_107_931 251
555 3300042006 Ga0439432_012691 Ga0439432_012691_665_1459 251
556 3300042438 Ga0439459_0006870 Ga0439459_0006870_755_1513 251
557 3300044658 Ga0466972_0003077 Ga0466972_0003077_641_1429 251
558 3300044658 Ga0466972_0003605 Ga0466972_0003605_3736_4500 251
559 3300044658 Ga0466972_0019824 Ga0466972_0019824_1107_1892 251
560 3300044658 Ga0466972_0083631 Ga0466972_0083631_458_1222 251
561 3300044683 Ga0466965_0001504 Ga0466965_0001504_5166_5930 251
562 3300044683 Ga0466965_0019122 Ga0466965_0019122_1082_1867 251
563 3300044683 Ga0466965_0055260 Ga0466965_0055260_1109_1897 251
564 3300044683 Ga0466965_0099532 Ga0466965_0099532_122_880 251
565 3300044684 Ga0466966_0005329 Ga0466966_0005329_1826_2584 251
566 3300044684 Ga0466966_0033633 Ga0466966_0033633_642_1400 251
567 3300044684 Ga0466966_0131190 Ga0466966_0131190_301_1089 251
568 3300044693 Ga0466961_0003903 Ga0466961_0003903_4197_4955 251
569 3300044693 Ga0466961_0055195 Ga0466961_0055195_625_1413 251
570 3300044706 Ga0466964_0056249 Ga0466964_0056249_521_1282 251
571 3300044719 Ga0466971_0008487 Ga0466971_0008487_2327_3115 251
572 3300044735 Ga0466968_0008896 Ga0466968_0008896_602_1366 251
573 3300044735 Ga0466968_0061591 Ga0466968_0061591_14_772 251
574 3300044735 Ga0466968_0120096 Ga0466968_0120096_155_943 251
575 3300044765 Ga0466970_0008022 Ga0466970_0008022_4009_4797 251
576 3300044765 Ga0466970_0078052 Ga0466970_0078052_400_1164 251
577 3300044842 Ga0466957_0004906 Ga0466957_0004906_4258_5016 251
578 3300044842 Ga0466957_0006947 Ga0466957_0006947_1163_1951 251
579 3300044842 Ga0466957_0153895 Ga0466957_0153895_307_1065 251
580 3300044901 Ga0466960_0000196 Ga0466960_0000196_16282_17046 251
581 3300044901 Ga0466960_0122136 Ga0466960_0122136_495_1256 251
582 3300044901 Ga0466960_0129642 Ga0466960_0129642_509_1267 251
583 3300045049 Ga0466959_0002337 Ga0466959_0002337_4436_5224 251
584 3300045049 Ga0466959_0003100 Ga0466959_0003100_7496_8254 251
585 3300045049 Ga0466959_0072859 Ga0466959_0072859_1015_1779 251
586 3300045836 Ga0466958_0019584 Ga0466958_0019584_1402_2160 251
587 3300045836 Ga0466958_0051352 Ga0466958_0051352_547_1335 251
588 3300045836 Ga0466958_0099092 Ga0466958_0099092_927_1715 251
589 3300045976 Ga0466967_0001060 Ga0466967_0001060_2118_2876 251
590 3300045976 Ga0466967_0032737 Ga0466967_0032737_2840_3601 251
591 3300045976 Ga0466967_0125613 Ga0466967_0125613_18_776 251
592 3300045976 Ga0466967_0166095 Ga0466967_0166095_38_826 251
593 3300046460 Ga0495638_0006330 Ga0495638_0006330_7344_8102 251
594 3300046473 Ga0495582_0064951 Ga0495582_0064951_1212_1979 251
595 3300046475 Ga0495639_0017325 Ga0495639_0017325_1968_2735 251
596 3300046499 Ga0495594_0045363 Ga0495594_0045363_840_1607 251
597 3300046511 Ga0495608_0144126 Ga0495608_0144126_581_1348 251
598 3300046524 Ga0495648_0000628 Ga0495648_0000628_20937_21695 251
599 3300046559 Ga0495667_0314143 Ga0495667_0314143_113_880 251
600 3300046616 Ga0495668_0008297 Ga0495668_0008297_4530_5288 251
601 3300046683 Ga0495658_0165704 Ga0495658_0165704_324_1091 251
602 3300046689 Ga0495613_0208294 Ga0495613_0208294_284_1051 251
603 3300046690 Ga0495624_0046221 Ga0495624_0046221_363_1130 251
604 3300046694 Ga0495649_0120509 Ga0495649_0120509_577_1335 251
605 3300047315 Ga0495581_0141405 Ga0495581_0141405_471_1238 251
606 3300047320 Ga0495672_0008575 Ga0495672_0008575_5562_6320 251
607 3300047320 Ga0495672_0030035 Ga0495672_0030035_847_1608 251
608 3300047321 Ga0495676_0041533 Ga0495676_0041533_1031_1798 251
609 3300047469 Ga0495673_0002027 Ga0495673_0002027_13379_14137 251
610 3300047673 Ga0495593_0026483 Ga0495593_0026483_1012_1779 251
611 3300048089 Ga0495614_0131684 Ga0495614_0131684_319_1086 251
612 3300048903 Ga0496100_0005195 Ga0496100_0005195_1226_1987 251
