F477641
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 725 | 343 | 691 | 253 |
Family's Representative Sequence
| Representative Sequence | 3300049571|Ga0501034_0037887|Ga0501034_0037887_3952_4785 |
| Length | 277 |
| Sequence | MTTELDQADQAASAEAAVLVHDESRVRTLTLNRPDALNACNEALYDALTNGLLEAAADPGIAVVLLTGAGRAFCAGTDLVEMAARVMDPDNFVEGEHGFLGLIDALTAFPKPLVIAVNGLGLGIGATILGFADLVFMSTEAKLKCPFTSLAVAPEAASSLLFPQLIGRQNATWMLLSSEWISAAEAKEMGLVWKLTEPDELLPAARQHAEHLAALPISSLVACKRVITEPLRTQIEAARQRENDAFVELLGSPANLEAFAAFAEGRKPNFVDLPGGD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221576 | Nocardioides sp. Root614 | Isolate | Unclassified |
| 2 | 2643221590 | Nocardioides sp. Root682 | Isolate | Unclassified |
| 3 | 2643221604 | Nocardioides sp. Root190 | Isolate | Unclassified |
| 4 | 2643221615 | Nocardioides sp. Root224 | Isolate | Unclassified |
| 5 | 2643221617 | Nocardioides sp. Root79 | Isolate | Unclassified |
| 6 | 2643221620 | Nocardioides sp. Root240 | Isolate | Unclassified |
| 7 | 2643221657 | Nocardioides sp. Root1257 | Isolate | Unclassified |
| 8 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 9 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 10 | 2738541264 | Mycobacterium sp. OK889 | Isolate | Unclassified |
| 11 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 12 | 2738541305 | Nocardioides sp. CF167 | Isolate | Unclassified |
| 13 | 2738541356 | Mycobacterium sp. OK887 | Isolate | Unclassified |
| 14 | 2738543005 | Rhodococcus sp. OK519 | Isolate | Unclassified |
| 15 | 2738543011 | Rhodococcus sp. OK611 | Isolate | Unclassified |
| 16 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 17 | 2744054611 | Aldersonia kunmingensis DSM 45001 | Isolate | Rhizosphere |
| 18 | 2773857762 | Nocardioides sp. SAI-095 | Isolate | Unclassified |
| 19 | 2808606439 | Nocardioides sp. SLBN-172 | Isolate | Unclassified |
| 20 | 2811994874 | Nocardioides sp. SLBN-35 | Isolate | Unclassified |
| 21 | 2811994878 | Nocardioides sp. SLBN-169 | Isolate | Unclassified |
| 22 | 2842134933 | Mycolicibacterium obuense SEMIA 442 | Isolate | Nodule |
| 23 | 2855386786 | Nocardioides ferulae EGI 63112 | Isolate | Unclassified |
| 24 | 2889300758 | Rhodococcus sp. PvR099 | Isolate | Rhizosphere |
| 25 | 2891968417 | Nocardioides luteus SAI-037 | Isolate | Unclassified |
| 26 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 27 | 2902799365 | Mycolicibacterium sp. P1-5 | Isolate | Unclassified |
| 28 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 29 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 30 | 2928142448 | Prescottella equi DPS 2018 | Isolate | Unclassified |
| 31 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 32 | 2932398195 | Dietzia sp. 2505 | Isolate | Rhizosphere |
| 33 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 34 | 2939743619 | Rhodococcus sp. PvR044 | Isolate | Rhizosphere |
| 35 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 36 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 37 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 38 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 39 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 40 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 41 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 42 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 43 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 44 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 47 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 49 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 52 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 54 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 61 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 74 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 75 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 76 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 78 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 84 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 85 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 86 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 88 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 89 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 90 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 91 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 92 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 93 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 94 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 95 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 96 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 97 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 98 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 100 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 101 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 102 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 103 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 104 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 105 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 106 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 107 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 108 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 109 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 111 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 112 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 113 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 114 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 115 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 116 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 118 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 129 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 144 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 145 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 146 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 199 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 203 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 204 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 205 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 206 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 207 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 208 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 209 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 210 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 211 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 212 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 213 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 214 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 215 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 216 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 217 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 218 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 219 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 220 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 221 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 222 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 223 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 224 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 225 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 226 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 227 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 228 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 229 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 230 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 231 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 232 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 233 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 234 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 235 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 236 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 237 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 238 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 239 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 240 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 241 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 242 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 243 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 244 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 245 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 246 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 247 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 248 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 249 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 250 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 251 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 252 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 253 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 254 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 255 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 275 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 276 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 277 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 278 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 279 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 280 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 281 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 282 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 283 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 284 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 285 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 286 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 287 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 288 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 289 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 290 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 291 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 292 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 293 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 294 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 295 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 296 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 297 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 298 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 299 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 300 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 301 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 321 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 322 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 323 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 324 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 325 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 326 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 327 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 331 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 333 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 334 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 335 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 336 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 337 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 338 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 339 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 340 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 341 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 342 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 343 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.31 |
| Metatranscriptomes | 0 |
| Isolates | 4.69 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 16.28 |
| Nodule | 0.14 |
| Rhizoplane | 9.52 |
| Rhizosphere | 63.03 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.03 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10034751 | 3300001990 | Bacteria | 1562 |
| 2 | JGI24743J22301_10002277 | 3300001991 | Bacteria | 2858 |
| 3 | JGI24748J21848_1004168 | 3300002074 | Bacteria | 1655 |
| 4 | JGI24744J21845_10000053 | 3300002077 | Bacteria | 13445 |
| 5 | JGI24034J26672_10012446 | 3300002239 | Bacteria | 1282 |
| 6 | JGI24742J22300_10001182 | 3300002244 | Bacteria | 4071 |
| 7 | rootH2_10144049 | 3300003320 | Bacteria | 3070 |
| 8 | rootL2_10131486 | 3300003322 | Bacteria | 2487 |
| 9 | Ga0055540_1000024 | 3300003792 | Bacteria | 199164 |
| 10 | Ga0055540_1001685 | 3300003792 | Bacteria | 12748 |
| 11 | Ga0055540_1003063 | 3300003792 | Bacteria | 8324 |
| 12 | Ga0055540_1011186 | 3300003792 | Bacteria | 2916 |
| 13 | Ga0070658_10013421 | 3300005327 | Bacteria | 6573 |
| 14 | Ga0070658_10043009 | 3300005327 | Bacteria | 3650 |
| 15 | Ga0070658_10067970 | 3300005327 | Bacteria | 2912 |
| 16 | Ga0070683_100129173 | 3300005329 | Bacteria | 2390 |
| 17 | Ga0070690_100001292 | 3300005330 | Bacteria | 13002 |
| 18 | Ga0070670_100409606 | 3300005331 | Bacteria | 1198 |
| 19 | Ga0068869_100012633 | 3300005334 | Bacteria | 5586 |
| 20 | Ga0070666_10459069 | 3300005335 | Bacteria | 920 |
| 21 | Ga0070682_100001916 | 3300005337 | Bacteria | 11610 |
| 22 | Ga0070682_100010417 | 3300005337 | Bacteria | 5275 |
| 23 | Ga0070682_100070943 | 3300005337 | Bacteria | 2228 |
| 24 | Ga0068868_100009639 | 3300005338 | Bacteria | 6966 |
| 25 | Ga0068868_100183131 | 3300005338 | Bacteria | 1739 |
| 26 | Ga0070660_100029280 | 3300005339 | Bacteria | 4126 |