613 3300048903 Ga0496100_0009828 Ga0496100_0009828_406_1164 251
614 3300048903 Ga0496100_0142140 Ga0496100_0142140_227_1018 251
615 3300048904 Ga0496101_0000066 Ga0496101_0000066_100474_101232 251
616 3300048904 Ga0496101_0002316 Ga0496101_0002316_4990_5751 251
617 3300048904 Ga0496101_0038619 Ga0496101_0038619_2202_2960 251
618 3300048904 Ga0496101_0060971 Ga0496101_0060971_793_1584 251
619 3300048904 Ga0496101_0132603 Ga0496101_0132603_859_1617 251
620 3300048904 Ga0496101_0270294 Ga0496101_0270294_38_796 251
621 3300048905 Ga0496102_0000035 Ga0496102_0000035_52438_53196 251
622 3300048905 Ga0496102_0000070 Ga0496102_0000070_79870_80661 251
623 3300048905 Ga0496102_0000600 Ga0496102_0000600_5894_6655 251
624 3300048905 Ga0496102_0004697 Ga0496102_0004697_5090_5848 251
625 3300048905 Ga0496102_0124712 Ga0496102_0124712_1102_1860 251
626 3300048905 Ga0496102_0146132 Ga0496102_0146132_116_874 251
627 3300048906 Ga0496103_0000028 Ga0496103_0000028_160465_161223 251
628 3300048906 Ga0496103_0000477 Ga0496103_0000477_21304_22095 251
629 3300048906 Ga0496103_0000667 Ga0496103_0000667_12844_13605 251
630 3300048906 Ga0496103_0023011 Ga0496103_0023011_1340_2098 251
631 3300048907 Ga0496104_0026704 Ga0496104_0026704_3438_4196 251
632 3300048907 Ga0496104_0078845 Ga0496104_0078845_1813_2571 251
633 3300048908 Ga0496105_0049701 Ga0496105_0049701_672_1430 251
634 3300048908 Ga0496105_0049975 Ga0496105_0049975_1395_2153 251
635 3300048909 Ga0496106_0002066 Ga0496106_0002066_765_1523 251
636 3300048909 Ga0496106_0010257 Ga0496106_0010257_5297_6058 251
637 3300048909 Ga0496106_0010815 Ga0496106_0010815_1549_2307 251
638 3300048909 Ga0496106_0153804 Ga0496106_0153804_609_1400 251
639 3300048910 Ga0496107_0001051 Ga0496107_0001051_11722_12480 251
640 3300048910 Ga0496107_0002661 Ga0496107_0002661_2347_3108 251
641 3300048910 Ga0496107_0028337 Ga0496107_0028337_840_1631 251
642 3300048910 Ga0496107_0047928 Ga0496107_0047928_1181_1939 251
643 3300048912 Ga0496109_0005948 Ga0496109_0005948_3541_4296 251
644 3300048912 Ga0496109_0150578 Ga0496109_0150578_38_796 251
645 3300048912 Ga0496109_0202851 Ga0496109_0202851_1009_1776 251
646 3300048913 Ga0496110_0130988 Ga0496110_0130988_600_1358 251
647 3300048914 Ga0496111_0269813 Ga0496111_0269813_64_822 251
648 3300048915 Ga0496112_0041494 Ga0496112_0041494_330_1085 251
649 3300048915 Ga0496112_0047543 Ga0496112_0047543_40_798 251
650 3300048915 Ga0496112_0104600 Ga0496112_0104600_787_1554 251
651 3300048916 Ga0496113_0031777 Ga0496113_0031777_193_951 251
652 3300048916 Ga0496113_0125836 Ga0496113_0125836_546_1313 251
653 3300048917 Ga0496114_0001610 Ga0496114_0001610_1972_2733 251
654 3300048917 Ga0496114_0004619 Ga0496114_0004619_7640_8398 251
655 3300048917 Ga0496114_0136658 Ga0496114_0136658_267_1025 251
656 3300048918 Ga0496115_0009272 Ga0496115_0009272_1177_1935 251
657 3300048918 Ga0496115_0028041 Ga0496115_0028041_336_1097 251
658 3300048919 Ga0496116_0000090 Ga0496116_0000090_52438_53196 251
659 3300048920 Ga0496117_0000051 Ga0496117_0000051_52438_53196 251
660 3300048920 Ga0496117_0001117 Ga0496117_0001117_18456_19247 251
661 3300048921 Ga0496118_0000043 Ga0496118_0000043_52438_53196 251
662 3300048921 Ga0496118_0004850 Ga0496118_0004850_11859_12650 251
663 3300048922 Ga0496119_0000559 Ga0496119_0000559_31584_32342 251
664 3300048922 Ga0496119_0016323 Ga0496119_0016323_1311_2102 251
665 3300048923 Ga0496120_0001323 Ga0496120_0001323_18089_18847 251
666 3300048923 Ga0496120_0015370 Ga0496120_0015370_365_1156 251
667 3300048924 Ga0496121_0000080 Ga0496121_0000080_91996_92754 251
668 3300048924 Ga0496121_0002543 Ga0496121_0002543_22474_23265 251
669 3300048928 Ga0496125_0010205 Ga0496125_0010205_5458_6249 251
670 3300048929 Ga0496126_0001251 Ga0496126_0001251_22795_23553 251
671 3300048929 Ga0496126_0035353 Ga0496126_0035353_2551_3342 251
672 3300048929 Ga0496126_0348160 Ga0496126_0348160_83_841 251
673 3300049569 Ga0501032_0330946 Ga0501032_0330946_167_925 251
674 3300049571 Ga0501034_0037887 Ga0501034_0037887_3952_4785 251
675 3300049571 Ga0501034_0098340 Ga0501034_0098340_251_1009 251
676 3300049571 Ga0501034_0285927 Ga0501034_0285927_700_1458 251
677 3300049571 Ga0501034_0346917 Ga0501034_0346917_217_1020 251
678 3300049572 Ga0501036_0485487 Ga0501036_0485487_172_930 251
679 3300049573 Ga0501037_0058868 Ga0501037_0058868_320_1078 251
680 3300049581 Ga0501047_0007852 Ga0501047_0007852_4380_5138 251
681 3300049581 Ga0501047_0319834 Ga0501047_0319834_183_944 251
682 3300049581 Ga0501047_0609553 Ga0501047_0609553_103_861 251
683 3300049585 Ga0501069_0223094 Ga0501069_0223094_281_1054 251
684 3300049586 Ga0501070_0063913 Ga0501070_0063913_482_1255 251
685 3300049586 Ga0501070_0164745 Ga0501070_0164745_192_980 251
686 3300049586 Ga0501070_0334328 Ga0501070_0334328_197_955 251
687 3300049742 Ga0501080_0294953 Ga0501080_0294953_231_989 251
688 3300049822 Ga0501035_0005928 Ga0501035_0005928_1216_1974 251
689 3300049823 Ga0501044_0000498 Ga0501044_0000498_29521_30279 251
690 3300050489 nmdc:mga03683_72136_c1 nmdc:mga03683_72136_c1_543_1301 251
691 3300050490 nmdc:mga03n38_112684_c1 nmdc:mga03n38_112684_c1_409_1167 251
692 3300050490 nmdc:mga03n38_2523_c1 nmdc:mga03n38_2523_c1_4112_4897 251
693 3300050490 nmdc:mga03n38_51520_c1 nmdc:mga03n38_51520_c1_766_1539 251
694 3300050490 nmdc:mga03n38_68444_c1 nmdc:mga03n38_68444_c1_63_821 251
695 3300050490 nmdc:mga03n38_69778_c1 nmdc:mga03n38_69778_c1_569_1342 251
696 3300050491 nmdc:mga00v17_337218_c1 nmdc:mga00v17_337218_c1_147_920 251
697 3300050491 nmdc:mga00v17_78484_c1 nmdc:mga00v17_78484_c1_582_1355 251
698 3300050491 nmdc:mga00v17_89944_c1 nmdc:mga00v17_89944_c1_821_1594 251
699 3300050491 nmdc:mga00v17_97515_c1 nmdc:mga00v17_97515_c1_804_1562 251
700 3300050492 nmdc:mga0yw44_130534_c1 nmdc:mga0yw44_130534_c1_798_1556 251
701 3300050492 nmdc:mga0yw44_15867_c1 nmdc:mga0yw44_15867_c1_2535_3308 251
702 3300050492 nmdc:mga0yw44_34572_c1 nmdc:mga0yw44_34572_c1_1448_2221 251
703 3300050492 nmdc:mga0yw44_379501_c1 nmdc:mga0yw44_379501_c1_126_911 251
704 3300050492 nmdc:mga0yw44_87803_c1 nmdc:mga0yw44_87803_c1_801_1574 251
705 3300050494 nmdc:mga06z11_31398_c1 nmdc:mga06z11_31398_c1_1612_2385 251
706 3300050494 nmdc:mga06z11_57800_c1 nmdc:mga06z11_57800_c1_494_1267 251
707 3300050496 nmdc:mga07m45_245785_c1 nmdc:mga07m45_245785_c1_210_983 251
708 3300050496 nmdc:mga07m45_41367_c1 nmdc:mga07m45_41367_c1_1682_2455 251
709 3300050496 nmdc:mga07m45_84516_c1 nmdc:mga07m45_84516_c1_193_966 251
710 3300050507 nmdc:mga05p37_112745_c1 nmdc:mga05p37_112745_c1_281_1039 251
711 3300050509 nmdc:mga0qj67_28056_c1 nmdc:mga0qj67_28056_c1_3320_4078 251
712 3300050510 nmdc:mga06r32_5670_c1 nmdc:mga06r32_5670_c1_4128_4886 251
713 3300050516 nmdc:mga0sz30_49651_c1 nmdc:mga0sz30_49651_c1_582_1343 251
714 3300050516 nmdc:mga0sz30_6965_c1 nmdc:mga0sz30_6965_c1_1919_2680 251
715 3300050516 nmdc:mga0sz30_89985_c1 nmdc:mga0sz30_89985_c1_181_939 251
716 3300053077 Ga0495601_0250421 Ga0495601_0250421_282_1049 251
717 3300053080 Ga0500635_0045829 Ga0500635_0045829_80_838 251
718 3300053087 Ga0500643_009356 Ga0500643_009356_1626_2384 251
719 3300053088 Ga0500644_0000014 Ga0500644_0000014_3469_4242 251
720 3300053096 Ga0500641_0019573 Ga0500641_0019573_1228_2016 251
721 3300053104 Ga0500556_0001691 Ga0500556_0001691_5210_5995 251
722 3300053117 Ga0500593_000305 Ga0500593_000305_8436_9221 251
723 3300053131 Ga0500652_014947 Ga0500652_014947_42_800 251
724 3300061719 Ga0466962_0010692 Ga0466962_0010692_755_1543 251
725 iso_pu_bacteria 2939582691 2939585497 251