| 27 | Ga0070689_100018207 | 3300005340 | Bacteria | 5171 |
| 28 | Ga0070691_10001466 | 3300005341 | Bacteria | 10121 |
| 29 | Ga0070692_10160066 | 3300005345 | Bacteria | 1289 |
| 30 | Ga0070668_100000358 | 3300005347 | Bacteria | 30164 |
| 31 | Ga0070668_100018368 | 3300005347 | Bacteria | 5250 |
| 32 | Ga0070668_100065415 | 3300005347 | Bacteria | 2820 |
| 33 | Ga0070668_100136161 | 3300005347 | Bacteria | 1976 |
| 34 | Ga0070669_100001662 | 3300005353 | Bacteria | 16093 |
| 35 | Ga0070669_100008249 | 3300005353 | Bacteria | 7439 |
| 36 | Ga0070671_100110992 | 3300005355 | Bacteria | 2304 |
| 37 | Ga0070671_100160681 | 3300005355 | Bacteria | 1899 |
| 38 | Ga0070671_100289776 | 3300005355 | Bacteria | 1393 |
| 39 | Ga0070674_100003807 | 3300005356 | Bacteria | 8528 |
| 40 | Ga0070688_100002128 | 3300005365 | Bacteria | 9979 |
| 41 | Ga0070688_100027921 | 3300005365 | Bacteria | 3363 |
| 42 | Ga0070659_100239859 | 3300005366 | Bacteria | 1500 |
| 43 | Ga0070667_100000075 | 3300005367 | Bacteria | 120953 |
| 44 | Ga0070667_100004048 | 3300005367 | Bacteria | 12396 |
| 45 | Ga0070667_100010253 | 3300005367 | Bacteria | 7743 |
| 46 | Ga0070667_100012854 | 3300005367 | Bacteria | 6917 |
| 47 | Ga0070709_10005095 | 3300005434 | Bacteria | 7102 |
| 48 | Ga0070709_10046065 | 3300005434 | Bacteria | 2710 |
| 49 | Ga0070714_100350055 | 3300005435 | Bacteria | 1387 |
| 50 | Ga0070714_100695337 | 3300005435 | Bacteria | 981 |
| 51 | Ga0070713_100019364 | 3300005436 | Bacteria | 5194 |
| 52 | Ga0070713_100350786 | 3300005436 | Bacteria | 1369 |
| 53 | Ga0070710_10001540 | 3300005437 | Bacteria | 10899 |
| 54 | Ga0070710_10235616 | 3300005437 | Bacteria | 1170 |
| 55 | Ga0070711_100001591 | 3300005439 | Bacteria | 12506 |
| 56 | Ga0070711_100063796 | 3300005439 | Bacteria | 2572 |
| 57 | Ga0070700_100014110 | 3300005441 | Bacteria | 4507 |
| 58 | Ga0070700_100022565 | 3300005441 | Bacteria | 3673 |
| 59 | Ga0070694_100018714 | 3300005444 | Bacteria | 4399 |
| 60 | Ga0070694_100061073 | 3300005444 | Bacteria | 2572 |
| 61 | Ga0070663_100002640 | 3300005455 | Bacteria | 10142 |
| 62 | Ga0070663_100576858 | 3300005455 | Bacteria | 943 |
| 63 | Ga0070678_100001197 | 3300005456 | Bacteria | 13803 |
| 64 | Ga0070662_100010769 | 3300005457 | Bacteria | 6019 |
| 65 | Ga0070662_100297193 | 3300005457 | Bacteria | 1311 |
| 66 | Ga0068867_100006287 | 3300005459 | Bacteria | 8400 |
| 67 | Ga0070685_10057771 | 3300005466 | Bacteria | 2259 |
| 68 | Ga0070685_10131527 | 3300005466 | Bacteria | 1565 |
| 69 | Ga0068853_100064641 | 3300005539 | Bacteria | 3173 |
| 70 | Ga0068853_100066553 | 3300005539 | Bacteria | 3129 |
| 71 | Ga0070672_100459220 | 3300005543 | Bacteria | 1098 |
| 72 | Ga0070686_100279959 | 3300005544 | Bacteria | 1230 |
| 73 | Ga0070695_100040554 | 3300005545 | Bacteria | 2948 |
| 74 | Ga0070696_100003435 | 3300005546 | Bacteria | 10555 |
| 75 | Ga0070696_100127567 | 3300005546 | Bacteria | 1847 |
| 76 | Ga0070693_100032667 | 3300005547 | Bacteria | 2864 |
| 77 | Ga0070665_100005474 | 3300005548 | Bacteria | 13089 |
| 78 | Ga0070665_100006380 | 3300005548 | Bacteria | 12021 |
| 79 | Ga0070665_100259269 | 3300005548 | Bacteria | 1740 |
| 80 | Ga0070665_100319577 | 3300005548 | Bacteria | 1557 |
| 81 | Ga0070704_100000391 | 3300005549 | Bacteria | 20083 |
| 82 | Ga0070704_100036324 | 3300005549 | Bacteria | 3357 |
| 83 | Ga0068855_100113289 | 3300005563 | Bacteria | 3111 |
| 84 | Ga0068855_100146922 | 3300005563 | Bacteria | 2683 |
| 85 | Ga0068854_100071073 | 3300005578 | Bacteria | 2545 |
| 86 | Ga0068856_100019507 | 3300005614 | Bacteria | 6580 |
| 87 | Ga0068856_100112546 | 3300005614 | Bacteria | 2720 |
| 88 | Ga0070702_100001144 | 3300005615 | Bacteria | 10661 |
| 89 | Ga0070702_100498725 | 3300005615 | Bacteria | 893 |
| 90 | Ga0068852_100056443 | 3300005616 | Bacteria | 3394 |
| 91 | Ga0068859_100000606 | 3300005617 | Bacteria | 35852 |
| 92 | Ga0068859_100003251 | 3300005617 | Bacteria | 16545 |
| 93 | Ga0068864_100046674 | 3300005618 | Bacteria | 3718 |
| 94 | Ga0068866_10069786 | 3300005718 | Bacteria | 1852 |
| 95 | Ga0068861_100337538 | 3300005719 | Bacteria | 1318 |
| 96 | Ga0068863_100002748 | 3300005841 | Bacteria | 17410 |
| 97 | Ga0068863_100051087 | 3300005841 | Bacteria | 3919 |
| 98 | Ga0068858_100001109 | 3300005842 | Bacteria | 27859 |
| 99 | Ga0068858_100106992 | 3300005842 | Bacteria | 2610 |
| 100 | Ga0068860_100000025 | 3300005843 | Bacteria | 271553 |
| 101 | Ga0068860_100000334 | 3300005843 | Bacteria | 63958 |
| 102 | Ga0068860_100012429 | 3300005843 | Bacteria | 8385 |
| 103 | Ga0068862_100000045 | 3300005844 | Bacteria | 155641 |
| 104 | Ga0068862_100001869 | 3300005844 | Bacteria | 19086 |
| 105 | Ga0068862_100186010 | 3300005844 | Bacteria | 1866 |
| 106 | Ga0068862_100340792 | 3300005844 | Bacteria | 1388 |
| 107 | Ga0081455_10093207 | 3300005937 | Bacteria | 2435 |
| 108 | Ga0081538_10043770 | 3300005981 | Bacteria | 2804 |
| 109 | Ga0070717_10406360 | 3300006028 | Bacteria | 1224 |
| 110 | Ga0075365_10016378 | 3300006038 | Bacteria | 4508 |
| 111 | Ga0075365_10028768 | 3300006038 | Bacteria | 3546 |
| 112 | Ga0075365_10031758 | 3300006038 | Bacteria | 3389 |
| 113 | Ga0075365_10035069 | 3300006038 | Bacteria | 3244 |
| 114 | Ga0075365_10065345 | 3300006038 | Bacteria | 2438 |
| 115 | Ga0075365_10111706 | 3300006038 | Bacteria | 1878 |
| 116 | Ga0075365_10166821 | 3300006038 | Bacteria | 1536 |
| 117 | Ga0075365_10345155 | 3300006038 | Bacteria | 1049 |
| 118 | Ga0075368_10001245 | 3300006042 | Bacteria | 8051 |
| 119 | Ga0075368_10010130 | 3300006042 | Bacteria | 3405 |
| 120 | Ga0075368_10019871 | 3300006042 | Bacteria | 2539 |
| 121 | Ga0075368_10031817 | 3300006042 | Bacteria | 2047 |
| 122 | Ga0075363_100000597 | 3300006048 | Bacteria | 11919 |
| 123 | Ga0075363_100009537 | 3300006048 | Bacteria | 4565 |
| 124 | Ga0075363_100010009 | 3300006048 | Bacteria | 4480 |
| 125 | Ga0075363_100025439 | 3300006048 | Bacteria | 3019 |
| 126 | Ga0075363_100157541 | 3300006048 | Bacteria | 1284 |
| 127 | Ga0075363_100281014 | 3300006048 | Bacteria | 963 |
| 128 | Ga0075364_10004332 | 3300006051 | Bacteria | 8139 |
| 129 | Ga0075364_10004468 | 3300006051 | Bacteria | 8052 |
| 130 | Ga0075364_10005507 | 3300006051 | Bacteria | 7366 |
| 131 | Ga0075364_10020193 | 3300006051 | Bacteria | 4189 |
| 132 | Ga0075364_10052991 | 3300006051 | Bacteria | 2652 |
| 133 | Ga0075364_10265141 | 3300006051 | Bacteria | 1168 |
| 134 | Ga0075364_10362964 | 3300006051 | Bacteria | 987 |
| 135 | Ga0070715_10030963 | 3300006163 | Bacteria | 2168 |
| 136 | Ga0070715_10095474 | 3300006163 | Bacteria | 1377 |
| 137 | Ga0070716_100001115 | 3300006173 | Bacteria | 11831 |
| 138 | Ga0070716_100013982 | 3300006173 | Bacteria | 4104 |
| 139 | Ga0070712_100313096 | 3300006175 | Bacteria | 1274 |
| 140 | Ga0075362_10008504 | 3300006177 | Bacteria | 3927 |
| 141 | Ga0075362_10013469 | 3300006177 | Bacteria | 3274 |
| 142 | Ga0075367_10009955 | 3300006178 | Bacteria | 4982 |
| 143 | Ga0075367_10015484 | 3300006178 | Bacteria | 4147 |
| 144 | Ga0075367_10039158 | 3300006178 | Bacteria | 2763 |
| 145 | Ga0075367_10066186 | 3300006178 | Bacteria | 2165 |
| 146 | Ga0075367_10102484 | 3300006178 | Bacteria | 1751 |
| 147 | Ga0075367_10389158 | 3300006178 | Bacteria | 881 |
| 148 | Ga0075369_10004473 | 3300006186 | Bacteria | 5168 |
| 149 | Ga0075369_10013887 | 3300006186 | Bacteria | 3207 |
| 150 | Ga0075369_10054417 | 3300006186 | Bacteria | 1737 |
| 151 | Ga0097621_100054694 | 3300006237 | Bacteria | 3256 |
| 152 | Ga0075370_10002478 | 3300006353 | Bacteria | 8558 |
| 153 | Ga0075370_10003387 | 3300006353 | Bacteria | 7575 |
| 154 | Ga0075370_10022644 | 3300006353 | Bacteria | 3453 |
| 155 | Ga0075370_10075269 | 3300006353 | Bacteria | 1935 |
| 156 | Ga0075370_10077069 | 3300006353 | Bacteria | 1913 |
| 157 | Ga0075370_10170448 | 3300006353 | Bacteria | 1279 |
| 158 | Ga0068871_100205001 | 3300006358 | Bacteria | 1704 |
| 159 | Ga0075428_100004846 | 3300006844 | Bacteria | 14930 |
| 160 | Ga0075430_100077655 | 3300006846 | Bacteria | 2783 |
| 161 | Ga0075431_100009857 | 3300006847 | Bacteria | 9591 |
| 162 | Ga0075429_100156557 | 3300006880 | Bacteria | 1995 |
| 163 | Ga0097620_100000606 | 3300006931 | Bacteria | 35852 |
| 164 | Ga0097620_100003251 | 3300006931 | Bacteria | 16545 |
| 165 | Ga0099795_10007788 | 3300007788 | Bacteria | 3016 |
| 166 | Ga0105250_10151479 | 3300009092 | Bacteria | 965 |
| 167 | Ga0105245_10002903 | 3300009098 | Bacteria | 15381 |
| 168 | Ga0105245_10010872 | 3300009098 | Bacteria | 7919 |
| 169 | Ga0105245_10211953 | 3300009098 | Bacteria | 1865 |
| 170 | Ga0105245_10260707 | 3300009098 | Bacteria | 1687 |
| 171 | Ga0105245_10831686 | 3300009098 | Bacteria | 962 |
| 172 | Ga0105247_10000010 | 3300009101 | Bacteria | 302475 |
| 173 | Ga0105247_10000366 | 3300009101 | Bacteria | 38409 |
| 174 | Ga0114129_10005689 | 3300009147 | Bacteria | 17652 |
| 175 | Ga0105243_10001450 | 3300009148 | Bacteria | 20829 |
| 176 | Ga0105243_10060285 | 3300009148 | Bacteria | 3031 |
| 177 | Ga0105243_10147680 | 3300009148 | Bacteria | 2013 |
| 178 | Ga0105242_10004714 | 3300009176 | Bacteria | 10558 |
| 179 | Ga0105248_10000145 | 3300009177 | Bacteria | 81917 |
| 180 | Ga0105248_10002194 | 3300009177 | Bacteria | 21610 |
| 181 | Ga0105248_10152352 | 3300009177 | Bacteria | 2609 |
| 182 | Ga0105248_10169093 | 3300009177 | Bacteria | 2464 |
| 183 | Ga0105237_10001648 | 3300009545 | Bacteria | 28966 |
| 184 | Ga0105237_10025835 | 3300009545 | Bacteria | 6004 |
| 185 | Ga0105237_10115873 | 3300009545 | Bacteria | 2673 |
| 186 | Ga0105238_10344128 | 3300009551 | Bacteria | 1479 |
| 187 | Ga0105249_10000010 | 3300009553 | Bacteria | 306939 |
| 188 | Ga0105249_10039645 | 3300009553 | Bacteria | 4277 |
| 189 | Ga0105249_10767213 | 3300009553 | Bacteria | 1027 |
| 190 | Ga0099796_10009296 | 3300010159 | Bacteria | 2655 |
| 191 | Ga0105239_10014541 | 3300010375 | Bacteria | 8731 |
| 192 | Ga0105239_10020241 | 3300010375 | Bacteria | 7341 |
| 193 | Ga0105239_10152069 | 3300010375 | Bacteria | 2583 |
| 194 | Ga0105239_10772287 | 3300010375 | Bacteria | 1100 |
| 195 | Ga0105246_10070009 | 3300011119 | Bacteria | 2466 |
| 196 | Ga0157369_10128021 | 3300013105 | Bacteria | 2691 |
| 197 | Ga0157369_10253713 | 3300013105 | Bacteria | 1835 |
| 198 | Ga0157374_10124344 | 3300013296 | Bacteria | 2492 |
| 199 | Ga0157378_10001442 | 3300013297 | Bacteria | 21432 |
| 200 | Ga0157378_10169980 | 3300013297 | Bacteria | 2044 |
| 201 | Ga0163162_10002768 | 3300013306 | Bacteria | 16649 |
| 202 | Ga0163162_10078462 | 3300013306 | Bacteria | 3368 |
| 203 | Ga0163162_10121125 | 3300013306 | Bacteria | 2721 |
| 204 | Ga0157372_10009077 | 3300013307 | Bacteria | 10565 |
| 205 | Ga0157375_10001272 | 3300013308 | Bacteria | 21812 |
| 206 | Ga0157375_10018997 | 3300013308 | Bacteria | 6240 |
| 207 | Ga0157375_10064643 | 3300013308 | Bacteria | 3643 |
| 208 | Ga0163163_10238755 | 3300014325 | Bacteria | 1867 |
| 209 | Ga0157380_10000302 | 3300014326 | Bacteria | 29666 |
| 210 | Ga0157377_10064134 | 3300014745 | Bacteria | 2106 |
| 211 | Ga0157377_10119012 | 3300014745 | Bacteria | 1598 |
| 212 | Ga0157379_10002729 | 3300014968 | Bacteria | 14887 |
| 213 | Ga0157379_10520261 | 3300014968 | Bacteria | 1104 |
| 214 | Ga0157376_10388622 | 3300014969 | Bacteria | 1346 |
| 215 | Ga0163161_10000799 | 3300017792 | Bacteria | 24668 |
| 216 | Ga0213876_10003078 | 3300021384 | Bacteria | 9655 |
| 217 | Ga0213876_10003966 | 3300021384 | Bacteria | 8351 |
| 218 | Ga0213876_10061787 | 3300021384 | Bacteria | 1977 |
| 219 | Ga0213875_10014036 | 3300021388 | Bacteria | 3917 |
| 220 | Ga0213875_10111691 | 3300021388 | Bacteria | 1276 |
| 221 | Ga0209673_1013423 | 3300025273 | Bacteria | 3233 |
| 222 | Ga0209673_1037922 | 3300025273 | Bacteria | 1410 |
| 223 | Ga0209051_1000021 | 3300025303 | Bacteria | 507633 |
| 224 | Ga0209051_1000613 | 3300025303 | Bacteria | 41149 |
| 225 | Ga0209051_1004881 | 3300025303 | Bacteria | 8038 |
| 226 | Ga0209051_1017466 | 3300025303 | Bacteria | 3205 |
| 227 | Ga0209051_1021120 | 3300025303 | Bacteria | 2783 |
| 228 | Ga0209051_1033181 | 3300025303 | Bacteria | 1956 |
| 229 | Ga0207682_10044059 | 3300025893 | Bacteria | 1828 |
| 230 | Ga0207642_10000143 | 3300025899 | Bacteria | 20251 |
| 231 | Ga0207642_10011054 | 3300025899 | Bacteria | 3206 |
| 232 | Ga0207710_10000028 | 3300025900 | Bacteria | 304525 |
| 233 | Ga0207710_10001961 | 3300025900 | Bacteria | 9831 |
| 234 | Ga0207688_10000090 | 3300025901 | Bacteria | 35199 |
| 235 | Ga0207680_10007483 | 3300025903 | Bacteria | 5328 |
| 236 | Ga0207680_10027001 | 3300025903 | Bacteria | 3190 |
| 237 | Ga0207647_10076037 | 3300025904 | Bacteria | 2020 |
| 238 | Ga0207685_10005331 | 3300025905 | Bacteria | 3383 |
| 239 | Ga0207699_10012071 | 3300025906 | Bacteria | 4386 |
| 240 | Ga0207645_10027091 | 3300025907 | Bacteria | 3703 |
| 241 | Ga0207705_10052540 | 3300025909 | Bacteria | 2934 |
| 242 | Ga0207705_10105220 | 3300025909 | Bacteria | 2080 |
| 243 | Ga0207654_10146511 | 3300025911 | Bacteria | 1511 |
| 244 | Ga0207671_10007464 | 3300025914 | Bacteria | 9484 |
| 245 | Ga0207671_10012164 | 3300025914 | Bacteria | 6942 |
| 246 | Ga0207671_10225188 | 3300025914 | Bacteria | 1470 |
| 247 | Ga0207671_10256277 | 3300025914 | Bacteria | 1376 |
| 248 | Ga0207693_10000555 | 3300025915 | Bacteria | 33777 |
| 249 | Ga0207693_10002064 | 3300025915 | Bacteria | 17553 |
| 250 | Ga0207663_10002170 | 3300025916 | Bacteria | 9368 |
| 251 | Ga0207663_10016673 | 3300025916 | Bacteria | 4080 |
| 252 | Ga0207657_10023644 | 3300025919 | Bacteria | 5716 |