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

21

273

0.96

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

26

262

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qmj-assembly1.cif.gz_A crystal structure of enoyl-coa hydratase echa8_6 from mycobacterium marinum 0.9808 1 213
3qmj-assembly1.cif.gz_A crystal structure of enoyl-coa hydratase echa8_6 from mycobacterium marinum 0.9762 1 213
5ve2-assembly3.cif.gz_I crystal structure of enoyl-coa hydratase/isomerase from pseudoalteromonas atlantica t6c at 2.3 a resolution. 0.9578 1 248
5ve2-assembly1.cif.gz_A crystal structure of enoyl-coa hydratase/isomerase from pseudoalteromonas atlantica t6c at 2.3 a resolution. 0.9538 1 248
3fdu-assembly2.cif.gz_F crystal structure of a putative enoyl-coa hydratase/isomerase from acinetobacter baumannii 0.9442 3 231
ID Description Score Start End Superfamily
3qmjA00 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9808 1 213 3.90.226.10
3qmjA00 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9762 1 213 3.90.226.10
3rsiC01 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3; 0.9678 2 55 3.30.300.220
5ve2I00 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9555 1 248 3.90.226.10
3fduF00 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9442 3 231 3.90.226.10
ID Description Score Start End GO Terms
AF-A0A7X7D5G8-F1-model_v4 Enoyl-CoA hydratase/isomerase family protein 0.9852 2 248 GO:0004165
GO:0005777
AF-A0A351DFT1-F1-model_v4 Crotonase 0.9849 3 240 GO:0004165
GO:0005777
AF-A0A7K1BM03-F1-model_v4 Enoyl-CoA hydratase/isomerase family protein 0.9776 3 197 GO:0004165
GO:0005777
AF-A0A2E9XBP0-F1-model_v4 Crotonase 0.9699 2 248 GO:0004165
GO:0005777
AF-A0A351DFT1-F1-model_v4 Crotonase 0.9688 3 240 GO:0004165
GO:0005777

Feature Viewer

pLDDT pTM Quality
91.24 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map