| 253 | Ga0207657_10182161 | 3300025919 | Bacteria | 1698 |
| 254 | Ga0207681_10006072 | 3300025923 | Bacteria | 7406 |
| 255 | Ga0207681_10202684 | 3300025923 | Bacteria | 1524 |
| 256 | Ga0207681_10363242 | 3300025923 | Bacteria | 1162 |
| 257 | Ga0207694_10177770 | 3300025924 | Bacteria | 1725 |
| 258 | Ga0207687_10118500 | 3300025927 | Bacteria | 1976 |
| 259 | Ga0207687_10290244 | 3300025927 | Bacteria | 1314 |
| 260 | Ga0207700_10059241 | 3300025928 | Bacteria | 2896 |
| 261 | Ga0207664_10455722 | 3300025929 | Bacteria | 1142 |
| 262 | Ga0207664_10495376 | 3300025929 | Bacteria | 1094 |
| 263 | Ga0207644_10100117 | 3300025931 | Bacteria | 2176 |
| 264 | Ga0207644_10117672 | 3300025931 | Bacteria | 2018 |
| 265 | Ga0207690_10066555 | 3300025932 | Bacteria | 2468 |
| 266 | Ga0207690_10090838 | 3300025932 | Bacteria | 2157 |
| 267 | Ga0207706_10005251 | 3300025933 | Bacteria | 12080 |
| 268 | Ga0207706_10016540 | 3300025933 | Bacteria | 6658 |
| 269 | Ga0207686_10001099 | 3300025934 | Bacteria | 15816 |
| 270 | Ga0207686_10006362 | 3300025934 | Bacteria | 6354 |
| 271 | Ga0207709_10002258 | 3300025935 | Bacteria | 12252 |
| 272 | Ga0207709_10020594 | 3300025935 | Bacteria | 3724 |
| 273 | Ga0207709_10258903 | 3300025935 | Bacteria | 1275 |
| 274 | Ga0207670_10029755 | 3300025936 | Bacteria | 3482 |
| 275 | Ga0207669_10000752 | 3300025937 | Bacteria | 13994 |
| 276 | Ga0207669_10135546 | 3300025937 | Bacteria | 1700 |
| 277 | Ga0207704_10000393 | 3300025938 | Bacteria | 19943 |
| 278 | Ga0207704_10292331 | 3300025938 | Bacteria | 1244 |
| 279 | Ga0207665_10001801 | 3300025939 | Bacteria | 14436 |
| 280 | Ga0207665_10003000 | 3300025939 | Bacteria | 11326 |
| 281 | Ga0207691_10092066 | 3300025940 | Bacteria | 2715 |
| 282 | Ga0207711_10000069 | 3300025941 | Bacteria | 115038 |
| 283 | Ga0207711_10019795 | 3300025941 | Bacteria | 5609 |
| 284 | Ga0207689_10022958 | 3300025942 | Bacteria | 5240 |
| 285 | Ga0207661_10096794 | 3300025944 | Bacteria | 2470 |
| 286 | Ga0207667_10065977 | 3300025949 | Bacteria | 3774 |
| 287 | Ga0207667_10168052 | 3300025949 | Bacteria | 2254 |
| 288 | Ga0207712_10000016 | 3300025961 | Bacteria | 343014 |
| 289 | Ga0207668_10005693 | 3300025972 | Bacteria | 7338 |
| 290 | Ga0207668_10011820 | 3300025972 | Bacteria | 5321 |
| 291 | Ga0207640_10036129 | 3300025981 | Bacteria | 3099 |
| 292 | Ga0207640_10085728 | 3300025981 | Bacteria | 2166 |
| 293 | Ga0207658_10000237 | 3300025986 | Bacteria | 58047 |
| 294 | Ga0207658_10002082 | 3300025986 | Bacteria | 14885 |
| 295 | Ga0207658_10006768 | 3300025986 | Bacteria | 7806 |
| 296 | Ga0207658_10191143 | 3300025986 | Bacteria | 1702 |
| 297 | Ga0207677_10003455 | 3300026023 | Bacteria | 8370 |
| 298 | Ga0207677_10105422 | 3300026023 | Bacteria | 2086 |
| 299 | Ga0207703_10044415 | 3300026035 | Bacteria | 3571 |
| 300 | Ga0207703_10054887 | 3300026035 | Bacteria | 3241 |
| 301 | Ga0207639_10003107 | 3300026041 | Bacteria | 11160 |
| 302 | Ga0207639_10247359 | 3300026041 | Bacteria | 1553 |
| 303 | Ga0207678_10003318 | 3300026067 | Bacteria | 14516 |
| 304 | Ga0207678_10011227 | 3300026067 | Bacteria | 7867 |
| 305 | Ga0207678_10013849 | 3300026067 | Bacteria | 7086 |
| 306 | Ga0207678_10071204 | 3300026067 | Bacteria | 2981 |
| 307 | Ga0207708_10006978 | 3300026075 | Bacteria | 8352 |
| 308 | Ga0207702_10064757 | 3300026078 | Bacteria | 3129 |
| 309 | Ga0207702_10072636 | 3300026078 | Bacteria | 2966 |
| 310 | Ga0207641_10001368 | 3300026088 | Bacteria | 24140 |
| 311 | Ga0207641_10025646 | 3300026088 | Bacteria | 4859 |
| 312 | Ga0207648_10000349 | 3300026089 | Bacteria | 50786 |
| 313 | Ga0207676_10094326 | 3300026095 | Bacteria | 2466 |
| 314 | Ga0207675_100006409 | 3300026118 | Bacteria | 11147 |
| 315 | Ga0207675_100014856 | 3300026118 | Bacteria | 7267 |
| 316 | Ga0207683_10000040 | 3300026121 | Bacteria | 95127 |
| 317 | Ga0207683_10079665 | 3300026121 | Bacteria | 2904 |
| 318 | Ga0207698_10022545 | 3300026142 | Bacteria | 4379 |
| 319 | Ga0209179_1031603 | 3300027512 | Bacteria | 1087 |
| 320 | Ga0209813_10011469 | 3300027866 | Bacteria | 2317 |
| 321 | Ga0209813_10065112 | 3300027866 | Bacteria | 1173 |
| 322 | Ga0268266_10002967 | 3300028379 | Bacteria | 17501 |
| 323 | Ga0268266_10005675 | 3300028379 | Bacteria | 11572 |
| 324 | Ga0268266_10036703 | 3300028379 | Bacteria | 4174 |
| 325 | Ga0268266_10139919 | 3300028379 | Bacteria | 2171 |
| 326 | Ga0268265_10000056 | 3300028380 | Bacteria | 155720 |
| 327 | Ga0268265_10005589 | 3300028380 | Bacteria | 8582 |
| 328 | Ga0268264_10000053 | 3300028381 | Bacteria | 320368 |
| 329 | Ga0268264_10000417 | 3300028381 | Bacteria | 60164 |
| 330 | Ga0265327_10099759 | 3300031251 | Bacteria | 1403 |
| 331 | Ga0307413_10069929 | 3300031824 | Bacteria | 2205 |
| 332 | Ga0307413_10170437 | 3300031824 | Bacteria | 1540 |
| 333 | Ga0307413_10429488 | 3300031824 | Bacteria | 1043 |
| 334 | Ga0307410_10034781 | 3300031852 | Bacteria | 3267 |
| 335 | Ga0307406_10307061 | 3300031901 | Bacteria | 1221 |
| 336 | Ga0307407_10122973 | 3300031903 | Bacteria | 1648 |
| 337 | Ga0307412_10142258 | 3300031911 | Bacteria | 1759 |
| 338 | Ga0307409_100017089 | 3300031995 | Bacteria | 4823 |
| 339 | Ga0307409_100041086 | 3300031995 | Bacteria | 3451 |
| 340 | Ga0307416_100215746 | 3300032002 | Bacteria | 1835 |
| 341 | Ga0307416_100659608 | 3300032002 | Bacteria | 1132 |
| 342 | Ga0307416_101085556 | 3300032002 | Bacteria | 905 |
| 343 | Ga0307411_10019423 | 3300032005 | Bacteria | 3926 |
| 344 | Ga0307411_10209697 | 3300032005 | Bacteria | 1503 |
| 345 | Ga0307415_100035856 | 3300032126 | Bacteria | 3244 |
| 346 | Ga0307415_100062369 | 3300032126 | Bacteria | 2585 |
| 347 | Ga0373952_0085084 | 3300035092 | Bacteria | 813 |
| 348 | Ga0373939_0022264 | 3300035114 | Bacteria | 1745 |
| 349 | Ga0373960_0036861 | 3300035121 | Bacteria | 1395 |
| 350 | Ga0373961_0051478 | 3300035241 | Bacteria | 1223 |
| 351 | Ga0373931_0045619 | 3300035691 | Bacteria | 2315 |
| 352 | Ga0373931_0093273 | 3300035691 | Bacteria | 1681 |
| 353 | Ga0373935_0555988 | 3300035692 | Bacteria | 837 |
| 354 | Ga0316582_0012630 | 3300036647 | Bacteria | 4721 |
| 355 | Ga0395900_0057306 | 3300037418 | Bacteria | 4011 |
| 356 | Ga0395900_0300231 | 3300037418 | Bacteria | 1592 |
| 357 | Ga0395898_0050328 | 3300037466 | Bacteria | 4078 |
| 358 | Ga0395898_0275014 | 3300037466 | Bacteria | 1606 |
| 359 | Ga0395905_0049703 | 3300037471 | Bacteria | 3930 |
| 360 | Ga0395905_0278405 | 3300037471 | Bacteria | 1559 |
| 361 | Ga0436364_0142680 | 3300037853 | Bacteria | 13599 |
| 362 | Ga0436364_0329205 | 3300037853 | Bacteria | 2715 |
| 363 | Ga0436364_0527008 | 3300037853 | Bacteria | 3944 |
| 364 | Ga0436364_0604589 | 3300037853 | Bacteria | 10148 |
| 365 | Ga0395901_0299200 | 3300038443 | Bacteria | 1668 |
| 366 | Ga0436365_0329583 | 3300039437 | Bacteria | 52503 |
| 367 | Ga0436365_0462461 | 3300039437 | Bacteria | 11131 |
| 368 | Ga0436365_0662080 | 3300039437 | Bacteria | 5680 |
| 369 | Ga0436365_0715051 | 3300039437 | Bacteria | 48440 |
| 370 | Ga0436365_0809829 | 3300039437 | Bacteria | 1773 |
| 371 | Ga0436365_1490253 | 3300039437 | Bacteria | 9196 |
| 372 | Ga0436362_0868766 | 3300039453 | Bacteria | 1536 |
| 373 | Ga0439461_0000774 | 3300041410 | Bacteria | 4688 |
| 374 | Ga0439466_0003695 | 3300041411 | Bacteria | 5906 |
| 375 | Ga0439466_0005991 | 3300041411 | Bacteria | 4627 |
| 376 | Ga0439466_0007929 | 3300041411 | Bacteria | 4005 |
| 377 | Ga0439465_0000439 | 3300041413 | Bacteria | 12169 |
| 378 | Ga0439465_0001000 | 3300041413 | Bacteria | 9013 |
| 379 | Ga0439465_0004076 | 3300041413 | Bacteria | 4756 |
| 380 | Ga0439465_0011408 | 3300041413 | Bacteria | 2789 |
| 381 | Ga0451793_1527126 | 3300041452 | Bacteria | 1187 |
| 382 | Ga0451800_0101687 | 3300041459 | Bacteria | 1576 |
| 383 | Ga0451833_1375940 | 3300041491 | Bacteria | 1321 |
| 384 | Ga0451841_1098966 | 3300041498 | Bacteria | 1163 |
| 385 | Ga0451843_0775765 | 3300041509 | Bacteria | 2348 |
| 386 | Ga0451853_3507486 | 3300041512 | Bacteria | 1028 |
| 387 | Ga0439431_0001548 | 3300041997 | Bacteria | 5093 |
| 388 | Ga0439431_0003707 | 3300041997 | Bacteria | 3376 |
| 389 | Ga0439431_0031811 | 3300041997 | Bacteria | 1313 |
| 390 | Ga0439442_007871 | 3300042002 | Bacteria | 2151 |
| 391 | Ga0439445_0023205 | 3300042004 | Bacteria | 1569 |
| 392 | Ga0439445_0030949 | 3300042004 | Bacteria | 1389 |
| 393 | Ga0439432_012691 | 3300042006 | Bacteria | 2877 |
| 394 | Ga0439434_0000539 | 3300042435 | Bacteria | 10813 |
| 395 | Ga0439459_0006870 | 3300042438 | Bacteria | 1908 |
| 396 | Ga0466972_0003077 | 3300044658 | Bacteria | 8265 |
| 397 | Ga0466972_0003083 | 3300044658 | Bacteria | 8256 |
| 398 | Ga0466972_0003605 | 3300044658 | Bacteria | 7699 |
| 399 | Ga0466972_0019824 | 3300044658 | Bacteria | 3363 |
| 400 | Ga0466972_0083631 | 3300044658 | Bacteria | 1518 |
| 401 | Ga0466965_0001504 | 3300044683 | Bacteria | 9446 |
| 402 | Ga0466965_0007700 | 3300044683 | Bacteria | 4956 |
| 403 | Ga0466965_0015322 | 3300044683 | Bacteria | 3642 |
| 404 | Ga0466965_0019122 | 3300044683 | Bacteria | 3289 |
| 405 | Ga0466965_0055260 | 3300044683 | Bacteria | 1975 |
| 406 | Ga0466965_0099532 | 3300044683 | Bacteria | 1486 |
| 407 | Ga0466966_0005329 | 3300044684 | Bacteria | 8458 |
| 408 | Ga0466966_0008984 | 3300044684 | Bacteria | 6623 |
| 409 | Ga0466966_0033633 | 3300044684 | Bacteria | 3319 |
| 410 | Ga0466966_0131190 | 3300044684 | Bacteria | 1534 |
| 411 | Ga0466961_0003903 | 3300044693 | Bacteria | 9322 |
| 412 | Ga0466961_0029368 | 3300044693 | Bacteria | 3535 |
| 413 | Ga0466961_0055195 | 3300044693 | Bacteria | 2533 |
| 414 | Ga0466963_0034126 | 3300044694 | Bacteria | 3309 |
| 415 | Ga0466964_0056249 | 3300044706 | Bacteria | 1626 |
| 416 | Ga0466971_0008487 | 3300044719 | Bacteria | 4480 |
| 417 | Ga0466971_0026763 | 3300044719 | Bacteria | 2580 |
| 418 | Ga0466971_0032310 | 3300044719 | Bacteria | 2345 |
| 419 | Ga0466971_0077539 | 3300044719 | Bacteria | 1513 |
| 420 | Ga0466968_0001680 | 3300044735 | Bacteria | 7977 |
| 421 | Ga0466968_0003136 | 3300044735 | Bacteria | 6100 |
| 422 | Ga0466968_0008896 | 3300044735 | Bacteria | 3853 |
| 423 | Ga0466968_0061591 | 3300044735 | Bacteria | 1619 |
| 424 | Ga0466968_0120096 | 3300044735 | Bacteria | 1188 |
| 425 | Ga0466970_0008022 | 3300044765 | Bacteria | 5300 |
| 426 | Ga0466970_0078052 | 3300044765 | Bacteria | 1786 |
| 427 | Ga0466970_0079569 | 3300044765 | Bacteria | 1769 |
| 428 | Ga0466957_0004906 | 3300044842 | Bacteria | 7488 |
| 429 | Ga0466957_0006947 | 3300044842 | Bacteria | 6401 |
| 430 | Ga0466957_0042990 | 3300044842 | Bacteria | 2734 |
| 431 | Ga0466957_0153895 | 3300044842 | Bacteria | 1489 |
| 432 | Ga0466957_0485003 | 3300044842 | Bacteria | 855 |
| 433 | Ga0466960_0000196 | 3300044901 | Bacteria | 20894 |
| 434 | Ga0466960_0000388 | 3300044901 | Bacteria | 15073 |
| 435 | Ga0466960_0001147 | 3300044901 | Bacteria | 9509 |
| 436 | Ga0466960_0122136 | 3300044901 | Bacteria | 1365 |
| 437 | Ga0466960_0129642 | 3300044901 | Bacteria | 1329 |
| 438 | Ga0466959_0001357 | 3300045049 | Bacteria | 14938 |
| 439 | Ga0466959_0002337 | 3300045049 | Bacteria | 12107 |
| 440 | Ga0466959_0003100 | 3300045049 | Bacteria | 10773 |
| 441 | Ga0466959_0017663 | 3300045049 | Bacteria | 5230 |
| 442 | Ga0466959_0072859 | 3300045049 | Bacteria | 2485 |
| 443 | Ga0466958_0019584 | 3300045836 | Bacteria | 3940 |
| 444 | Ga0466958_0051352 | 3300045836 | Bacteria | 2496 |
| 445 | Ga0466958_0099092 | 3300045836 | Bacteria | 1810 |
| 446 | Ga0466967_0001060 | 3300045976 | Bacteria | 15161 |
| 447 | Ga0466967_0003093 | 3300045976 | Bacteria | 10702 |
| 448 | Ga0466967_0003987 | 3300045976 | Bacteria | 9832 |
| 449 | Ga0466967_0023553 | 3300045976 | Bacteria | 5049 |
| 450 | Ga0466967_0023877 | 3300045976 | Bacteria | 5018 |
| 451 | Ga0466967_0032737 | 3300045976 | Bacteria | 4394 |
| 452 | Ga0466967_0125613 | 3300045976 | Bacteria | 2376 |
| 453 | Ga0466967_0166095 | 3300045976 | Bacteria | 2074 |
| 454 | Ga0466967_0205356 | 3300045976 | Bacteria | 1867 |
| 455 | Ga0466967_0501739 | 3300045976 | Bacteria | 1191 |
| 456 | Ga0495638_0006330 | 3300046460 | Bacteria | 8628 |
| 457 | Ga0495638_0096789 | 3300046460 | Bacteria | 1771 |
| 458 | Ga0495582_0064951 | 3300046473 | Bacteria | 2016 |
| 459 | Ga0495639_0017325 | 3300046475 | Bacteria | 3129 |
| 460 | Ga0495594_0045363 | 3300046499 | Bacteria | 2413 |
| 461 | Ga0495608_0144126 | 3300046511 | Bacteria | 1520 |
| 462 | Ga0495648_0000628 | 3300046524 | Bacteria | 37663 |
| 463 | Ga0495667_0314143 | 3300046559 | Bacteria | 992 |
| 464 | Ga0495668_0008297 | 3300046616 | Bacteria | 6507 |
| 465 | Ga0495658_0165704 | 3300046683 | Bacteria | 1365 |
| 466 | Ga0495669_0003085 | 3300046684 | Bacteria | 6850 |
| 467 | Ga0495613_0208294 | 3300046689 | Bacteria | 1376 |
| 468 | Ga0495624_0046221 | 3300046690 | Bacteria | 2769 |
| 469 | Ga0495649_0120509 | 3300046694 | Bacteria | 1388 |
| 470 | Ga0495649_0126004 | 3300046694 | Bacteria | 1353 |
| 471 | Ga0495581_0141405 | 3300047315 | Bacteria | 1404 |
| 472 | Ga0495672_0008575 | 3300047320 | Bacteria | 7524 |
| 473 | Ga0495672_0024723 | 3300047320 | Bacteria | 3864 |
| 474 | Ga0495672_0030035 | 3300047320 | Bacteria | 3415 |
| 475 | Ga0495676_0041533 | 3300047321 | Bacteria | 3784 |
| 476 | Ga0495673_0002027 | 3300047469 | Bacteria | 14878 |
| 477 | Ga0495593_0026483 | 3300047673 | Bacteria | 3201 |
| 478 | Ga0495614_0131684 | 3300048089 | Bacteria | 1107 |
| 479 | Ga0496100_0000099 | 3300048903 | Bacteria | 49748 |
| 480 | Ga0496100_0005195 | 3300048903 | Bacteria | 6986 |
| 481 | Ga0496100_0009828 | 3300048903 | Bacteria | 5390 |
| 482 | Ga0496100_0055044 | 3300048903 | Bacteria | 2598 |
| 483 | Ga0496100_0142140 | 3300048903 | Bacteria | 1702 |
| 484 | Ga0496101_0000066 | 3300048904 | Bacteria | 122196 |
| 485 | Ga0496101_0000074 | 3300048904 | Bacteria | 113105 |
| 486 | Ga0496101_0002316 | 3300048904 | Bacteria | 11658 |
| 487 | Ga0496101_0038619 | 3300048904 | Bacteria | 3391 |
| 488 | Ga0496101_0060971 | 3300048904 | Bacteria | 2738 |
| 489 | Ga0496101_0132603 | 3300048904 | Bacteria | 1893 |
| 490 | Ga0496101_0270294 | 3300048904 | Bacteria | 1327 |
| 491 | Ga0496102_0000035 | 3300048905 | Bacteria | 213557 |
| 492 | Ga0496102_0000070 | 3300048905 | Bacteria | 155087 |
| 493 | Ga0496102_0000600 | 3300048905 | Bacteria | 37655 |
| 494 | Ga0496102_0004697 | 3300048905 | Bacteria | 11558 |
| 495 | Ga0496102_0008806 | 3300048905 | Bacteria | 8658 |
| 496 | Ga0496102_0124712 | 3300048905 | Bacteria | 2407 |
| 497 | Ga0496102_0146132 | 3300048905 | Bacteria | 2219 |
| 498 | Ga0496103_0000028 | 3300048906 | Bacteria | 213660 |
| 499 | Ga0496103_0000381 | 3300048906 | Bacteria | 39710 |
| 500 | Ga0496103_0000477 | 3300048906 | Bacteria | 33721 |
| 501 | Ga0496103_0000667 | 3300048906 | Bacteria | 25794 |
| 502 | Ga0496103_0023011 | 3300048906 | Bacteria | 3756 |
| 503 | Ga0496104_0026704 | 3300048907 | Bacteria | 5335 |
| 504 | Ga0496104_0078845 | 3300048907 | Bacteria | 3139 |
| 505 | Ga0496104_0485058 | 3300048907 | Bacteria | 1147 |
| 506 | Ga0496105_0049701 | 3300048908 | Bacteria | 3463 |
| 507 | Ga0496105_0049975 | 3300048908 | Bacteria | 3454 |
| 508 | Ga0496106_0002066 | 3300048909 | Bacteria | 15061 |
| 509 | Ga0496106_0010257 | 3300048909 | Bacteria | 6926 |
| 510 | Ga0496106_0010815 | 3300048909 | Bacteria | 6746 |
| 511 | Ga0496106_0153804 | 3300048909 | Bacteria | 1815 |
| 512 | Ga0496107_0001051 | 3300048910 | Bacteria | 16518 |
| 513 | Ga0496107_0002661 | 3300048910 | Bacteria | 11698 |
| 514 | Ga0496107_0012907 | 3300048910 | Bacteria | 5839 |
| 515 | Ga0496107_0028337 | 3300048910 | Bacteria | 3979 |
| 516 | Ga0496107_0047928 | 3300048910 | Bacteria | 3077 |
| 517 | Ga0496108_0000802 | 3300048911 | Bacteria | 24400 |
| 518 | Ga0496108_0027767 | 3300048911 | Bacteria | 4678 |
| 519 | Ga0496108_0050142 | 3300048911 | Bacteria | 3494 |
| 520 | Ga0496109_0000160 | 3300048912 | Bacteria | 66073 |
| 521 | Ga0496109_0005948 | 3300048912 | Bacteria | 10238 |
| 522 | Ga0496109_0007855 | 3300048912 | Bacteria | 9037 |
| 523 | Ga0496109_0150578 | 3300048912 | Bacteria | 2178 |
| 524 | Ga0496109_0202851 | 3300048912 | Bacteria | 1865 |
| 525 | Ga0496110_0130988 | 3300048913 | Bacteria | 2265 |
| 526 | Ga0496110_0177249 | 3300048913 | Bacteria | 1935 |
| 527 | Ga0496111_0016907 | 3300048914 | Bacteria | 5035 |
| 528 | Ga0496111_0269813 | 3300048914 | Bacteria | 1262 |
| 529 | Ga0496112_0008839 | 3300048915 | Bacteria | 9037 |
| 530 | Ga0496112_0041494 | 3300048915 | Bacteria | 4503 |
| 531 | Ga0496112_0047543 | 3300048915 | Bacteria | 4209 |
| 532 | Ga0496112_0104600 | 3300048915 | Bacteria | 2801 |
| 533 | Ga0496112_0363354 | 3300048915 | Bacteria | 1389 |
| 534 | Ga0496113_0031777 | 3300048916 | Bacteria | 3834 |
| 535 | Ga0496113_0114204 | 3300048916 | Bacteria | 2105 |
| 536 | Ga0496113_0125836 | 3300048916 | Bacteria | 2007 |
| 537 | Ga0496114_0001610 | 3300048917 | Bacteria | 17143 |
| 538 | Ga0496114_0002368 | 3300048917 | Bacteria | 14350 |
| 539 | Ga0496114_0004619 | 3300048917 | Bacteria | 10700 |
| 540 | Ga0496114_0136658 | 3300048917 | Bacteria | 2120 |
| 541 | Ga0496114_0549975 | 3300048917 | Bacteria | 1020 |
| 542 | Ga0496115_0009272 | 3300048918 | Bacteria | 7313 |
| 543 | Ga0496115_0021794 | 3300048918 | Bacteria | 4953 |
| 544 | Ga0496115_0028041 | 3300048918 | Bacteria | 4410 |
| 545 | Ga0496115_0459054 | 3300048918 | Bacteria | 1028 |
| 546 | Ga0496116_0000090 | 3300048919 | Bacteria | 212651 |
| 547 | Ga0496117_0000051 | 3300048920 | Bacteria | 285716 |
| 548 | Ga0496117_0001117 | 3300048920 | Bacteria | 40451 |
| 549 | Ga0496117_0025666 | 3300048920 | Bacteria | 4627 |
| 550 | Ga0496118_0000043 | 3300048921 | Bacteria | 285716 |
| 551 | Ga0496118_0000272 | 3300048921 | Bacteria | 91016 |
| 552 | Ga0496118_0004850 | 3300048921 | Bacteria | 15670 |
| 553 | Ga0496118_0034057 | 3300048921 | Bacteria | 4165 |
| 554 | Ga0496119_0000559 | 3300048922 | Bacteria | 50341 |
| 555 | Ga0496119_0004410 | 3300048922 | Bacteria | 14028 |
| 556 | Ga0496119_0016323 | 3300048922 | Bacteria | 5658 |
| 557 | Ga0496120_0001323 | 3300048923 | Bacteria | 30586 |
| 558 | Ga0496120_0015370 | 3300048923 | Bacteria | 5054 |
| 559 | Ga0496120_0034583 | 3300048923 | Bacteria | 3026 |
| 560 | Ga0496121_0000014 | 3300048924 | Bacteria | 609379 |
| 561 | Ga0496121_0000080 | 3300048924 | Bacteria | 230195 |
| 562 | Ga0496121_0002543 | 3300048924 | Bacteria | 27647 |
| 563 | Ga0496122_0000097 | 3300048925 | Bacteria | 199223 |
| 564 | Ga0496122_0033470 | 3300048925 | Bacteria | 4226 |
| 565 | Ga0496123_0029402 | 3300048926 | Bacteria | 4046 |
| 566 | Ga0496123_0037691 | 3300048926 | Bacteria | 3410 |
| 567 | Ga0496124_0000019 | 3300048927 | Bacteria | 436995 |
| 568 | Ga0496124_0195055 | 3300048927 | Bacteria | 1546 |
| 569 | Ga0496125_0000014 | 3300048928 | Bacteria | 610124 |
| 570 | Ga0496125_0010205 | 3300048928 | Bacteria | 9521 |
| 571 | Ga0496125_0162429 | 3300048928 | Bacteria | 1515 |
| 572 | Ga0496126_0000017 | 3300048929 | Bacteria | 610676 |
| 573 | Ga0496126_0001251 | 3300048929 | Bacteria | 41100 |
| 574 | Ga0496126_0035353 | 3300048929 | Bacteria | 4684 |
| 575 | Ga0496126_0059304 | 3300048929 | Bacteria | 3446 |
| 576 | Ga0496126_0348160 | 3300048929 | Bacteria | 1212 |
| 577 | Ga0501032_0009488 | 3300049569 | Bacteria | 7053 |
| 578 | Ga0501032_0330946 | 3300049569 | Bacteria | 982 |
| 579 | Ga0501033_0005242 | 3300049570 | Bacteria | 10291 |
| 580 | Ga0501034_0015666 | 3300049571 | Bacteria | 7784 |
| 581 | Ga0501034_0037887 | 3300049571 | Bacteria | 4883 |
| 582 | Ga0501034_0059563 | 3300049571 | Bacteria | 3835 |
| 583 | Ga0501034_0098340 | 3300049571 | Bacteria | 2922 |
| 584 | Ga0501034_0285927 | 3300049571 | Bacteria | 1588 |
| 585 | Ga0501034_0346917 | 3300049571 | Bacteria | 1414 |
| 586 | Ga0501034_0431254 | 3300049571 | Bacteria | 1238 |
| 587 | Ga0501036_0213288 | 3300049572 | Bacteria | 1622 |
| 588 | Ga0501036_0485487 | 3300049572 | Bacteria | 1028 |
| 589 | Ga0501037_0000434 | 3300049573 | Bacteria | 34407 |
| 590 | Ga0501037_0011193 | 3300049573 | Bacteria | 6603 |
| 591 | Ga0501037_0058868 | 3300049573 | Bacteria | 2803 |
| 592 | Ga0501038_0012184 | 3300049574 | Bacteria | 7850 |
| 593 | Ga0501039_0002790 | 3300049575 | Bacteria | 13049 |
| 594 | Ga0501043_0061911 | 3300049579 | Bacteria | 2938 |
| 595 | Ga0501043_0217784 | 3300049579 | Bacteria | 1478 |
| 596 | Ga0501043_0333361 | 3300049579 | Bacteria | 1155 |
| 597 | Ga0501046_0011358 | 3300049580 | Bacteria | 7620 |
| 598 | Ga0501047_0002023 | 3300049581 | Bacteria | 19406 |
| 599 | Ga0501047_0007852 | 3300049581 | Bacteria | 10054 |
| 600 | Ga0501047_0022160 | 3300049581 | Bacteria | 6104 |
| 601 | Ga0501047_0319834 | 3300049581 | Bacteria | 1392 |
| 602 | Ga0501047_0609553 | 3300049581 | Bacteria | 913 |
| 603 | Ga0501048_0019214 | 3300049582 | Bacteria | 5017 |
| 604 | Ga0501069_0042281 | 3300049585 | Bacteria | 2521 |
| 605 | Ga0501069_0223094 | 3300049585 | Bacteria | 1096 |
| 606 | Ga0501070_0006875 | 3300049586 | Bacteria | 9677 |
| 607 | Ga0501070_0019114 | 3300049586 | Bacteria | 5746 |
| 608 | Ga0501070_0063913 | 3300049586 | Bacteria | 3049 |
| 609 | Ga0501070_0164745 | 3300049586 | Bacteria | 1827 |
| 610 | Ga0501070_0172841 | 3300049586 | Bacteria | 1779 |
| 611 | Ga0501070_0334328 | 3300049586 | Bacteria | 1231 |
| 612 | Ga0501071_0144602 | 3300049587 | Bacteria | 1772 |
| 613 | Ga0501072_0013982 | 3300049588 | Bacteria | 6150 |
| 614 | Ga0501080_0018162 | 3300049742 | Bacteria | 6510 |
| 615 | Ga0501080_0093009 | 3300049742 | Bacteria | 2800 |
| 616 | Ga0501080_0253631 | 3300049742 | Bacteria | 1604 |
| 617 | Ga0501080_0294953 | 3300049742 | Bacteria | 1472 |
| 618 | Ga0501083_0036359 | 3300049744 | Bacteria | 3359 |
| 619 | Ga0501035_0002184 | 3300049822 | Bacteria | 19411 |
| 620 | Ga0501035_0005928 | 3300049822 | Bacteria | 11503 |
| 621 | Ga0501044_0000498 | 3300049823 | Bacteria | 47714 |
| 622 | Ga0501044_0002158 | 3300049823 | Bacteria | 22557 |
| 623 | Ga0501044_0051682 | 3300049823 | Bacteria | 4237 |
| 624 | Ga0501044_0209673 | 3300049823 | Bacteria | 1903 |
| 625 | nmdc:mga03683_72136_c1 | 3300050489 | Bacteria | 1478 |
| 626 | nmdc:mga03n38_112684_c1 | 3300050490 | Bacteria | 1327 |
| 627 | nmdc:mga03n38_1531_c1 | 3300050490 | Bacteria | 6690 |
| 628 | nmdc:mga03n38_226870_c1 | 3300050490 | Bacteria | 977 |
| 629 | nmdc:mga03n38_24393_c1 | 3300050490 | Bacteria | 2473 |
| 630 | nmdc:mga03n38_2523_c1 | 3300050490 | Bacteria | 5677 |
| 631 | nmdc:mga03n38_51520_c1 | 3300050490 | Bacteria | 1839 |
| 632 | nmdc:mga03n38_68444_c1 | 3300050490 | Bacteria | 1637 |
| 633 | nmdc:mga03n38_69778_c1 | 3300050490 | Bacteria | 1624 |
| 634 | nmdc:mga03n38_78819_c1 | 3300050490 | Bacteria | 1543 |
| 635 | nmdc:mga03n38_83420_c1 | 3300050490 | Bacteria | 1507 |
| 636 | nmdc:mga00v17_161264_c1 | 3300050491 | Bacteria | 1444 |
| 637 | nmdc:mga00v17_2413_c1 | 3300050491 | Bacteria | 9570 |
| 638 | nmdc:mga00v17_286612_c1 | 3300050491 | Bacteria | 1069 |
| 639 | nmdc:mga00v17_3084_c1 | 3300050491 | Bacteria | 8568 |
| 640 | nmdc:mga00v17_337218_c1 | 3300050491 | Bacteria | 980 |
| 641 | nmdc:mga00v17_60682_c1 | 3300050491 | Bacteria | 2323 |
| 642 | nmdc:mga00v17_610_c1 | 3300050491 | Bacteria | 9214 |
| 643 | nmdc:mga00v17_7742_c2 | 3300050491 | Bacteria | 1545 |
| 644 | nmdc:mga00v17_78484_c1 | 3300050491 | Bacteria | 2057 |
| 645 | nmdc:mga00v17_89944_c1 | 3300050491 | Bacteria | 1927 |
| 646 | nmdc:mga00v17_97515_c1 | 3300050491 | Bacteria | 1853 |
| 647 | nmdc:mga0yw44_130534_c1 | 3300050492 | Bacteria | 1626 |
| 648 | nmdc:mga0yw44_14712_c1 | 3300050492 | Bacteria | 4165 |
| 649 | nmdc:mga0yw44_15867_c1 | 3300050492 | Bacteria | 4051 |
| 650 | nmdc:mga0yw44_15876_c1 | 3300050492 | Bacteria | 4050 |
| 651 | nmdc:mga0yw44_27183_c1 | 3300050492 | Bacteria | 3275 |
| 652 | nmdc:mga0yw44_276618_c1 | 3300050492 | Bacteria | 1121 |
| 653 | nmdc:mga0yw44_30717_c1 | 3300050492 | Bacteria | 3117 |
| 654 | nmdc:mga0yw44_34572_c1 | 3300050492 | Bacteria | 2962 |
| 655 | nmdc:mga0yw44_3579_c1 | 3300050492 | Bacteria | 6926 |
| 656 | nmdc:mga0yw44_379501_c1 | 3300050492 | Bacteria | 954 |
| 657 | nmdc:mga0yw44_64568_c1 | 3300050492 | Bacteria | 2253 |
| 658 | nmdc:mga0yw44_87803_c1 | 3300050492 | Bacteria | 1960 |
| 659 | nmdc:mga06z11_111279_c1 | 3300050494 | Bacteria | 1517 |
| 660 | nmdc:mga06z11_256899_c1 | 3300050494 | Bacteria | 1030 |
| 661 | nmdc:mga06z11_31398_c1 | 3300050494 | Bacteria | 2580 |
| 662 | nmdc:mga06z11_57800_c1 | 3300050494 | Bacteria | 2010 |
| 663 | nmdc:mga04h51_21258_c1 | 3300050495 | Bacteria | 1950 |
| 664 | nmdc:mga07m45_110949_c1 | 3300050496 | Bacteria | 1580 |
| 665 | nmdc:mga07m45_245785_c1 | 3300050496 | Bacteria | 1041 |
| 666 | nmdc:mga07m45_41367_c1 | 3300050496 | Bacteria | 2581 |
| 667 | nmdc:mga07m45_84516_c1 | 3300050496 | Bacteria | 1815 |
| 668 | nmdc:mga05p37_112745_c1 | 3300050507 | Bacteria | 3344 |
| 669 | nmdc:mga0qj67_28056_c1 | 3300050509 | Bacteria | 4367 |
| 670 | nmdc:mga06r32_5670_c1 | 3300050510 | Bacteria | 11237 |
| 671 | nmdc:mga0sz30_32770_c1 | 3300050516 | Bacteria | 1073 |
| 672 | nmdc:mga0sz30_49651_c1 | 3300050516 | Bacteria | 1778 |
| 673 | nmdc:mga0sz30_64339_c1 | 3300050516 | Bacteria | 1571 |
| 674 | nmdc:mga0sz30_6965_c1 | 3300050516 | Bacteria | 4225 |
| 675 | nmdc:mga0sz30_89985_c1 | 3300050516 | Bacteria | 1335 |
| 676 | Ga0495601_0250421 | 3300053077 | Bacteria | 1157 |
| 677 | Ga0500635_0045829 | 3300053080 | Bacteria | 1481 |
| 678 | Ga0500643_005328 | 3300053087 | Bacteria | 5563 |
| 679 | Ga0500643_009356 | 3300053087 | Bacteria | 3750 |
| 680 | Ga0500644_0000014 | 3300053088 | Bacteria | 109650 |
| 681 | Ga0500644_0072434 | 3300053088 | Bacteria | 1245 |
| 682 | Ga0500641_0019573 | 3300053096 | Bacteria | 2560 |
| 683 | Ga0500556_0001691 | 3300053104 | Bacteria | 8473 |
| 684 | Ga0500593_000305 | 3300053117 | Bacteria | 19941 |
| 685 | Ga0500652_014947 | 3300053131 | Bacteria | 2789 |
| 686 | Ga0500652_048020 | 3300053131 | Bacteria | 1736 |
| 687 | Ga0500573_0063602 | 3300053140 | Bacteria | 2111 |
| 688 | Ga0500588_0038768 | 3300053146 | Bacteria | 1423 |
| 689 | Ga0500604_0021109 | 3300053151 | Bacteria | 1839 |
| 690 | Ga0500645_000006 | 3300053730 | Bacteria | 276677 |
| 691 | Ga0466962_0010692 | 3300061719 | Bacteria | 4415 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005327 | Ga0070658_10013421 | Ga0070658_100134212 | 209 |
| 2 | 3300009098 | Ga0105245_10260707 | Ga0105245_102607072 | 209 |
| 3 | 3300025927 | Ga0207687_10290244 | Ga0207687_102902442 | 209 |
| 4 | 3300046684 | Ga0495669_0003085 | Ga0495669_0003085_1701_2492 | 221 |
| 5 | 3300050492 | nmdc:mga0yw44_14712_c1 | nmdc:mga0yw44_14712_c1_2081_2863 | 222 |
| 6 | 3300025909 | Ga0207705_10105220 | Ga0207705_101052202 | 226 |
| 7 | 3300025937 | Ga0207669_10135546 | Ga0207669_101355463 | 230 |
| 8 | 3300048907 | Ga0496104_0485058 | Ga0496104_0485058_380_1087 | 231 |
| 9 | 3300048911 | Ga0496108_0027767 | Ga0496108_0027767_2640_3347 | 231 |
| 10 | 3300048912 | Ga0496109_0007855 | Ga0496109_0007855_3969_4676 | 231 |
| 11 | 3300048913 | Ga0496110_0177249 | Ga0496110_0177249_890_1597 | 231 |
| 12 | 3300048915 | Ga0496112_0008839 | Ga0496112_0008839_6319_7026 | 231 |
| 13 | 3300049823 | Ga0501044_0051682 | Ga0501044_0051682_3440_4156 | 231 |
| 14 | 3300050490 | nmdc:mga03n38_1531_c1 | nmdc:mga03n38_1531_c1_1358_2065 | 231 |
| 15 | 3300050490 | nmdc:mga03n38_226870_c1 | nmdc:mga03n38_226870_c1_40_747 | 231 |
| 16 | 3300006038 | Ga0075365_10016378 | Ga0075365_100163786 | 234 |
| 17 | 3300006038 | Ga0075365_10031758 | Ga0075365_100317583 | 234 |
| 18 | 3300006038 | Ga0075365_10065345 | Ga0075365_100653452 | 234 |
| 19 | 3300050491 | nmdc:mga00v17_286612_c1 | nmdc:mga00v17_286612_c1_43_828 | 234 |
| 20 | 3300050492 | nmdc:mga0yw44_3579_c1 | nmdc:mga0yw44_3579_c1_5479_6264 | 234 |
| 21 | 3300053088 | Ga0500644_0072434 | Ga0500644_0072434_298_1083 | 234 |
| 22 | 3300053151 | Ga0500604_0021109 | Ga0500604_0021109_397_1179 | 234 |
| 23 | 3300005435 | Ga0070714_100350055 | Ga0070714_1003500552 | 235 |
| 24 | 3300025929 | Ga0207664_10455722 | Ga0207664_104557222 | 235 |
| 25 | 3300049579 | Ga0501043_0217784 | Ga0501043_0217784_649_1401 | 235 |
| 26 | 3300049742 | Ga0501080_0093009 | Ga0501080_0093009_463_1245 | 235 |
| 27 | 3300048927 | Ga0496124_0195055 | Ga0496124_0195055_517_1302 | 236 |
| 28 | 3300049588 | Ga0501072_0013982 | Ga0501072_0013982_1430_2212 | 237 |
| 29 | 3300006038 | Ga0075365_10111706 | Ga0075365_101117062 | 238 |
| 30 | 3300006042 | Ga0075368_10019871 | Ga0075368_100198712 | 238 |
| 31 | 3300006048 | Ga0075363_100025439 | Ga0075363_1000254393 | 238 |
| 32 | 3300006051 | Ga0075364_10052991 | Ga0075364_100529913 | 238 |
| 33 | 3300006178 | Ga0075367_10039158 | Ga0075367_100391583 | 238 |
| 34 | 3300049571 | Ga0501034_0431254 | Ga0501034_0431254_373_1143 | 238 |
| 35 | 3300049586 | Ga0501070_0172841 | Ga0501070_0172841_415_1185 | 238 |
| 36 | 3300049742 | Ga0501080_0253631 | Ga0501080_0253631_241_1011 | 238 |
| 37 | 3300050490 | nmdc:mga03n38_83420_c1 | nmdc:mga03n38_83420_c1_352_1137 | 238 |
| 38 | 3300050491 | nmdc:mga00v17_60682_c1 | nmdc:mga00v17_60682_c1_806_1591 | 238 |
| 39 | 3300050492 | nmdc:mga0yw44_27183_c1 | nmdc:mga0yw44_27183_c1_1949_2734 | 238 |
| 40 | 3300005843 | Ga0068860_100000334 | Ga0068860_10000033458 | 239 |
| 41 | 3300028381 | Ga0268264_10000417 | Ga0268264_1000041736 | 239 |
| 42 | 3300050492 | nmdc:mga0yw44_276618_c1 | nmdc:mga0yw44_276618_c1_276_1061 | 241 |
| 43 | 3300050492 | nmdc:mga0yw44_30717_c1 | nmdc:mga0yw44_30717_c1_2239_3012 | 241 |
| 44 | 3300005539 | Ga0068853_100066553 | Ga0068853_1000665535 | 242 |
| 45 | 3300026041 | Ga0207639_10247359 | Ga0207639_102473592 | 242 |
| 46 | 3300049587 | Ga0501071_0144602 | Ga0501071_0144602_124_906 | 242 |
| 47 | 3300005327 | Ga0070658_10043009 | Ga0070658_100430093 | 243 |
| 48 | 3300031995 | Ga0307409_100017089 | Ga0307409_1000170891 | 243 |
| 49 | 3300032002 | Ga0307416_100215746 | Ga0307416_1002157462 | 243 |
| 50 | 3300032005 | Ga0307411_10209697 | Ga0307411_102096972 | 243 |
| 51 | 3300032126 | Ga0307415_100062369 | Ga0307415_1000623692 | 243 |
| 52 | 3300048917 | Ga0496114_0549975 | Ga0496114_0549975_159_962 | 243 |
| 53 | 3300050492 | nmdc:mga0yw44_15876_c1 | nmdc:mga0yw44_15876_c1_2910_3695 | 243 |
| 54 | iso_pu_bacteria | 2932398195 | 2932398404 | 243 |
| 55 | 3300053140 | Ga0500573_0063602 | Ga0500573_0063602_38_820 | 244 |
| 56 | 3300005436 | Ga0070713_100019364 | Ga0070713_1000193644 | 245 |
| 57 | 3300005437 | Ga0070710_10235616 | Ga0070710_102356162 | 245 |
| 58 | 3300006028 | Ga0070717_10406360 | Ga0070717_104063602 | 245 |
| 59 | 3300009148 | Ga0105243_10147680 | Ga0105243_101476803 | 245 |
| 60 | 3300025928 | Ga0207700_10059241 | Ga0207700_100592412 | 245 |
| 61 | 3300025935 | Ga0207709_10258903 | Ga0207709_102589032 | 245 |
| 62 | 3300039437 | Ga0436365_0809829 | Ga0436365_0809829_954_1712 | 245 |
| 63 | 3300039453 | Ga0436362_0868766 | Ga0436362_0868766_593_1351 | 245 |
| 64 | iso_pu_bacteria | 2902799365 | 2902799554 | 245 |
| 65 | iso_pu_bacteria | 2643221715 | 2644634139 | 246 |
| 66 | iso_pu_bacteria | 2738541274 | 2738704334 | 246 |
| 67 | iso_pu_bacteria | 2738543028 | 2739331183 | 246 |
| 68 | iso_pu_bacteria | 2902810491 | 2902811702 | 246 |
| 69 | 3300048903 | Ga0496100_0055044 | Ga0496100_0055044_1458_2204 | 247 |
| 70 | 3300048915 | Ga0496112_0363354 | Ga0496112_0363354_82_828 | 247 |
| 71 | 3300048916 | Ga0496113_0114204 | Ga0496113_0114204_829_1575 | 247 |
| 72 | 3300048925 | Ga0496122_0033470 | Ga0496122_0033470_1614_2360 | 247 |
| 73 | 3300048926 | Ga0496123_0037691 | Ga0496123_0037691_1627_2373 | 247 |
| 74 | 3300048928 | Ga0496125_0162429 | Ga0496125_0162429_548_1294 | 247 |
| 75 | 3300049823 | Ga0501044_0209673 | Ga0501044_0209673_335_1084 | 247 |
| 76 | iso_pu_bacteria | 2643221576 | 2643889839 | 247 |
| 77 | iso_pu_bacteria | 2643221590 | 2643958895 | 247 |
| 78 | iso_pu_bacteria | 2643221604 | 2644033954 | 247 |
| 79 | iso_pu_bacteria | 2643221615 | 2644089355 | 247 |
| 80 | iso_pu_bacteria | 2643221617 | 2644099468 | 247 |
| 81 | iso_pu_bacteria | 2643221620 | 2644116339 | 247 |
| 82 | iso_pu_bacteria | 2643221657 | 2644319200 | 247 |
| 83 | iso_pu_bacteria | 2643221687 | 2644485509 | 247 |
| 84 | iso_pu_bacteria | 2738541305 | 2738867557 | 247 |
| 85 | iso_pu_bacteria | 2738543005 | 2739206710 | 247 |
| 86 | iso_pu_bacteria | 2738543011 | 2739240266 | 247 |
| 87 | iso_pu_bacteria | 2744054611 | 2744954737 | 247 |
| 88 | iso_pu_bacteria | 2773857762 | 2774392511 | 247 |
| 89 | iso_pu_bacteria | 2808606439 | 2809196293 | 247 |
| 90 | iso_pu_bacteria | 2811994874 | 2812331803 | 247 |
| 91 | iso_pu_bacteria | 2811994878 | 2812351545 | 247 |
| 92 | iso_pu_bacteria | 2842134933 | 2842139875 | 247 |
| 93 | iso_pu_bacteria | 2855386786 | 2855386941 | 247 |
| 94 | iso_pu_bacteria | 2889300758 | 2889302821 | 247 |
| 95 | iso_pu_bacteria | 2902792274 | 2902798122 | 247 |
| 96 | iso_pu_bacteria | 2902837492 | 2902837980 | 247 |
| 97 | iso_pu_bacteria | 2928142448 | 2928145922 | 247 |
| 98 | iso_pu_bacteria | 2929212328 | 2929215900 | 247 |
| 99 | iso_pu_bacteria | 2939743619 | 2939748028 | 247 |
| 100 | 3300005329 | Ga0070683_100129173 | Ga0070683_1001291733 | 248 |
| 101 | 3300013105 | Ga0157369_10253713 | Ga0157369_102537133 | 248 |
| 102 | 3300025944 | Ga0207661_10096794 | Ga0207661_100967943 | 248 |
| 103 | 3300044694 | Ga0466963_0034126 | Ga0466963_0034126_2414_3163 | 248 |
| 104 | 3300044719 | Ga0466971_0032310 | Ga0466971_0032310_1535_2284 | 248 |
| 105 | 3300044901 | Ga0466960_0000388 | Ga0466960_0000388_107_856 | 248 |
| 106 | 3300045976 | Ga0466967_0003093 | Ga0466967_0003093_2308_3057 | 248 |
| 107 | 3300045976 | Ga0466967_0003987 | Ga0466967_0003987_6246_6995 | 248 |
| 108 | 3300045976 | Ga0466967_0023877 | Ga0466967_0023877_670_1419 | 248 |
| 109 | 3300048905 | Ga0496102_0008806 | Ga0496102_0008806_3191_3940 | 248 |
| 110 | 3300048921 | Ga0496118_0000272 | Ga0496118_0000272_58238_58987 | 248 |
| 111 | 3300049569 | Ga0501032_0009488 | Ga0501032_0009488_3416_4165 | 248 |
| 112 | 3300049570 | Ga0501033_0005242 | Ga0501033_0005242_3866_4615 | 248 |
| 113 | 3300049571 | Ga0501034_0015666 | Ga0501034_0015666_6706_7455 | 248 |
| 114 | 3300049572 | Ga0501036_0213288 | Ga0501036_0213288_434_1183 | 248 |
| 115 | 3300049573 | Ga0501037_0011193 | Ga0501037_0011193_5096_5845 | 248 |
| 116 | 3300049579 | Ga0501043_0061911 | Ga0501043_0061911_538_1287 | 248 |
| 117 | 3300049580 | Ga0501046_0011358 | Ga0501046_0011358_3939_4688 | 248 |
| 118 | 3300049581 | Ga0501047_0002023 | Ga0501047_0002023_15999_16748 | 248 |
| 119 | 3300049582 | Ga0501048_0019214 | Ga0501048_0019214_905_1654 | 248 |
| 120 | 3300049585 | Ga0501069_0042281 | Ga0501069_0042281_1206_1955 | 248 |
| 121 | 3300049586 | Ga0501070_0006875 | Ga0501070_0006875_3514_4263 | 248 |
| 122 | 3300049742 | Ga0501080_0018162 | Ga0501080_0018162_3004_3753 | 248 |
| 123 | 3300049744 | Ga0501083_0036359 | Ga0501083_0036359_2286_3035 | 248 |
| 124 | 3300049822 | Ga0501035_0002184 | Ga0501035_0002184_13510_14259 | 248 |
| 125 | 3300049823 | Ga0501044_0002158 | Ga0501044_0002158_15991_16740 | 248 |
| 126 | 3300013306 | Ga0163162_10121125 | Ga0163162_101211252 | 249 |
| 127 | 3300031824 | Ga0307413_10429488 | Ga0307413_104294881 | 249 |
| 128 | 3300039437 | Ga0436365_0715051 | Ga0436365_0715051_16686_17438 | 249 |
| 129 | 3300041452 | Ga0451793_1527126 | Ga0451793_1527126_386_1147 | 249 |
| 130 | 3300044719 | Ga0466971_0026763 | Ga0466971_0026763_1450_2202 | 249 |
| 131 | 3300045976 | Ga0466967_0501739 | Ga0466967_0501739_364_1158 | 249 |
| 132 | 3300046694 | Ga0495649_0126004 | Ga0495649_0126004_373_1125 | 249 |
| 133 | 3300049573 | Ga0501037_0000434 | Ga0501037_0000434_20702_21460 | 249 |
| 134 | 3300049574 | Ga0501038_0012184 | Ga0501038_0012184_6563_7321 | 249 |
| 135 | 3300049575 | Ga0501039_0002790 | Ga0501039_0002790_5707_6465 | 249 |
| 136 | 3300049581 | Ga0501047_0022160 | Ga0501047_0022160_3953_4735 | 249 |
| 137 | 3300049586 | Ga0501070_0019114 | Ga0501070_0019114_2046_2804 | 249 |
| 138 | iso_pu_bacteria | 2891968417 | 2891970848 | 249 |
| 139 | 3300003792 | Ga0055540_1000024 | Ga0055540_1000024128 | 250 |
| 140 | 3300005335 | Ga0070666_10459069 | Ga0070666_104590691 | 250 |
| 141 | 3300005367 | Ga0070667_100010253 | Ga0070667_1000102532 | 250 |
| 142 | 3300005435 | Ga0070714_100695337 | Ga0070714_1006953371 | 250 |
| 143 | 3300005436 | Ga0070713_100350786 | Ga0070713_1003507861 | 250 |
| 144 | 3300005614 | Ga0068856_100019507 | Ga0068856_1000195076 | 250 |
| 145 | 3300005614 | Ga0068856_100112546 | Ga0068856_1001125463 | 250 |
| 146 | 3300005616 | Ga0068852_100056443 | Ga0068852_1000564433 | 250 |
| 147 | 3300006038 | Ga0075365_10035069 | Ga0075365_100350692 | 250 |
| 148 | 3300006038 | Ga0075365_10166821 | Ga0075365_101668213 | 250 |
| 149 | 3300006042 | Ga0075368_10031817 | Ga0075368_100318172 | 250 |
| 150 | 3300006048 | Ga0075363_100010009 | Ga0075363_1000100094 | 250 |
| 151 | 3300006048 | Ga0075363_100281014 | Ga0075363_1002810141 | 250 |
| 152 | 3300006051 | Ga0075364_10004332 | Ga0075364_100043325 | 250 |
| 153 | 3300006051 | Ga0075364_10005507 | Ga0075364_100055077 | 250 |
| 154 | 3300006051 | Ga0075364_10362964 | Ga0075364_103629641 | 250 |
| 155 | 3300006177 | Ga0075362_10013469 | Ga0075362_100134693 | 250 |
| 156 | 3300006178 | Ga0075367_10015484 | Ga0075367_100154842 | 250 |
| 157 | 3300006186 | Ga0075369_10054417 | Ga0075369_100544172 | 250 |
| 158 | 3300006353 | Ga0075370_10003387 | Ga0075370_100033877 | 250 |
| 159 | 3300006353 | Ga0075370_10170448 | Ga0075370_101704482 | 250 |
| 160 | 3300009098 | Ga0105245_10010872 | Ga0105245_100108726 | 250 |
| 161 | 3300009098 | Ga0105245_10211953 | Ga0105245_102119533 | 250 |
| 162 | 3300009545 | Ga0105237_10115873 | Ga0105237_101158734 | 250 |
| 163 | 3300010375 | Ga0105239_10014541 | Ga0105239_100145418 | 250 |
| 164 | 3300013306 | Ga0163162_10078462 | Ga0163162_100784623 | 250 |
| 165 | 3300021384 | Ga0213876_10003078 | Ga0213876_100030783 | 250 |
| 166 | 3300021384 | Ga0213876_10003966 | Ga0213876_100039663 | 250 |
| 167 | 3300021384 | Ga0213876_10061787 | Ga0213876_100617872 | 250 |
| 168 | 3300021388 | Ga0213875_10111691 | Ga0213875_101116912 | 250 |
| 169 | 3300025303 | Ga0209051_1000021 | Ga0209051_1000021127 | 250 |
| 170 | 3300025303 | Ga0209051_1017466 | Ga0209051_10174665 | 250 |
| 171 | 3300025903 | Ga0207680_10007483 | Ga0207680_100074834 | 250 |
| 172 | 3300025914 | Ga0207671_10012164 | Ga0207671_100121649 | 250 |
| 173 | 3300025929 | Ga0207664_10495376 | Ga0207664_104953762 | 250 |
| 174 | 3300025949 | Ga0207667_10065977 | Ga0207667_100659772 | 250 |
| 175 | 3300025986 | Ga0207658_10006768 | Ga0207658_100067682 | 250 |
| 176 | 3300025986 | Ga0207658_10191143 | Ga0207658_101911432 | 250 |
| 177 | 3300026023 | Ga0207677_10105422 | Ga0207677_101054223 | 250 |
| 178 | 3300026078 | Ga0207702_10064757 | Ga0207702_100647572 | 250 |
| 179 | 3300026078 | Ga0207702_10072636 | Ga0207702_100726362 | 250 |
| 180 | 3300026142 | Ga0207698_10022545 | Ga0207698_100225454 | 250 |
| 181 | 3300027866 | Ga0209813_10065112 | Ga0209813_100651122 | 250 |
| 182 | 3300031251 | Ga0265327_10099759 | Ga0265327_100997592 | 250 |
| 183 | 3300031901 | Ga0307406_10307061 | Ga0307406_103070611 | 250 |
| 184 | 3300037471 | Ga0395905_0278405 | Ga0395905_0278405_676_1458 | 250 |
| 185 | 3300037853 | Ga0436364_0329205 | Ga0436364_0329205_1882_2637 | 250 |
| 186 | 3300037853 | Ga0436364_0527008 | Ga0436364_0527008_2326_3081 | 250 |
| 187 | 3300037853 | Ga0436364_0604589 | Ga0436364_0604589_4563_5318 | 250 |
| 188 | 3300039437 | Ga0436365_0329583 | Ga0436365_0329583_32259_33014 | 250 |
| 189 | 3300039437 | Ga0436365_0462461 | Ga0436365_0462461_5471_6253 | 250 |
| 190 | 3300039437 | Ga0436365_1490253 | Ga0436365_1490253_2526_3281 | 250 |
| 191 | 3300041410 | Ga0439461_0000774 | Ga0439461_0000774_2370_3125 | 250 |
| 192 | 3300041411 | Ga0439466_0003695 | Ga0439466_0003695_588_1370 | 250 |
| 193 | 3300041413 | Ga0439465_0001000 | Ga0439465_0001000_6943_7698 | 250 |
| 194 | 3300041491 | Ga0451833_1375940 | Ga0451833_1375940_278_1045 | 250 |
| 195 | 3300041997 | Ga0439431_0003707 | Ga0439431_0003707_571_1353 | 250 |
| 196 | 3300042435 | Ga0439434_0000539 | Ga0439434_0000539_363_1118 | 250 |
| 197 | 3300044658 | Ga0466972_0003083 | Ga0466972_0003083_6702_7457 | 250 |
| 198 | 3300044683 | Ga0466965_0007700 | Ga0466965_0007700_153_908 | 250 |
| 199 | 3300044683 | Ga0466965_0015322 | Ga0466965_0015322_55_822 | 250 |
| 200 | 3300044684 | Ga0466966_0008984 | Ga0466966_0008984_3052_3807 | 250 |
| 201 | 3300044693 | Ga0466961_0029368 | Ga0466961_0029368_1623_2378 | 250 |
| 202 | 3300044719 | Ga0466971_0077539 | Ga0466971_0077539_94_849 | 250 |
| 203 | 3300044735 | Ga0466968_0001680 | Ga0466968_0001680_3121_3876 | 250 |
| 204 | 3300044735 | Ga0466968_0003136 | Ga0466968_0003136_2618_3373 | 250 |
| 205 | 3300044765 | Ga0466970_0079569 | Ga0466970_0079569_215_970 | 250 |
| 206 | 3300044842 | Ga0466957_0042990 | Ga0466957_0042990_820_1575 | 250 |
| 207 | 3300044842 | Ga0466957_0485003 | Ga0466957_0485003_78_833 | 250 |
| 208 | 3300044901 | Ga0466960_0001147 | Ga0466960_0001147_1442_2197 | 250 |
| 209 | 3300045049 | Ga0466959_0001357 | Ga0466959_0001357_1245_2000 | 250 |
| 210 | 3300045049 | Ga0466959_0017663 | Ga0466959_0017663_2069_2824 | 250 |
| 211 | 3300045976 | Ga0466967_0023553 | Ga0466967_0023553_2412_3167 | 250 |
| 212 | 3300045976 | Ga0466967_0205356 | Ga0466967_0205356_525_1292 | 250 |
| 213 | 3300046460 | Ga0495638_0096789 | Ga0495638_0096789_133_888 | 250 |
| 214 | 3300047320 | Ga0495672_0024723 | Ga0495672_0024723_998_1753 | 250 |
| 215 | 3300048903 | Ga0496100_0000099 | Ga0496100_0000099_9133_9903 | 250 |
| 216 | 3300048904 | Ga0496101_0000074 | Ga0496101_0000074_41442_42212 | 250 |
| 217 | 3300048906 | Ga0496103_0000381 | Ga0496103_0000381_10714_11484 | 250 |
| 218 | 3300048910 | Ga0496107_0012907 | Ga0496107_0012907_5024_5794 | 250 |
| 219 | 3300048911 | Ga0496108_0000802 | Ga0496108_0000802_22185_22955 | 250 |
| 220 | 3300048911 | Ga0496108_0050142 | Ga0496108_0050142_2347_3102 | 250 |
| 221 | 3300048912 | Ga0496109_0000160 | Ga0496109_0000160_50655_51425 | 250 |
| 222 | 3300048914 | Ga0496111_0016907 | Ga0496111_0016907_2658_3428 | 250 |
| 223 | 3300048917 | Ga0496114_0002368 | Ga0496114_0002368_11169_11939 | 250 |
| 224 | 3300048918 | Ga0496115_0021794 | Ga0496115_0021794_2853_3623 | 250 |
| 225 | 3300048918 | Ga0496115_0459054 | Ga0496115_0459054_208_963 | 250 |
| 226 | 3300048920 | Ga0496117_0025666 | Ga0496117_0025666_3639_4409 | 250 |
| 227 | 3300048921 | Ga0496118_0034057 | Ga0496118_0034057_1404_2174 | 250 |
| 228 | 3300048922 | Ga0496119_0004410 | Ga0496119_0004410_11743_12513 | 250 |
| 229 | 3300048923 | Ga0496120_0034583 | Ga0496120_0034583_259_1029 | 250 |
| 230 | 3300048924 | Ga0496121_0000014 | Ga0496121_0000014_77320_78090 | 250 |
| 231 | 3300048925 | Ga0496122_0000097 | Ga0496122_0000097_77313_78083 | 250 |
| 232 | 3300048926 | Ga0496123_0029402 | Ga0496123_0029402_944_1714 | 250 |
| 233 | 3300048927 | Ga0496124_0000019 | Ga0496124_0000019_77320_78090 | 250 |
| 234 | 3300048928 | Ga0496125_0000014 | Ga0496125_0000014_77320_78090 | 250 |
| 235 | 3300048929 | Ga0496126_0000017 | Ga0496126_0000017_532587_533357 | 250 |
| 236 | 3300048929 | Ga0496126_0059304 | Ga0496126_0059304_1063_1818 | 250 |
| 237 | 3300049571 | Ga0501034_0059563 | Ga0501034_0059563_276_1058 | 250 |
| 238 | 3300049579 | Ga0501043_0333361 | Ga0501043_0333361_223_978 | 250 |
| 239 | 3300050490 | nmdc:mga03n38_24393_c1 | nmdc:mga03n38_24393_c1_1540_2295 | 250 |
| 240 | 3300050490 | nmdc:mga03n38_78819_c1 | nmdc:mga03n38_78819_c1_527_1282 | 250 |
| 241 | 3300050491 | nmdc:mga00v17_161264_c1 | nmdc:mga00v17_161264_c1_447_1202 | 250 |
| 242 | 3300050491 | nmdc:mga00v17_2413_c1 | nmdc:mga00v17_2413_c1_8724_9479 | 250 |
| 243 | 3300050491 | nmdc:mga00v17_3084_c1 | nmdc:mga00v17_3084_c1_507_1262 | 250 |
| 244 | 3300050491 | nmdc:mga00v17_610_c1 | nmdc:mga00v17_610_c1_1009_1764 | 250 |
| 245 | 3300050491 | nmdc:mga00v17_7742_c2 | nmdc:mga00v17_7742_c2_469_1224 | 250 |
| 246 | 3300050492 | nmdc:mga0yw44_64568_c1 | nmdc:mga0yw44_64568_c1_105_860 | 250 |
| 247 | 3300050494 | nmdc:mga06z11_111279_c1 | nmdc:mga06z11_111279_c1_569_1324 | 250 |
| 248 | 3300050494 | nmdc:mga06z11_256899_c1 | nmdc:mga06z11_256899_c1_84_839 | 250 |
| 249 | 3300050495 | nmdc:mga04h51_21258_c1 | nmdc:mga04h51_21258_c1_856_1611 | 250 |
| 250 | 3300050496 | nmdc:mga07m45_110949_c1 | nmdc:mga07m45_110949_c1_695_1450 | 250 |
| 251 | 3300050516 | nmdc:mga0sz30_32770_c1 | nmdc:mga0sz30_32770_c1_235_990 | 250 |
| 252 | 3300050516 | nmdc:mga0sz30_64339_c1 | nmdc:mga0sz30_64339_c1_254_1009 | 250 |
| 253 | 3300053087 | Ga0500643_005328 | Ga0500643_005328_3569_4324 | 250 |
| 254 | 3300053131 | Ga0500652_048020 | Ga0500652_048020_339_1094 | 250 |
| 255 | 3300053146 | Ga0500588_0038768 | Ga0500588_0038768_108_863 | 250 |
| 256 | 3300053730 | Ga0500645_000006 | Ga0500645_000006_65947_66702 | 250 |
| 257 | iso_pu_bacteria | 2738541264 | 2738665368 | 250 |
| 258 | iso_pu_bacteria | 2738541356 | 2739144502 | 250 |
| 259 | 3300001990 | JGI24737J22298_10034751 | JGI24737J22298_100347512 | 251 |
| 260 | 3300001991 | JGI24743J22301_10002277 | JGI24743J22301_100022773 | 251 |
| 261 | 3300002074 | JGI24748J21848_1004168 | JGI24748J21848_10041682 | 251 |
| 262 | 3300002077 | JGI24744J21845_10000053 | JGI24744J21845_100000538 | 251 |
| 263 | 3300002239 | JGI24034J26672_10012446 | JGI24034J26672_100124462 | 251 |
| 264 | 3300002244 | JGI24742J22300_10001182 | JGI24742J22300_100011822 | 251 |
| 265 | 3300003320 | rootH2_10144049 | rootH2_101440494 | 251 |
| 266 | 3300003322 | rootL2_10131486 | rootL2_101314862 | 251 |
| 267 | 3300003792 | Ga0055540_1001685 | Ga0055540_100168510 | 251 |
| 268 | 3300003792 | Ga0055540_1003063 | Ga0055540_10030638 | 251 |
| 269 | 3300003792 | Ga0055540_1011186 | Ga0055540_10111861 | 251 |
| 270 | 3300005327 | Ga0070658_10067970 | Ga0070658_100679702 | 251 |
| 271 | 3300005330 | Ga0070690_100001292 | Ga0070690_1000012927 | 251 |
| 272 | 3300005331 | Ga0070670_100409606 | Ga0070670_1004096061 | 251 |
| 273 | 3300005334 | Ga0068869_100012633 | Ga0068869_1000126334 | 251 |
| 274 | 3300005337 | Ga0070682_100001916 | Ga0070682_1000019168 | 251 |
| 275 | 3300005337 | Ga0070682_100010417 | Ga0070682_1000104176 | 251 |
| 276 | 3300005337 | Ga0070682_100070943 | Ga0070682_1000709432 | 251 |
| 277 | 3300005338 | Ga0068868_100009639 | Ga0068868_1000096396 | 251 |
| 278 | 3300005338 | Ga0068868_100183131 | Ga0068868_1001831312 | 251 |
| 279 | 3300005339 | Ga0070660_100029280 | Ga0070660_1000292802 | 251 |
| 280 | 3300005340 | Ga0070689_100018207 | Ga0070689_1000182076 | 251 |
| 281 | 3300005341 | Ga0070691_10001466 | Ga0070691_100014666 | 251 |
| 282 | 3300005345 | Ga0070692_10160066 | Ga0070692_101600662 | 251 |
| 283 | 3300005347 | Ga0070668_100000358 | Ga0070668_10000035820 | 251 |
| 284 | 3300005347 | Ga0070668_100018368 | Ga0070668_1000183685 | 251 |
| 285 | 3300005347 | Ga0070668_100065415 | Ga0070668_1000654152 | 251 |
| 286 | 3300005347 | Ga0070668_100136161 | Ga0070668_1001361611 | 251 |
| 287 | 3300005353 | Ga0070669_100001662 | Ga0070669_1000016626 | 251 |
| 288 | 3300005353 | Ga0070669_100008249 | Ga0070669_1000082493 | 251 |
| 289 | 3300005355 | Ga0070671_100110992 | Ga0070671_1001109924 | 251 |
| 290 | 3300005355 | Ga0070671_100160681 | Ga0070671_1001606812 | 251 |
| 291 | 3300005355 | Ga0070671_100289776 | Ga0070671_1002897762 | 251 |
| 292 | 3300005356 | Ga0070674_100003807 | Ga0070674_1000038078 | 251 |
| 293 | 3300005365 | Ga0070688_100002128 | Ga0070688_1000021288 | 251 |
| 294 | 3300005365 | Ga0070688_100027921 | Ga0070688_1000279212 | 251 |
| 295 | 3300005366 | Ga0070659_100239859 | Ga0070659_1002398592 | 251 |
| 296 | 3300005367 | Ga0070667_100000075 | Ga0070667_10000007538 | 251 |
| 297 | 3300005367 | Ga0070667_100004048 | Ga0070667_10000404810 | 251 |
| 298 | 3300005367 | Ga0070667_100012854 | Ga0070667_1000128546 | 251 |
| 299 | 3300005434 | Ga0070709_10005095 | Ga0070709_100050952 | 251 |
| 300 | 3300005434 | Ga0070709_10046065 | Ga0070709_100460655 | 251 |
| 301 | 3300005437 | Ga0070710_10001540 | Ga0070710_100015403 | 251 |
| 302 | 3300005439 | Ga0070711_100001591 | Ga0070711_1000015919 | 251 |
| 303 | 3300005439 | Ga0070711_100063796 | Ga0070711_1000637962 | 251 |
| 304 | 3300005441 | Ga0070700_100014110 | Ga0070700_1000141106 | 251 |
| 305 | 3300005441 | Ga0070700_100022565 | Ga0070700_1000225653 | 251 |
| 306 | 3300005444 | Ga0070694_100018714 | Ga0070694_1000187146 | 251 |
| 307 | 3300005444 | Ga0070694_100061073 | Ga0070694_1000610732 | 251 |
| 308 | 3300005455 | Ga0070663_100002640 | Ga0070663_1000026408 | 251 |
| 309 | 3300005455 | Ga0070663_100576858 | Ga0070663_1005768581 | 251 |
| 310 | 3300005456 | Ga0070678_100001197 | Ga0070678_1000011974 | 251 |
| 311 | 3300005457 | Ga0070662_100010769 | Ga0070662_1000107696 | 251 |
| 312 | 3300005457 | Ga0070662_100297193 | Ga0070662_1002971931 | 251 |
| 313 | 3300005459 | Ga0068867_100006287 | Ga0068867_1000062874 | 251 |
| 314 | 3300005466 | Ga0070685_10057771 | Ga0070685_100577712 | 251 |
| 315 | 3300005466 | Ga0070685_10131527 | Ga0070685_101315272 | 251 |
| 316 | 3300005539 | Ga0068853_100064641 | Ga0068853_1000646414 | 251 |
| 317 | 3300005543 | Ga0070672_100459220 | Ga0070672_1004592201 | 251 |
| 318 | 3300005544 | Ga0070686_100279959 | Ga0070686_1002799592 | 251 |
| 319 | 3300005545 | Ga0070695_100040554 | Ga0070695_1000405545 | 251 |
| 320 | 3300005546 | Ga0070696_100003435 | Ga0070696_1000034356 | 251 |
| 321 | 3300005546 | Ga0070696_100127567 | Ga0070696_1001275672 | 251 |
| 322 | 3300005547 | Ga0070693_100032667 | Ga0070693_1000326674 | 251 |
| 323 | 3300005548 | Ga0070665_100005474 | Ga0070665_1000054747 | 251 |
| 324 | 3300005548 | Ga0070665_100006380 | Ga0070665_1000063808 | 251 |
| 325 | 3300005548 | Ga0070665_100259269 | Ga0070665_1002592692 | 251 |
| 326 | 3300005548 | Ga0070665_100319577 | Ga0070665_1003195772 | 251 |
| 327 | 3300005549 | Ga0070704_100000391 | Ga0070704_10000039116 | 251 |
| 328 | 3300005549 | Ga0070704_100036324 | Ga0070704_1000363245 | 251 |
| 329 | 3300005563 | Ga0068855_100113289 | Ga0068855_1001132892 | 251 |
| 330 | 3300005563 | Ga0068855_100146922 | Ga0068855_1001469224 | 251 |
| 331 | 3300005578 | Ga0068854_100071073 | Ga0068854_1000710733 | 251 |
| 332 | 3300005615 | Ga0070702_100001144 | Ga0070702_1000011449 | 251 |
| 333 | 3300005615 | Ga0070702_100498725 | Ga0070702_1004987251 | 251 |
| 334 | 3300005617 | Ga0068859_100000606 | Ga0068859_10000060618 | 251 |
| 335 | 3300005617 | Ga0068859_100003251 | Ga0068859_1000032518 | 251 |
| 336 | 3300005618 | Ga0068864_100046674 | Ga0068864_1000466742 | 251 |
| 337 | 3300005718 | Ga0068866_10069786 | Ga0068866_100697862 | 251 |
| 338 | 3300005719 | Ga0068861_100337538 | Ga0068861_1003375382 | 251 |
| 339 | 3300005841 | Ga0068863_100002748 | Ga0068863_1000027482 | 251 |
| 340 | 3300005841 | Ga0068863_100051087 | Ga0068863_1000510876 | 251 |
| 341 | 3300005842 | Ga0068858_100001109 | Ga0068858_1000011098 | 251 |
| 342 | 3300005842 | Ga0068858_100106992 | Ga0068858_1001069922 | 251 |
| 343 | 3300005843 | Ga0068860_100000025 | Ga0068860_100000025153 | 251 |
| 344 | 3300005843 | Ga0068860_100012429 | Ga0068860_1000124298 | 251 |
| 345 | 3300005844 | Ga0068862_100000045 | Ga0068862_100000045153 | 251 |
| 346 | 3300005844 | Ga0068862_100001869 | Ga0068862_10000186913 | 251 |
| 347 | 3300005844 | Ga0068862_100186010 | Ga0068862_1001860102 | 251 |
| 348 | 3300005844 | Ga0068862_100340792 | Ga0068862_1003407922 | 251 |
| 349 | 3300005937 | Ga0081455_10093207 | Ga0081455_100932074 | 251 |
| 350 | 3300005981 | Ga0081538_10043770 | Ga0081538_100437704 | 251 |
| 351 | 3300006038 | Ga0075365_10028768 | Ga0075365_100287683 | 251 |
| 352 | 3300006038 | Ga0075365_10345155 | Ga0075365_103451552 | 251 |
| 353 | 3300006042 | Ga0075368_10001245 | Ga0075368_100012456 | 251 |
| 354 | 3300006042 | Ga0075368_10010130 | Ga0075368_100101304 | 251 |
| 355 | 3300006048 | Ga0075363_100000597 | Ga0075363_1000005979 | 251 |
| 356 | 3300006048 | Ga0075363_100009537 | Ga0075363_1000095372 | 251 |
| 357 | 3300006048 | Ga0075363_100157541 | Ga0075363_1001575412 | 251 |
| 358 | 3300006051 | Ga0075364_10004468 | Ga0075364_100044682 | 251 |
| 359 | 3300006051 | Ga0075364_10020193 | Ga0075364_100201935 | 251 |
| 360 | 3300006051 | Ga0075364_10265141 | Ga0075364_102651411 | 251 |
| 361 | 3300006163 | Ga0070715_10030963 | Ga0070715_100309632 | 251 |
| 362 | 3300006163 | Ga0070715_10095474 | Ga0070715_100954742 | 251 |
| 363 | 3300006173 | Ga0070716_100001115 | Ga0070716_1000011156 | 251 |
| 364 | 3300006173 | Ga0070716_100013982 | Ga0070716_1000139822 | 251 |
| 365 | 3300006175 | Ga0070712_100313096 | Ga0070712_1003130962 | 251 |
| 366 | 3300006177 | Ga0075362_10008504 | Ga0075362_100085043 | 251 |
| 367 | 3300006178 | Ga0075367_10009955 | Ga0075367_100099554 | 251 |
| 368 | 3300006178 | Ga0075367_10066186 | Ga0075367_100661863 | 251 |
| 369 | 3300006178 | Ga0075367_10102484 | Ga0075367_101024842 | 251 |
| 370 | 3300006178 | Ga0075367_10389158 | Ga0075367_103891582 | 251 |
| 371 | 3300006186 | Ga0075369_10004473 | Ga0075369_100044735 | 251 |
| 372 | 3300006186 | Ga0075369_10013887 | Ga0075369_100138873 | 251 |
| 373 | 3300006237 | Ga0097621_100054694 | Ga0097621_1000546943 | 251 |
| 374 | 3300006353 | Ga0075370_10002478 | Ga0075370_100024787 | 251 |
| 375 | 3300006353 | Ga0075370_10022644 | Ga0075370_100226442 | 251 |
| 376 | 3300006353 | Ga0075370_10075269 | Ga0075370_100752692 | 251 |
| 377 | 3300006353 | Ga0075370_10077069 | Ga0075370_100770691 | 251 |
| 378 | 3300006358 | Ga0068871_100205001 | Ga0068871_1002050013 | 251 |
| 379 | 3300006844 | Ga0075428_100004846 | Ga0075428_1000048467 | 251 |
| 380 | 3300006846 | Ga0075430_100077655 | Ga0075430_1000776552 | 251 |
| 381 | 3300006847 | Ga0075431_100009857 | Ga0075431_1000098573 | 251 |
| 382 | 3300006880 | Ga0075429_100156557 | Ga0075429_1001565572 | 251 |
| 383 | 3300006931 | Ga0097620_100000606 | Ga0097620_10000060618 | 251 |
| 384 | 3300006931 | Ga0097620_100003251 | Ga0097620_1000032518 | 251 |
| 385 | 3300007788 | Ga0099795_10007788 | Ga0099795_100077883 | 251 |
| 386 | 3300009092 | Ga0105250_10151479 | Ga0105250_101514792 | 251 |
| 387 | 3300009098 | Ga0105245_10002903 | Ga0105245_1000290314 | 251 |
| 388 | 3300009098 | Ga0105245_10831686 | Ga0105245_108316862 | 251 |
| 389 | 3300009101 | Ga0105247_10000010 | Ga0105247_10000010181 | 251 |
| 390 | 3300009101 | Ga0105247_10000366 | Ga0105247_1000036633 | 251 |
| 391 | 3300009147 | Ga0114129_10005689 | Ga0114129_1000568917 | 251 |
| 392 | 3300009148 | Ga0105243_10001450 | Ga0105243_1000145013 | 251 |
| 393 | 3300009148 | Ga0105243_10060285 | Ga0105243_100602855 | 251 |
| 394 | 3300009176 | Ga0105242_10004714 | Ga0105242_100047142 | 251 |
| 395 | 3300009177 | Ga0105248_10000145 | Ga0105248_1000014551 | 251 |
| 396 | 3300009177 | Ga0105248_10002194 | Ga0105248_1000219411 | 251 |
| 397 | 3300009177 | Ga0105248_10152352 | Ga0105248_101523523 | 251 |
| 398 | 3300009177 | Ga0105248_10169093 | Ga0105248_101690932 | 251 |
| 399 | 3300009545 | Ga0105237_10001648 | Ga0105237_1000164816 | 251 |
| 400 | 3300009545 | Ga0105237_10025835 | Ga0105237_100258357 | 251 |
| 401 | 3300009551 | Ga0105238_10344128 | Ga0105238_103441282 | 251 |
| 402 | 3300009553 | Ga0105249_10000010 | Ga0105249_10000010176 | 251 |
| 403 | 3300009553 | Ga0105249_10039645 | Ga0105249_100396455 | 251 |
| 404 | 3300009553 | Ga0105249_10767213 | Ga0105249_107672132 | 251 |
| 405 | 3300010159 | Ga0099796_10009296 | Ga0099796_100092962 | 251 |
| 406 | 3300010375 | Ga0105239_10020241 | Ga0105239_100202415 | 251 |
| 407 | 3300010375 | Ga0105239_10152069 | Ga0105239_101520692 | 251 |
| 408 | 3300010375 | Ga0105239_10772287 | Ga0105239_107722872 | 251 |
| 409 | 3300011119 | Ga0105246_10070009 | Ga0105246_100700095 | 251 |
| 410 | 3300013105 | Ga0157369_10128021 | Ga0157369_101280214 | 251 |
| 411 | 3300013296 | Ga0157374_10124344 | Ga0157374_101243444 | 251 |
| 412 | 3300013297 | Ga0157378_10001442 | Ga0157378_1000144212 | 251 |
| 413 | 3300013297 | Ga0157378_10169980 | Ga0157378_101699802 | 251 |
| 414 | 3300013306 | Ga0163162_10002768 | Ga0163162_1000276810 | 251 |
| 415 | 3300013307 | Ga0157372_10009077 | Ga0157372_100090778 | 251 |
| 416 | 3300013308 | Ga0157375_10001272 | Ga0157375_1000127214 | 251 |
| 417 | 3300013308 | Ga0157375_10018997 | Ga0157375_100189974 | 251 |
| 418 | 3300013308 | Ga0157375_10064643 | Ga0157375_100646436 | 251 |
| 419 | 3300014325 | Ga0163163_10238755 | Ga0163163_102387552 | 251 |
| 420 | 3300014326 | Ga0157380_10000302 | Ga0157380_1000030221 | 251 |
| 421 | 3300014745 | Ga0157377_10064134 | Ga0157377_100641342 | 251 |
| 422 | 3300014745 | Ga0157377_10119012 | Ga0157377_101190122 | 251 |
| 423 | 3300014968 | Ga0157379_10002729 | Ga0157379_100027291 | 251 |
| 424 | 3300014968 | Ga0157379_10520261 | Ga0157379_105202612 | 251 |
| 425 | 3300014969 | Ga0157376_10388622 | Ga0157376_103886222 | 251 |
| 426 | 3300017792 | Ga0163161_10000799 | Ga0163161_1000079911 | 251 |
| 427 | 3300021388 | Ga0213875_10014036 | Ga0213875_100140363 | 251 |
| 428 | 3300025273 | Ga0209673_1013423 | Ga0209673_10134233 | 251 |
| 429 | 3300025273 | Ga0209673_1037922 | Ga0209673_10379222 | 251 |
| 430 | 3300025303 | Ga0209051_1000613 | Ga0209051_100061312 | 251 |
| 431 | 3300025303 | Ga0209051_1004881 | Ga0209051_10048816 | 251 |
| 432 | 3300025303 | Ga0209051_1021120 | Ga0209051_10211201 | 251 |
| 433 | 3300025303 | Ga0209051_1033181 | Ga0209051_10331813 | 251 |
| 434 | 3300025893 | Ga0207682_10044059 | Ga0207682_100440593 | 251 |
| 435 | 3300025899 | Ga0207642_10000143 | Ga0207642_1000014313 | 251 |
| 436 | 3300025899 | Ga0207642_10011054 | Ga0207642_100110543 | 251 |
| 437 | 3300025900 | Ga0207710_10000028 | Ga0207710_10000028183 | 251 |
| 438 | 3300025900 | Ga0207710_10001961 | Ga0207710_100019618 | 251 |
| 439 | 3300025901 | Ga0207688_10000090 | Ga0207688_1000009027 | 251 |
| 440 | 3300025903 | Ga0207680_10027001 | Ga0207680_100270015 | 251 |
| 441 | 3300025904 | Ga0207647_10076037 | Ga0207647_100760372 | 251 |
| 442 | 3300025905 | Ga0207685_10005331 | Ga0207685_100053312 | 251 |
| 443 | 3300025906 | Ga0207699_10012071 | Ga0207699_100120713 | 251 |
| 444 | 3300025907 | Ga0207645_10027091 | Ga0207645_100270913 | 251 |
| 445 | 3300025909 | Ga0207705_10052540 | Ga0207705_100525402 | 251 |
| 446 | 3300025911 | Ga0207654_10146511 | Ga0207654_101465112 | 251 |
| 447 | 3300025914 | Ga0207671_10007464 | Ga0207671_100074647 | 251 |
| 448 | 3300025914 | Ga0207671_10225188 | Ga0207671_102251882 | 251 |
| 449 | 3300025914 | Ga0207671_10256277 | Ga0207671_102562772 | 251 |
| 450 | 3300025915 | Ga0207693_10000555 | Ga0207693_100005558 | 251 |
| 451 | 3300025915 | Ga0207693_10002064 | Ga0207693_100020649 | 251 |
| 452 | 3300025916 | Ga0207663_10002170 | Ga0207663_100021708 | 251 |
| 453 | 3300025916 | Ga0207663_10016673 | Ga0207663_100166735 | 251 |
| 454 | 3300025919 | Ga0207657_10023644 | Ga0207657_100236445 | 251 |
| 455 | 3300025919 | Ga0207657_10182161 | Ga0207657_101821612 | 251 |
| 456 | 3300025923 | Ga0207681_10006072 | Ga0207681_100060725 | 251 |
| 457 | 3300025923 | Ga0207681_10202684 | Ga0207681_102026842 | 251 |
| 458 | 3300025923 | Ga0207681_10363242 | Ga0207681_103632422 | 251 |
| 459 | 3300025924 | Ga0207694_10177770 | Ga0207694_101777703 | 251 |
| 460 | 3300025927 | Ga0207687_10118500 | Ga0207687_101185002 | 251 |
| 461 | 3300025931 | Ga0207644_10100117 | Ga0207644_101001172 | 251 |
| 462 | 3300025931 | Ga0207644_10117672 | Ga0207644_101176722 | 251 |
| 463 | 3300025932 | Ga0207690_10066555 | Ga0207690_100665552 | 251 |
| 464 | 3300025932 | Ga0207690_10090838 | Ga0207690_100908383 | 251 |
| 465 | 3300025933 | Ga0207706_10005251 | Ga0207706_100052516 | 251 |
| 466 | 3300025933 | Ga0207706_10016540 | Ga0207706_100165406 | 251 |
| 467 | 3300025934 | Ga0207686_10001099 | Ga0207686_100010998 | 251 |
| 468 | 3300025934 | Ga0207686_10006362 | Ga0207686_100063626 | 251 |
| 469 | 3300025935 | Ga0207709_10002258 | Ga0207709_100022588 | 251 |
| 470 | 3300025935 | Ga0207709_10020594 | Ga0207709_100205943 | 251 |
| 471 | 3300025936 | Ga0207670_10029755 | Ga0207670_100297552 | 251 |
| 472 | 3300025937 | Ga0207669_10000752 | Ga0207669_100007529 | 251 |
| 473 | 3300025938 | Ga0207704_10000393 | Ga0207704_100003937 | 251 |
| 474 | 3300025938 | Ga0207704_10292331 | Ga0207704_102923312 | 251 |
| 475 | 3300025939 | Ga0207665_10001801 | Ga0207665_100018019 | 251 |
| 476 | 3300025939 | Ga0207665_10003000 | Ga0207665_100030006 | 251 |
| 477 | 3300025940 | Ga0207691_10092066 | Ga0207691_100920664 | 251 |
| 478 | 3300025941 | Ga0207711_10000069 | Ga0207711_1000006923 | 251 |
| 479 | 3300025941 | Ga0207711_10019795 | Ga0207711_100197953 | 251 |
| 480 | 3300025942 | Ga0207689_10022958 | Ga0207689_100229583 | 251 |
| 481 | 3300025949 | Ga0207667_10168052 | Ga0207667_101680523 | 251 |
| 482 | 3300025961 | Ga0207712_10000016 | Ga0207712_10000016177 | 251 |
| 483 | 3300025972 | Ga0207668_10005693 | Ga0207668_100056935 | 251 |
| 484 | 3300025972 | Ga0207668_10011820 | Ga0207668_100118204 | 251 |
| 485 | 3300025981 | Ga0207640_10036129 | Ga0207640_100361292 | 251 |
| 486 | 3300025981 | Ga0207640_10085728 | Ga0207640_100857283 | 251 |
| 487 | 3300025986 | Ga0207658_10000237 | Ga0207658_1000023718 | 251 |
| 488 | 3300025986 | Ga0207658_10002082 | Ga0207658_100020829 | 251 |
| 489 | 3300026023 | Ga0207677_10003455 | Ga0207677_100034554 | 251 |
| 490 | 3300026035 | Ga0207703_10044415 | Ga0207703_100444152 | 251 |
| 491 | 3300026035 | Ga0207703_10054887 | Ga0207703_100548873 | 251 |
| 492 | 3300026041 | Ga0207639_10003107 | Ga0207639_100031076 | 251 |
| 493 | 3300026067 | Ga0207678_10003318 | Ga0207678_1000331815 | 251 |
| 494 | 3300026067 | Ga0207678_10011227 | Ga0207678_100112277 | 251 |
| 495 | 3300026067 | Ga0207678_10013849 | Ga0207678_100138492 | 251 |
| 496 | 3300026067 | Ga0207678_10071204 | Ga0207678_100712044 | 251 |
| 497 | 3300026075 | Ga0207708_10006978 | Ga0207708_100069787 | 251 |
| 498 | 3300026088 | Ga0207641_10001368 | Ga0207641_1000136829 | 251 |
| 499 | 3300026088 | Ga0207641_10025646 | Ga0207641_100256463 | 251 |
| 500 | 3300026089 | Ga0207648_10000349 | Ga0207648_1000034924 | 251 |
| 501 | 3300026095 | Ga0207676_10094326 | Ga0207676_100943262 | 251 |
| 502 | 3300026118 | Ga0207675_100006409 | Ga0207675_10000640911 | 251 |
| 503 | 3300026118 | Ga0207675_100014856 | Ga0207675_1000148562 | 251 |
| 504 | 3300026121 | Ga0207683_10000040 | Ga0207683_1000004055 | 251 |
| 505 | 3300026121 | Ga0207683_10079665 | Ga0207683_100796653 | 251 |
| 506 | 3300027512 | Ga0209179_1031603 | Ga0209179_10316031 | 251 |
| 507 | 3300027866 | Ga0209813_10011469 | Ga0209813_100114693 | 251 |
| 508 | 3300028379 | Ga0268266_10002967 | Ga0268266_100029673 | 251 |
| 509 | 3300028379 | Ga0268266_10005675 | Ga0268266_100056758 | 251 |
| 510 | 3300028379 | Ga0268266_10036703 | Ga0268266_100367034 | 251 |
| 511 | 3300028379 | Ga0268266_10139919 | Ga0268266_101399192 | 251 |
| 512 | 3300028380 | Ga0268265_10000056 | Ga0268265_10000056147 | 251 |
| 513 | 3300028380 | Ga0268265_10005589 | Ga0268265_100055896 | 251 |
| 514 | 3300028381 | Ga0268264_10000053 | Ga0268264_10000053177 | 251 |
| 515 | 3300031824 | Ga0307413_10069929 | Ga0307413_100699292 | 251 |
| 516 | 3300031824 | Ga0307413_10170437 | Ga0307413_101704371 | 251 |
| 517 | 3300031852 | Ga0307410_10034781 | Ga0307410_100347812 | 251 |
| 518 | 3300031903 | Ga0307407_10122973 | Ga0307407_101229731 | 251 |
| 519 | 3300031911 | Ga0307412_10142258 | Ga0307412_101422582 | 251 |
| 520 | 3300031995 | Ga0307409_100041086 | Ga0307409_1000410862 | 251 |
| 521 | 3300032002 | Ga0307416_100659608 | Ga0307416_1006596081 | 251 |
| 522 | 3300032002 | Ga0307416_101085556 | Ga0307416_1010855561 | 251 |
| 523 | 3300032005 | Ga0307411_10019423 | Ga0307411_100194232 | 251 |
| 524 | 3300032126 | Ga0307415_100035856 | Ga0307415_1000358562 | 251 |
| 525 | 3300035092 | Ga0373952_0085084 | Ga0373952_0085084_20_778 | 251 |
| 526 | 3300035114 | Ga0373939_0022264 | Ga0373939_0022264_729_1487 | 251 |
| 527 | 3300035121 | Ga0373960_0036861 | Ga0373960_0036861_187_945 | 251 |
| 528 | 3300035241 | Ga0373961_0051478 | Ga0373961_0051478_338_1096 | 251 |
| 529 | 3300035691 | Ga0373931_0045619 | Ga0373931_0045619_588_1349 | 251 |
| 530 | 3300035691 | Ga0373931_0093273 | Ga0373931_0093273_306_1064 | 251 |
| 531 | 3300035692 | Ga0373935_0555988 | Ga0373935_0555988_55_822 | 251 |
| 532 | 3300036647 | Ga0316582_0012630 | Ga0316582_0012630_57_815 | 251 |
| 533 | 3300037418 | Ga0395900_0057306 | Ga0395900_0057306_1053_1838 | 251 |
| 534 | 3300037418 | Ga0395900_0300231 | Ga0395900_0300231_787_1572 | 251 |
| 535 | 3300037466 | Ga0395898_0050328 | Ga0395898_0050328_2151_2936 | 251 |
| 536 | 3300037466 | Ga0395898_0275014 | Ga0395898_0275014_54_830 | 251 |
| 537 | 3300037471 | Ga0395905_0049703 | Ga0395905_0049703_2910_3695 | 251 |
| 538 | 3300037853 | Ga0436364_0142680 | Ga0436364_0142680_3824_4609 | 251 |
| 539 | 3300038443 | Ga0395901_0299200 | Ga0395901_0299200_248_1033 | 251 |
| 540 | 3300039437 | Ga0436365_0662080 | Ga0436365_0662080_4738_5523 | 251 |
| 541 | 3300041411 | Ga0439466_0005991 | Ga0439466_0005991_74_859 | 251 |
| 542 | 3300041411 | Ga0439466_0007929 | Ga0439466_0007929_129_896 | 251 |
| 543 | 3300041413 | Ga0439465_0000439 | Ga0439465_0000439_8246_9013 | 251 |
| 544 | 3300041413 | Ga0439465_0004076 | Ga0439465_0004076_1991_2752 | 251 |
| 545 | 3300041413 | Ga0439465_0011408 | Ga0439465_0011408_639_1433 | 251 |
| 546 | 3300041459 | Ga0451800_0101687 | Ga0451800_0101687_638_1405 | 251 |
| 547 | 3300041498 | Ga0451841_1098966 | Ga0451841_1098966_305_1069 | 251 |
| 548 | 3300041509 | Ga0451843_0775765 | Ga0451843_0775765_262_1080 | 251 |
| 549 | 3300041512 | Ga0451853_3507486 | Ga0451853_3507486_218_982 | 251 |
| 550 | 3300041997 | Ga0439431_0001548 | Ga0439431_0001548_2607_3392 | 251 |
| 551 | 3300041997 | Ga0439431_0031811 | Ga0439431_0031811_444_1268 | 251 |
| 552 | 3300042002 | Ga0439442_007871 | Ga0439442_007871_736_1521 | 251 |
| 553 | 3300042004 | Ga0439445_0023205 | Ga0439445_0023205_404_1171 | 251 |
| 554 | 3300042004 | Ga0439445_0030949 | Ga0439445_0030949_107_931 | 251 |
| 555 | 3300042006 | Ga0439432_012691 | Ga0439432_012691_665_1459 | 251 |
| 556 | 3300042438 | Ga0439459_0006870 | Ga0439459_0006870_755_1513 | 251 |
| 557 | 3300044658 | Ga0466972_0003077 | Ga0466972_0003077_641_1429 | 251 |
| 558 | 3300044658 | Ga0466972_0003605 | Ga0466972_0003605_3736_4500 | 251 |
| 559 | 3300044658 | Ga0466972_0019824 | Ga0466972_0019824_1107_1892 | 251 |
| 560 | 3300044658 | Ga0466972_0083631 | Ga0466972_0083631_458_1222 | 251 |
| 561 | 3300044683 | Ga0466965_0001504 | Ga0466965_0001504_5166_5930 | 251 |
| 562 | 3300044683 | Ga0466965_0019122 | Ga0466965_0019122_1082_1867 | 251 |
| 563 | 3300044683 | Ga0466965_0055260 | Ga0466965_0055260_1109_1897 | 251 |
| 564 | 3300044683 | Ga0466965_0099532 | Ga0466965_0099532_122_880 | 251 |
| 565 | 3300044684 | Ga0466966_0005329 | Ga0466966_0005329_1826_2584 | 251 |
| 566 | 3300044684 | Ga0466966_0033633 | Ga0466966_0033633_642_1400 | 251 |
| 567 | 3300044684 | Ga0466966_0131190 | Ga0466966_0131190_301_1089 | 251 |
| 568 | 3300044693 | Ga0466961_0003903 | Ga0466961_0003903_4197_4955 | 251 |
| 569 | 3300044693 | Ga0466961_0055195 | Ga0466961_0055195_625_1413 | 251 |
| 570 | 3300044706 | Ga0466964_0056249 | Ga0466964_0056249_521_1282 | 251 |
| 571 | 3300044719 | Ga0466971_0008487 | Ga0466971_0008487_2327_3115 | 251 |
| 572 | 3300044735 | Ga0466968_0008896 | Ga0466968_0008896_602_1366 | 251 |
| 573 | 3300044735 | Ga0466968_0061591 | Ga0466968_0061591_14_772 | 251 |
| 574 | 3300044735 | Ga0466968_0120096 | Ga0466968_0120096_155_943 | 251 |
| 575 | 3300044765 | Ga0466970_0008022 | Ga0466970_0008022_4009_4797 | 251 |
| 576 | 3300044765 | Ga0466970_0078052 | Ga0466970_0078052_400_1164 | 251 |
| 577 | 3300044842 | Ga0466957_0004906 | Ga0466957_0004906_4258_5016 | 251 |
| 578 | 3300044842 | Ga0466957_0006947 | Ga0466957_0006947_1163_1951 | 251 |
| 579 | 3300044842 | Ga0466957_0153895 | Ga0466957_0153895_307_1065 | 251 |
| 580 | 3300044901 | Ga0466960_0000196 | Ga0466960_0000196_16282_17046 | 251 |
| 581 | 3300044901 | Ga0466960_0122136 | Ga0466960_0122136_495_1256 | 251 |
| 582 | 3300044901 | Ga0466960_0129642 | Ga0466960_0129642_509_1267 | 251 |
| 583 | 3300045049 | Ga0466959_0002337 | Ga0466959_0002337_4436_5224 | 251 |
| 584 | 3300045049 | Ga0466959_0003100 | Ga0466959_0003100_7496_8254 | 251 |
| 585 | 3300045049 | Ga0466959_0072859 | Ga0466959_0072859_1015_1779 | 251 |
| 586 | 3300045836 | Ga0466958_0019584 | Ga0466958_0019584_1402_2160 | 251 |
| 587 | 3300045836 | Ga0466958_0051352 | Ga0466958_0051352_547_1335 | 251 |
| 588 | 3300045836 | Ga0466958_0099092 | Ga0466958_0099092_927_1715 | 251 |
| 589 | 3300045976 | Ga0466967_0001060 | Ga0466967_0001060_2118_2876 | 251 |
| 590 | 3300045976 | Ga0466967_0032737 | Ga0466967_0032737_2840_3601 | 251 |
| 591 | 3300045976 | Ga0466967_0125613 | Ga0466967_0125613_18_776 | 251 |
| 592 | 3300045976 | Ga0466967_0166095 | Ga0466967_0166095_38_826 | 251 |
| 593 | 3300046460 | Ga0495638_0006330 | Ga0495638_0006330_7344_8102 | 251 |
| 594 | 3300046473 | Ga0495582_0064951 | Ga0495582_0064951_1212_1979 | 251 |
| 595 | 3300046475 | Ga0495639_0017325 | Ga0495639_0017325_1968_2735 | 251 |
| 596 | 3300046499 | Ga0495594_0045363 | Ga0495594_0045363_840_1607 | 251 |
| 597 | 3300046511 | Ga0495608_0144126 | Ga0495608_0144126_581_1348 | 251 |
| 598 | 3300046524 | Ga0495648_0000628 | Ga0495648_0000628_20937_21695 | 251 |
| 599 | 3300046559 | Ga0495667_0314143 | Ga0495667_0314143_113_880 | 251 |
| 600 | 3300046616 | Ga0495668_0008297 | Ga0495668_0008297_4530_5288 | 251 |
| 601 | 3300046683 | Ga0495658_0165704 | Ga0495658_0165704_324_1091 | 251 |
| 602 | 3300046689 | Ga0495613_0208294 | Ga0495613_0208294_284_1051 | 251 |
| 603 | 3300046690 | Ga0495624_0046221 | Ga0495624_0046221_363_1130 | 251 |
| 604 | 3300046694 | Ga0495649_0120509 | Ga0495649_0120509_577_1335 | 251 |
| 605 | 3300047315 | Ga0495581_0141405 | Ga0495581_0141405_471_1238 | 251 |
| 606 | 3300047320 | Ga0495672_0008575 | Ga0495672_0008575_5562_6320 | 251 |
| 607 | 3300047320 | Ga0495672_0030035 | Ga0495672_0030035_847_1608 | 251 |
| 608 | 3300047321 | Ga0495676_0041533 | Ga0495676_0041533_1031_1798 | 251 |
| 609 | 3300047469 | Ga0495673_0002027 | Ga0495673_0002027_13379_14137 | 251 |
| 610 | 3300047673 | Ga0495593_0026483 | Ga0495593_0026483_1012_1779 | 251 |
| 611 | 3300048089 | Ga0495614_0131684 | Ga0495614_0131684_319_1086 | 251 |
| 612 | 3300048903 | Ga0496100_0005195 | Ga0496100_0005195_1226_1987 | 251 |
| 613 | 3300048903 | Ga0496100_0009828 | Ga0496100_0009828_406_1164 | 251 |
| 614 | 3300048903 | Ga0496100_0142140 | Ga0496100_0142140_227_1018 | 251 |
| 615 | 3300048904 | Ga0496101_0000066 | Ga0496101_0000066_100474_101232 | 251 |
| 616 | 3300048904 | Ga0496101_0002316 | Ga0496101_0002316_4990_5751 | 251 |
| 617 | 3300048904 | Ga0496101_0038619 | Ga0496101_0038619_2202_2960 | 251 |
| 618 | 3300048904 | Ga0496101_0060971 | Ga0496101_0060971_793_1584 | 251 |
| 619 | 3300048904 | Ga0496101_0132603 | Ga0496101_0132603_859_1617 | 251 |
| 620 | 3300048904 | Ga0496101_0270294 | Ga0496101_0270294_38_796 | 251 |
| 621 | 3300048905 | Ga0496102_0000035 | Ga0496102_0000035_52438_53196 | 251 |
| 622 | 3300048905 | Ga0496102_0000070 | Ga0496102_0000070_79870_80661 | 251 |
| 623 | 3300048905 | Ga0496102_0000600 | Ga0496102_0000600_5894_6655 | 251 |
| 624 | 3300048905 | Ga0496102_0004697 | Ga0496102_0004697_5090_5848 | 251 |
| 625 | 3300048905 | Ga0496102_0124712 | Ga0496102_0124712_1102_1860 | 251 |
| 626 | 3300048905 | Ga0496102_0146132 | Ga0496102_0146132_116_874 | 251 |
| 627 | 3300048906 | Ga0496103_0000028 | Ga0496103_0000028_160465_161223 | 251 |
| 628 | 3300048906 | Ga0496103_0000477 | Ga0496103_0000477_21304_22095 | 251 |
| 629 | 3300048906 | Ga0496103_0000667 | Ga0496103_0000667_12844_13605 | 251 |
| 630 | 3300048906 | Ga0496103_0023011 | Ga0496103_0023011_1340_2098 | 251 |
| 631 | 3300048907 | Ga0496104_0026704 | Ga0496104_0026704_3438_4196 | 251 |
| 632 | 3300048907 | Ga0496104_0078845 | Ga0496104_0078845_1813_2571 | 251 |
| 633 | 3300048908 | Ga0496105_0049701 | Ga0496105_0049701_672_1430 | 251 |
| 634 | 3300048908 | Ga0496105_0049975 | Ga0496105_0049975_1395_2153 | 251 |
| 635 | 3300048909 | Ga0496106_0002066 | Ga0496106_0002066_765_1523 | 251 |
| 636 | 3300048909 | Ga0496106_0010257 | Ga0496106_0010257_5297_6058 | 251 |
| 637 | 3300048909 | Ga0496106_0010815 | Ga0496106_0010815_1549_2307 | 251 |
| 638 | 3300048909 | Ga0496106_0153804 | Ga0496106_0153804_609_1400 | 251 |
| 639 | 3300048910 | Ga0496107_0001051 | Ga0496107_0001051_11722_12480 | 251 |
| 640 | 3300048910 | Ga0496107_0002661 | Ga0496107_0002661_2347_3108 | 251 |
| 641 | 3300048910 | Ga0496107_0028337 | Ga0496107_0028337_840_1631 | 251 |
| 642 | 3300048910 | Ga0496107_0047928 | Ga0496107_0047928_1181_1939 | 251 |
| 643 | 3300048912 | Ga0496109_0005948 | Ga0496109_0005948_3541_4296 | 251 |
| 644 | 3300048912 | Ga0496109_0150578 | Ga0496109_0150578_38_796 | 251 |
| 645 | 3300048912 | Ga0496109_0202851 | Ga0496109_0202851_1009_1776 | 251 |
| 646 | 3300048913 | Ga0496110_0130988 | Ga0496110_0130988_600_1358 | 251 |
| 647 | 3300048914 | Ga0496111_0269813 | Ga0496111_0269813_64_822 | 251 |
| 648 | 3300048915 | Ga0496112_0041494 | Ga0496112_0041494_330_1085 | 251 |
| 649 | 3300048915 | Ga0496112_0047543 | Ga0496112_0047543_40_798 | 251 |
| 650 | 3300048915 | Ga0496112_0104600 | Ga0496112_0104600_787_1554 | 251 |
| 651 | 3300048916 | Ga0496113_0031777 | Ga0496113_0031777_193_951 | 251 |
| 652 | 3300048916 | Ga0496113_0125836 | Ga0496113_0125836_546_1313 | 251 |
| 653 | 3300048917 | Ga0496114_0001610 | Ga0496114_0001610_1972_2733 | 251 |
| 654 | 3300048917 | Ga0496114_0004619 | Ga0496114_0004619_7640_8398 | 251 |
| 655 | 3300048917 | Ga0496114_0136658 | Ga0496114_0136658_267_1025 | 251 |
| 656 | 3300048918 | Ga0496115_0009272 | Ga0496115_0009272_1177_1935 | 251 |
| 657 | 3300048918 | Ga0496115_0028041 | Ga0496115_0028041_336_1097 | 251 |
| 658 | 3300048919 | Ga0496116_0000090 | Ga0496116_0000090_52438_53196 | 251 |
| 659 | 3300048920 | Ga0496117_0000051 | Ga0496117_0000051_52438_53196 | 251 |
| 660 | 3300048920 | Ga0496117_0001117 | Ga0496117_0001117_18456_19247 | 251 |
| 661 | 3300048921 | Ga0496118_0000043 | Ga0496118_0000043_52438_53196 | 251 |
| 662 | 3300048921 | Ga0496118_0004850 | Ga0496118_0004850_11859_12650 | 251 |
| 663 | 3300048922 | Ga0496119_0000559 | Ga0496119_0000559_31584_32342 | 251 |
| 664 | 3300048922 | Ga0496119_0016323 | Ga0496119_0016323_1311_2102 | 251 |
| 665 | 3300048923 | Ga0496120_0001323 | Ga0496120_0001323_18089_18847 | 251 |
| 666 | 3300048923 | Ga0496120_0015370 | Ga0496120_0015370_365_1156 | 251 |
| 667 | 3300048924 | Ga0496121_0000080 | Ga0496121_0000080_91996_92754 | 251 |
| 668 | 3300048924 | Ga0496121_0002543 | Ga0496121_0002543_22474_23265 | 251 |
| 669 | 3300048928 | Ga0496125_0010205 | Ga0496125_0010205_5458_6249 | 251 |
| 670 | 3300048929 | Ga0496126_0001251 | Ga0496126_0001251_22795_23553 | 251 |
| 671 | 3300048929 | Ga0496126_0035353 | Ga0496126_0035353_2551_3342 | 251 |
| 672 | 3300048929 | Ga0496126_0348160 | Ga0496126_0348160_83_841 | 251 |
| 673 | 3300049569 | Ga0501032_0330946 | Ga0501032_0330946_167_925 | 251 |
| 674 | 3300049571 | Ga0501034_0037887 | Ga0501034_0037887_3952_4785 | 251 |
| 675 | 3300049571 | Ga0501034_0098340 | Ga0501034_0098340_251_1009 | 251 |
| 676 | 3300049571 | Ga0501034_0285927 | Ga0501034_0285927_700_1458 | 251 |
| 677 | 3300049571 | Ga0501034_0346917 | Ga0501034_0346917_217_1020 | 251 |
| 678 | 3300049572 | Ga0501036_0485487 | Ga0501036_0485487_172_930 | 251 |
| 679 | 3300049573 | Ga0501037_0058868 | Ga0501037_0058868_320_1078 | 251 |
| 680 | 3300049581 | Ga0501047_0007852 | Ga0501047_0007852_4380_5138 | 251 |
| 681 | 3300049581 | Ga0501047_0319834 | Ga0501047_0319834_183_944 | 251 |
| 682 | 3300049581 | Ga0501047_0609553 | Ga0501047_0609553_103_861 | 251 |
| 683 | 3300049585 | Ga0501069_0223094 | Ga0501069_0223094_281_1054 | 251 |
| 684 | 3300049586 | Ga0501070_0063913 | Ga0501070_0063913_482_1255 | 251 |
| 685 | 3300049586 | Ga0501070_0164745 | Ga0501070_0164745_192_980 | 251 |
| 686 | 3300049586 | Ga0501070_0334328 | Ga0501070_0334328_197_955 | 251 |
| 687 | 3300049742 | Ga0501080_0294953 | Ga0501080_0294953_231_989 | 251 |
| 688 | 3300049822 | Ga0501035_0005928 | Ga0501035_0005928_1216_1974 | 251 |
| 689 | 3300049823 | Ga0501044_0000498 | Ga0501044_0000498_29521_30279 | 251 |
| 690 | 3300050489 | nmdc:mga03683_72136_c1 | nmdc:mga03683_72136_c1_543_1301 | 251 |
| 691 | 3300050490 | nmdc:mga03n38_112684_c1 | nmdc:mga03n38_112684_c1_409_1167 | 251 |
| 692 | 3300050490 | nmdc:mga03n38_2523_c1 | nmdc:mga03n38_2523_c1_4112_4897 | 251 |
| 693 | 3300050490 | nmdc:mga03n38_51520_c1 | nmdc:mga03n38_51520_c1_766_1539 | 251 |
| 694 | 3300050490 | nmdc:mga03n38_68444_c1 | nmdc:mga03n38_68444_c1_63_821 | 251 |
| 695 | 3300050490 | nmdc:mga03n38_69778_c1 | nmdc:mga03n38_69778_c1_569_1342 | 251 |
| 696 | 3300050491 | nmdc:mga00v17_337218_c1 | nmdc:mga00v17_337218_c1_147_920 | 251 |
| 697 | 3300050491 | nmdc:mga00v17_78484_c1 | nmdc:mga00v17_78484_c1_582_1355 | 251 |
| 698 | 3300050491 | nmdc:mga00v17_89944_c1 | nmdc:mga00v17_89944_c1_821_1594 | 251 |
| 699 | 3300050491 | nmdc:mga00v17_97515_c1 | nmdc:mga00v17_97515_c1_804_1562 | 251 |
| 700 | 3300050492 | nmdc:mga0yw44_130534_c1 | nmdc:mga0yw44_130534_c1_798_1556 | 251 |
| 701 | 3300050492 | nmdc:mga0yw44_15867_c1 | nmdc:mga0yw44_15867_c1_2535_3308 | 251 |
| 702 | 3300050492 | nmdc:mga0yw44_34572_c1 | nmdc:mga0yw44_34572_c1_1448_2221 | 251 |
| 703 | 3300050492 | nmdc:mga0yw44_379501_c1 | nmdc:mga0yw44_379501_c1_126_911 | 251 |
| 704 | 3300050492 | nmdc:mga0yw44_87803_c1 | nmdc:mga0yw44_87803_c1_801_1574 | 251 |
| 705 | 3300050494 | nmdc:mga06z11_31398_c1 | nmdc:mga06z11_31398_c1_1612_2385 | 251 |
| 706 | 3300050494 | nmdc:mga06z11_57800_c1 | nmdc:mga06z11_57800_c1_494_1267 | 251 |
| 707 | 3300050496 | nmdc:mga07m45_245785_c1 | nmdc:mga07m45_245785_c1_210_983 | 251 |
| 708 | 3300050496 | nmdc:mga07m45_41367_c1 | nmdc:mga07m45_41367_c1_1682_2455 | 251 |
| 709 | 3300050496 | nmdc:mga07m45_84516_c1 | nmdc:mga07m45_84516_c1_193_966 | 251 |
| 710 | 3300050507 | nmdc:mga05p37_112745_c1 | nmdc:mga05p37_112745_c1_281_1039 | 251 |
| 711 | 3300050509 | nmdc:mga0qj67_28056_c1 | nmdc:mga0qj67_28056_c1_3320_4078 | 251 |
| 712 | 3300050510 | nmdc:mga06r32_5670_c1 | nmdc:mga06r32_5670_c1_4128_4886 | 251 |
| 713 | 3300050516 | nmdc:mga0sz30_49651_c1 | nmdc:mga0sz30_49651_c1_582_1343 | 251 |
| 714 | 3300050516 | nmdc:mga0sz30_6965_c1 | nmdc:mga0sz30_6965_c1_1919_2680 | 251 |
| 715 | 3300050516 | nmdc:mga0sz30_89985_c1 | nmdc:mga0sz30_89985_c1_181_939 | 251 |
| 716 | 3300053077 | Ga0495601_0250421 | Ga0495601_0250421_282_1049 | 251 |
| 717 | 3300053080 | Ga0500635_0045829 | Ga0500635_0045829_80_838 | 251 |
| 718 | 3300053087 | Ga0500643_009356 | Ga0500643_009356_1626_2384 | 251 |
| 719 | 3300053088 | Ga0500644_0000014 | Ga0500644_0000014_3469_4242 | 251 |
| 720 | 3300053096 | Ga0500641_0019573 | Ga0500641_0019573_1228_2016 | 251 |
| 721 | 3300053104 | Ga0500556_0001691 | Ga0500556_0001691_5210_5995 | 251 |
| 722 | 3300053117 | Ga0500593_000305 | Ga0500593_000305_8436_9221 | 251 |
| 723 | 3300053131 | Ga0500652_014947 | Ga0500652_014947_42_800 | 251 |
| 724 | 3300061719 | Ga0466962_0010692 | Ga0466962_0010692_755_1543 | 251 |
| 725 | iso_pu_bacteria | 2939582691 | 2939585497 | 251 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3qmj-assembly1.cif.gz_A | crystal structure of enoyl-coa hydratase echa8_6 from mycobacterium marinum | 0.9808 | 1 | 213 |
| 3qmj-assembly1.cif.gz_A | crystal structure of enoyl-coa hydratase echa8_6 from mycobacterium marinum | 0.9762 | 1 | 213 |
| 5ve2-assembly3.cif.gz_I | crystal structure of enoyl-coa hydratase/isomerase from pseudoalteromonas atlantica t6c at 2.3 a resolution. | 0.9578 | 1 | 248 |
| 5ve2-assembly1.cif.gz_A | crystal structure of enoyl-coa hydratase/isomerase from pseudoalteromonas atlantica t6c at 2.3 a resolution. | 0.9538 | 1 | 248 |
| 3fdu-assembly2.cif.gz_F | crystal structure of a putative enoyl-coa hydratase/isomerase from acinetobacter baumannii | 0.9442 | 3 | 231 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3qmjA00 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9808 | 1 | 213 | 3.90.226.10 |
| 3qmjA00 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9762 | 1 | 213 | 3.90.226.10 |
| 3rsiC01 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3; | 0.9678 | 2 | 55 | 3.30.300.220 |
| 5ve2I00 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9555 | 1 | 248 | 3.90.226.10 |
| 3fduF00 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9442 | 3 | 231 | 3.90.226.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7X7D5G8-F1-model_v4 | Enoyl-CoA hydratase/isomerase family protein | 0.9852 | 2 | 248 |
GO:0004165
GO:0005777 |
| AF-A0A351DFT1-F1-model_v4 | Crotonase | 0.9849 | 3 | 240 |
GO:0004165
GO:0005777 |
| AF-A0A7K1BM03-F1-model_v4 | Enoyl-CoA hydratase/isomerase family protein | 0.9776 | 3 | 197 |
GO:0004165
GO:0005777 |
| AF-A0A2E9XBP0-F1-model_v4 | Crotonase | 0.9699 | 2 | 248 |
GO:0004165
GO:0005777 |
| AF-A0A351DFT1-F1-model_v4 | Crotonase | 0.9688 | 3 | 240 |
GO:0004165
GO:0005777 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar