F477629
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 725 | 395 | 724 | 97 |
Family's Representative Sequence
| Representative Sequence | 3300046453|Ga0495627_053601|Ga0495627_053601_332_694 |
| Length | 120 |
| Sequence | MGANGFAECSRALYCSFNNTREITMAKAYWVSAYRAVKDADKLAAYAKLAGPAITAGGGRFLARGLPAKTYEFGLTERTVLIEFDSVEQATATHDSPDYKAALAALGDGAERDLRIIEGV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 2 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 3 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 4 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 5 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 6 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 7 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 8 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 9 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 10 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 11 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 12 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 13 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 14 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 15 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 17 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 19 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 20 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 21 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 22 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 23 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 25 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 26 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 30 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 34 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 45 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 57 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 63 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 69 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 71 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 72 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 73 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 75 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 76 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 77 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 78 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 79 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 80 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 81 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 82 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 83 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 84 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 86 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 87 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 88 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 89 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 90 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 91 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 92 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 93 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 95 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 96 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 97 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 98 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 99 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 100 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 101 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 117 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 128 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 131 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 132 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 133 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 139 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 141 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 142 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 143 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 145 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 148 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 151 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 206 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 207 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 211 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 212 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 213 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 214 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 215 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 216 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 217 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 218 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 219 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 220 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 221 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 222 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 223 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 224 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 225 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 226 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 227 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 228 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 229 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 230 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 231 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 232 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 233 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 234 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 235 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 236 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 237 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 238 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 239 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 240 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 241 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 242 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 243 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 244 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 245 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 246 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 247 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 248 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 249 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 250 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 251 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 252 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 253 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 254 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 255 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 256 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 257 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 258 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 259 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 260 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 261 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 262 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 263 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 264 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 265 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 266 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 267 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 268 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 269 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 270 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 271 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 272 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 273 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 274 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 275 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 276 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 277 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 278 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 316 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 317 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 318 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 319 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 320 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 321 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 322 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 323 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 324 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 325 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 326 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 327 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 328 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 329 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 330 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 331 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 332 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 333 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 334 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 335 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 336 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 337 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 338 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 346 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 347 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 350 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 351 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 352 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 353 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 354 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 355 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 356 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 357 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 360 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 367 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 368 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 369 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 370 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 371 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 372 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 373 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 374 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 375 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 376 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 377 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 378 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 379 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 380 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 381 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 382 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 383 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 384 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 385 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 386 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 387 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 388 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 389 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 390 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 391 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 392 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 393 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 394 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 395 | 3300053734 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.86 |
| Metatranscriptomes | 0 |
| Isolates | 0.14 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 21.52 |
| Nodule | 0 |
| Rhizoplane | 3.45 |
| Rhizosphere | 70.76 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.28 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25152J39213_1003553 | 3300002773 | Bacteria | 5274 |
| 2 | JGI25152J39213_1008447 | 3300002773 | Bacteria | 2556 |
| 3 | JGI25150J39212_1000529 | 3300002774 | Bacteria | 15578 |
| 4 | JGI25159J45721_1000714 | 3300002987 | Bacteria | 14510 |
| 5 | JGI25159J45721_1004054 | 3300002987 | Bacteria | 4979 |
| 6 | JGI25151J46595_10000648 | 3300003187 | Bacteria | 29621 |
| 7 | JGI25151J46595_10001672 | 3300003187 | Bacteria | 14533 |
| 8 | JGI25151J46595_10001768 | 3300003187 | Bacteria | 13990 |
| 9 | JGI25151J46595_10010051 | 3300003187 | Bacteria | 4432 |
| 10 | JGI25153J46596_10001378 | 3300003215 | Bacteria | 14533 |
| 11 | rootH2_10084863 | 3300003320 | Bacteria | 1805 |
| 12 | rootL2_10335959 | 3300003322 | Bacteria | 1330 |
| 13 | rootH1_10021926 | 3300003323 | Bacteria | 3942 |
| 14 | rootH1_10122036 | 3300003323 | Bacteria | 1429 |
| 15 | JGI25160J50197_1001019 | 3300003354 | Bacteria | 14510 |
| 16 | JGI25160J50197_1005287 | 3300003354 | Bacteria | 5400 |
| 17 | JGI25161J50226_1001734 | 3300003374 | Bacteria | 6170 |
| 18 | JGI25161J50226_1002393 | 3300003374 | Bacteria | 4829 |
| 19 | JGI25161J50226_1003095 | 3300003374 | Bacteria | 3967 |
| 20 | Ga0055527_1009080 | 3300003760 | Bacteria | 1174 |
| 21 | Ga0055535_1000827 | 3300003761 | Bacteria | 22215 |
| 22 | Ga0055542_1000103 | 3300003762 | Bacteria | 114989 |
| 23 | Ga0055526_1001885 | 3300003771 | Bacteria | 14533 |
| 24 | Ga0055526_1010803 | 3300003771 | Bacteria | 4200 |
| 25 | Ga0055537_1000532 | 3300003773 | Bacteria | 22142 |
| 26 | Ga0055524_1001312 | 3300003775 | Bacteria | 14533 |
| 27 | Ga0055536_1000559 | 3300003781 | Bacteria | 25395 |
| 28 | Ga0055536_1081886 | 3300003781 | Bacteria | 611 |
| 29 | Ga0055534_1000806 | 3300003784 | Bacteria | 14533 |
| 30 | Ga0055534_1004180 | 3300003784 | Bacteria | 4259 |
| 31 | Ga0055528_1000780 | 3300003790 | Bacteria | 22142 |
| 32 | Ga0055530_10000342 | 3300003791 | Bacteria | 42139 |
| 33 | Ga0055530_10012129 | 3300003791 | Bacteria | 3030 |
| 34 | Ga0055540_1001460 | 3300003792 | Bacteria | 14092 |
| 35 | Ga0055540_1001885 | 3300003792 | Bacteria | 11758 |
| 36 | Ga0055540_1012669 | 3300003792 | Bacteria | 2629 |
| 37 | Ga0055531_10000628 | 3300003794 | Bacteria | 30386 |
| 38 | Ga0055531_10002126 | 3300003794 | Bacteria | 13587 |
| 39 | Ga0055531_10002147 | 3300003794 | Bacteria | 13476 |
| 40 | Ga0055531_10011100 | 3300003794 | Bacteria | 4393 |
| 41 | Ga0055543_1000702 | 3300004625 | Bacteria | 17034 |
| 42 | Ga0055543_1000769 | 3300004625 | Bacteria | 15968 |
| 43 | Ga0065165_1002519 | 3300005262 | Bacteria | 15255 |
| 44 | Ga0065165_1002602 | 3300005262 | Bacteria | 14777 |
| 45 | Ga0070658_10143979 | 3300005327 | Bacteria | 1992 |
| 46 | Ga0070690_100331648 | 3300005330 | Bacteria | 1099 |
| 47 | Ga0070670_100581499 | 3300005331 | Bacteria | 1001 |
| 48 | Ga0070670_100618278 | 3300005331 | Unclassified | 970 |
| 49 | Ga0068869_100055545 | 3300005334 | Bacteria | 2886 |
| 50 | Ga0068869_100058931 | 3300005334 | Bacteria | 2809 |
| 51 | Ga0068869_100252172 | 3300005334 | Bacteria | 1410 |
| 52 | Ga0068869_100479292 | 3300005334 | Bacteria | 1036 |
| 53 | Ga0068869_100490495 | 3300005334 | Unclassified | 1024 |
| 54 | Ga0068869_100709691 | 3300005334 | Unclassified | 858 |
| 55 | Ga0070666_10007871 | 3300005335 | Bacteria | 6583 |
| 56 | Ga0070680_101747640 | 3300005336 | Bacteria | 539 |
| 57 | Ga0070682_100577459 | 3300005337 | Unclassified | 884 |
| 58 | Ga0068868_100002109 | 3300005338 | Bacteria | 13696 |
| 59 | Ga0068868_100139682 | 3300005338 | Bacteria | 1988 |
| 60 | Ga0070660_100557997 | 3300005339 | Bacteria | 956 |
| 61 | Ga0070689_100362657 | 3300005340 | Unclassified | 1218 |
| 62 | Ga0070689_101558577 | 3300005340 | Bacteria | 599 |
| 63 | Ga0070689_101721177 | 3300005340 | Unclassified | 571 |
| 64 | Ga0070691_10394681 | 3300005341 | Unclassified | 778 |
| 65 | Ga0070661_100409418 | 3300005344 | Bacteria | 1073 |
| 66 | Ga0070668_100005152 | 3300005347 | Bacteria | 9692 |
| 67 | Ga0070668_100176210 | 3300005347 | Unclassified | 1744 |
| 68 | Ga0070668_100192504 | 3300005347 | Bacteria | 1671 |
| 69 | Ga0070668_101295069 | 3300005347 | Unclassified | 662 |
| 70 | Ga0070669_100100404 | 3300005353 | Bacteria | 2182 |
| 71 | Ga0070669_100100504 | 3300005353 | Bacteria | 2181 |
| 72 | Ga0070669_100279142 | 3300005353 | Bacteria | 1338 |
| 73 | Ga0070669_100838909 | 3300005353 | Unclassified | 783 |
| 74 | Ga0070675_100000542 | 3300005354 | Bacteria | 25851 |
| 75 | Ga0070675_102019558 | 3300005354 | Unclassified | 532 |
| 76 | Ga0070671_100002141 | 3300005355 | Bacteria | 15246 |
| 77 | Ga0070674_100000170 | 3300005356 | Bacteria | 30382 |
| 78 | Ga0070674_100239961 | 3300005356 | Bacteria | 1418 |
| 79 | Ga0070673_100000311 | 3300005364 | Bacteria | 25555 |
| 80 | Ga0070673_100218080 | 3300005364 | Bacteria | 1650 |
| 81 | Ga0070673_100347493 | 3300005364 | Bacteria | 1316 |
| 82 | Ga0070688_100911765 | 3300005365 | Unclassified | 694 |
| 83 | Ga0070659_100061334 | 3300005366 | Bacteria | 2972 |
| 84 | Ga0070659_100132504 | 3300005366 | Bacteria | 2025 |
| 85 | Ga0070667_100049914 | 3300005367 | Bacteria | 3525 |
| 86 | Ga0070667_100063297 | 3300005367 | Bacteria | 3134 |
| 87 | Ga0070667_100461459 | 3300005367 | Bacteria | 1161 |
| 88 | Ga0070667_100561586 | 3300005367 | Bacteria | 1050 |
| 89 | Ga0070667_101064602 | 3300005367 | Bacteria | 755 |
| 90 | Ga0070667_101164662 | 3300005367 | Bacteria | 721 |
| 91 | Ga0070709_10335666 | 3300005434 | Bacteria | 1113 |
| 92 | Ga0070714_100642970 | 3300005435 | Unclassified | 1021 |
| 93 | Ga0070713_102258684 | 3300005436 | Bacteria | 527 |
| 94 | Ga0070705_100435481 | 3300005440 | Bacteria | 980 |
| 95 | Ga0070700_100615715 | 3300005441 | Unclassified | 853 |
| 96 | Ga0070694_100259431 | 3300005444 | Bacteria | 1318 |
| 97 | Ga0070694_100498130 | 3300005444 | Bacteria | 969 |
| 98 | Ga0070694_101733375 | 3300005444 | Unclassified | 532 |
| 99 | Ga0070708_100181974 | 3300005445 | Bacteria | 1965 |
| 100 | Ga0070708_101251544 | 3300005445 | Bacteria | 694 |
| 101 | Ga0070678_100091899 | 3300005456 | Bacteria | 2330 |
| 102 | Ga0070678_100382776 | 3300005456 | Bacteria | 1218 |
| 103 | Ga0070678_101977108 | 3300005456 | Bacteria | 551 |
| 104 | Ga0070662_100014668 | 3300005457 | Bacteria | 5236 |
| 105 | Ga0070662_100201575 | 3300005457 | Bacteria | 1579 |
| 106 | Ga0070662_100472456 | 3300005457 | Bacteria | 1043 |
| 107 | Ga0068867_100001800 | 3300005459 | Bacteria | 14908 |
| 108 | Ga0068867_100262927 | 3300005459 | Bacteria | 1407 |
| 109 | Ga0070706_100075353 | 3300005467 | Bacteria | 3122 |
| 110 | Ga0070706_100848951 | 3300005467 | Unclassified | 844 |
| 111 | Ga0070706_102147263 | 3300005467 | Bacteria | 504 |
| 112 | Ga0070707_100939480 | 3300005468 | Unclassified | 830 |
| 113 | Ga0070698_100709024 | 3300005471 | Bacteria | 948 |
| 114 | Ga0070699_100067054 | 3300005518 | Bacteria | 3116 |
| 115 | Ga0070699_100158743 | 3300005518 | Bacteria | 2001 |
| 116 | Ga0070697_100019668 | 3300005536 | Bacteria | 5334 |
| 117 | Ga0070697_100377459 | 3300005536 | Unclassified | 1227 |
| 118 | Ga0068853_102033145 | 3300005539 | Bacteria | 557 |
| 119 | Ga0070672_100667480 | 3300005543 | Bacteria | 909 |
| 120 | Ga0070672_101025453 | 3300005543 | Bacteria | 732 |
| 121 | Ga0070686_100084298 | 3300005544 | Bacteria | 2111 |
| 122 | Ga0070695_100518610 | 3300005545 | Bacteria | 924 |
| 123 | Ga0070665_100037310 | 3300005548 | Bacteria | 4888 |
| 124 | Ga0070665_100324469 | 3300005548 | Bacteria | 1544 |
| 125 | Ga0070665_102352335 | 3300005548 | Bacteria | 535 |
| 126 | Ga0070704_100096066 | 3300005549 | Bacteria | 2221 |
| 127 | Ga0068855_100056789 | 3300005563 | Bacteria | 4591 |
| 128 | Ga0068855_100467014 | 3300005563 | Unclassified | 1375 |
| 129 | Ga0068855_100561829 | 3300005563 | Bacteria | 1234 |
| 130 | Ga0068855_101385870 | 3300005563 | Unclassified | 725 |
| 131 | Ga0068855_101933275 | 3300005563 | Bacteria | 597 |
| 132 | Ga0070664_100413073 | 3300005564 | Bacteria | 1235 |
| 133 | Ga0068857_100242266 | 3300005577 | Bacteria | 1651 |
| 134 | Ga0068854_100131714 | 3300005578 | Bacteria | 1910 |
| 135 | Ga0068854_100501279 | 3300005578 | Bacteria | 1022 |
| 136 | Ga0068856_100201670 | 3300005614 | Bacteria | 2004 |
| 137 | Ga0070702_100348681 | 3300005615 | Bacteria | 1042 |
| 138 | Ga0068852_100005901 | 3300005616 | Bacteria | 8805 |
| 139 | Ga0068852_100063610 | 3300005616 | Bacteria | 3213 |
| 140 | Ga0068859_100071884 | 3300005617 | Bacteria | 3495 |
| 141 | Ga0068859_100475781 | 3300005617 | Unclassified | 1345 |
| 142 | Ga0068859_100770303 | 3300005617 | Unclassified | 1051 |
| 143 | Ga0068859_101327482 | 3300005617 | Bacteria | 793 |
| 144 | Ga0068859_101674306 | 3300005617 | Bacteria | 703 |
| 145 | Ga0068864_100099102 | 3300005618 | Bacteria | 2581 |
| 146 | Ga0068864_100202147 | 3300005618 | Bacteria | 1826 |
| 147 | Ga0068861_100206870 | 3300005719 | Bacteria | 1651 |
| 148 | Ga0068861_101012345 | 3300005719 | Bacteria | 794 |
| 149 | Ga0068851_10000476 | 3300005834 | Bacteria | 17664 |
| 150 | Ga0068851_10001359 | 3300005834 | Bacteria | 10676 |
| 151 | Ga0068870_10088965 | 3300005840 | Unclassified | 1723 |
| 152 | Ga0068870_10169266 | 3300005840 | Bacteria | 1302 |
| 153 | Ga0068863_100000916 | 3300005841 | Bacteria | 29618 |
| 154 | Ga0068863_100073675 | 3300005841 | Bacteria | 3231 |
| 155 | Ga0068863_100085174 | 3300005841 | Bacteria | 2995 |
| 156 | Ga0068863_100322907 | 3300005841 | Bacteria | 1500 |
| 157 | Ga0068863_100336373 | 3300005841 | Bacteria | 1468 |
| 158 | Ga0068863_100406256 | 3300005841 | Bacteria | 1333 |
| 159 | Ga0068858_100037941 | 3300005842 | Bacteria | 4469 |
| 160 | Ga0068858_100981113 | 3300005842 | Bacteria | 827 |
| 161 | Ga0068858_101131764 | 3300005842 | Unclassified | 769 |
| 162 | Ga0068858_101942296 | 3300005842 | Bacteria | 582 |
| 163 | Ga0068860_100001439 | 3300005843 | Bacteria | 25753 |
| 164 | Ga0068860_100004070 | 3300005843 | Bacteria | 15007 |
| 165 | Ga0068860_100006251 | 3300005843 | Bacteria | 11963 |
| 166 | Ga0068860_101049479 | 3300005843 | Bacteria | 834 |
| 167 | Ga0068862_100011277 | 3300005844 | Bacteria | 7380 |
| 168 | Ga0068862_100104652 | 3300005844 | Bacteria | 2480 |
| 169 | Ga0068862_100149511 | 3300005844 | Bacteria | 2078 |
| 170 | Ga0068862_100345684 | 3300005844 | Bacteria | 1379 |
| 171 | Ga0070717_10633148 | 3300006028 | Unclassified | 971 |
| 172 | Ga0075365_10007356 | 3300006038 | Bacteria | 6160 |
| 173 | Ga0075368_10426573 | 3300006042 | Bacteria | 585 |
| 174 | Ga0075363_100016251 | 3300006048 | Bacteria | 3674 |
| 175 | Ga0075363_100242056 | 3300006048 | Bacteria | 1037 |
| 176 | Ga0075363_100773327 | 3300006048 | Bacteria | 583 |
| 177 | Ga0075364_10003516 | 3300006051 | Bacteria | 8918 |
| 178 | Ga0075432_10019998 | 3300006058 | Bacteria | 2289 |
| 179 | Ga0070716_100908045 | 3300006173 | Bacteria | 690 |
| 180 | Ga0075367_10059577 | 3300006178 | Bacteria | 2273 |
| 181 | Ga0075367_10540448 | 3300006178 | Bacteria | 740 |
| 182 | Ga0075366_10010380 | 3300006195 | Bacteria | 5228 |
| 183 | Ga0075366_10019852 | 3300006195 | Bacteria | 3893 |
| 184 | Ga0075366_10420009 | 3300006195 | Bacteria | 824 |
| 185 | Ga0097621_100006254 | 3300006237 | Bacteria | 8450 |
| 186 | Ga0097621_100013732 | 3300006237 | Bacteria | 6046 |
| 187 | Ga0097621_102235631 | 3300006237 | Unclassified | 523 |
| 188 | Ga0075370_10002892 | 3300006353 | Bacteria | 8057 |
| 189 | Ga0075370_10003792 | 3300006353 | Bacteria | 7238 |
| 190 | Ga0075370_10003831 | 3300006353 | Bacteria | 7193 |
| 191 | Ga0075370_10004452 | 3300006353 | Bacteria | 6807 |
| 192 | Ga0075370_10041438 | 3300006353 | Bacteria | 2599 |
| 193 | Ga0068871_100002954 | 3300006358 | Bacteria | 11667 |
| 194 | Ga0068871_100778273 | 3300006358 | Bacteria | 881 |
| 195 | Ga0075428_100059829 | 3300006844 | Bacteria | 4171 |
| 196 | Ga0075428_100659398 | 3300006844 | Bacteria | 1116 |
| 197 | Ga0075430_100178297 | 3300006846 | Bacteria | 1768 |
| 198 | Ga0075430_100195026 | 3300006846 | Bacteria | 1683 |
| 199 | Ga0075431_100280265 | 3300006847 | Bacteria | 1688 |
| 200 | Ga0075431_100324710 | 3300006847 | Bacteria | 1551 |
| 201 | Ga0075431_101425613 | 3300006847 | Unclassified | 652 |
| 202 | Ga0075433_10174797 | 3300006852 | Bacteria | 1911 |
| 203 | Ga0068865_100097611 | 3300006881 | Bacteria | 2145 |
| 204 | Ga0068865_100112428 | 3300006881 | Bacteria | 2011 |
| 205 | Ga0068865_100382162 | 3300006881 | Bacteria | 1149 |
| 206 | Ga0068865_101981906 | 3300006881 | Bacteria | 528 |
| 207 | Ga0097620_100071884 | 3300006931 | Bacteria | 3495 |
| 208 | Ga0097620_100475731 | 3300006931 | Unclassified | 1345 |
| 209 | Ga0097620_100770368 | 3300006931 | Unclassified | 1051 |
| 210 | Ga0097620_101327624 | 3300006931 | Bacteria | 793 |
| 211 | Ga0097620_101674287 | 3300006931 | Bacteria | 703 |
| 212 | Ga0105244_10003954 | 3300009036 | Bacteria | 10393 |
| 213 | Ga0105244_10026489 | 3300009036 | Bacteria | 3137 |
| 214 | Ga0105244_10469483 | 3300009036 | Bacteria | 579 |
| 215 | Ga0105240_10041594 | 3300009093 | Bacteria | 5865 |
| 216 | Ga0105240_10174675 | 3300009093 | Bacteria | 2541 |
| 217 | Ga0111539_10219863 | 3300009094 | Bacteria | 2212 |
| 218 | Ga0111539_12068630 | 3300009094 | Unclassified | 660 |
| 219 | Ga0105245_10354792 | 3300009098 | Bacteria | 1454 |
| 220 | Ga0114129_11504672 | 3300009147 | Bacteria | 827 |
| 221 | Ga0105243_10000385 | 3300009148 | Bacteria | 47177 |
| 222 | Ga0105243_10030905 | 3300009148 | Bacteria | 4127 |
| 223 | Ga0105243_10461052 | 3300009148 | Bacteria | 1195 |
| 224 | Ga0105243_10506919 | 3300009148 | Bacteria | 1145 |
| 225 | Ga0105243_10648725 | 3300009148 | Bacteria | 1023 |
| 226 | Ga0105243_11010719 | 3300009148 | Bacteria | 835 |
| 227 | Ga0105241_11143763 | 3300009174 | Bacteria | 735 |
| 228 | Ga0105242_10066651 | 3300009176 | Bacteria | 2974 |
| 229 | Ga0105242_10541419 | 3300009176 | Bacteria | 1114 |
| 230 | Ga0105242_11319236 | 3300009176 | Bacteria | 746 |
| 231 | Ga0105248_10222563 | 3300009177 | Bacteria | 2125 |
| 232 | Ga0105248_10516452 | 3300009177 | Bacteria | 1347 |
| 233 | Ga0105237_10044342 | 3300009545 | Bacteria | 4478 |
| 234 | Ga0105238_10519878 | 3300009551 | Bacteria | 1193 |
| 235 | Ga0105249_10016212 | 3300009553 | Bacteria | 6608 |
| 236 | Ga0105249_10281820 | 3300009553 | Unclassified | 1660 |
| 237 | Ga0105249_10342956 | 3300009553 | Bacteria | 1511 |
| 238 | Ga0105249_10796876 | 3300009553 | Bacteria | 1009 |
| 239 | Ga0105239_10218755 | 3300010375 | Bacteria | 2136 |
| 240 | Ga0105239_10327973 | 3300010375 | Bacteria | 1726 |
| 241 | Ga0105246_10038608 | 3300011119 | Bacteria | 3212 |
| 242 | Ga0105246_10256765 | 3300011119 | Bacteria | 1390 |
| 243 | Ga0105246_10370212 | 3300011119 | Bacteria | 1180 |
| 244 | Ga0157327_1070785 | 3300012512 | Bacteria | 541 |
| 245 | Ga0157373_10012427 | 3300013100 | Bacteria | 6259 |
| 246 | Ga0157373_10057182 | 3300013100 | Bacteria | 2767 |
| 247 | Ga0157373_10132012 | 3300013100 | Bacteria | 1756 |
| 248 | Ga0157371_10016208 | 3300013102 | Bacteria | 5568 |
| 249 | Ga0157370_10010652 | 3300013104 | Bacteria | 9679 |
| 250 | Ga0157370_10145566 | 3300013104 | Bacteria | 2206 |
| 251 | Ga0157369_10001788 | 3300013105 | Bacteria | 26005 |
| 252 | Ga0157378_10023616 | 3300013297 | Bacteria | 5408 |
| 253 | Ga0157378_10266161 | 3300013297 | Unclassified | 1646 |
| 254 | Ga0157378_10698950 | 3300013297 | Bacteria | 1033 |
| 255 | Ga0157378_11332547 | 3300013297 | Bacteria | 759 |
| 256 | Ga0163162_10082115 | 3300013306 | Bacteria | 3295 |
| 257 | Ga0163162_10098434 | 3300013306 | Bacteria | 3014 |
| 258 | Ga0163162_10581621 | 3300013306 | Bacteria | 1247 |
| 259 | Ga0163162_13195259 | 3300013306 | Bacteria | 526 |
| 260 | Ga0157372_10103425 | 3300013307 | Bacteria | 3254 |
| 261 | Ga0157375_10192933 | 3300013308 | Bacteria | 2192 |
| 262 | Ga0157375_10758042 | 3300013308 | Bacteria | 1121 |
| 263 | Ga0163163_10360389 | 3300014325 | Unclassified | 1510 |
| 264 | Ga0163163_10406154 | 3300014325 | Bacteria | 1420 |
| 265 | Ga0157380_10255346 | 3300014326 | Bacteria | 1589 |
| 266 | Ga0157380_10255764 | 3300014326 | Bacteria | 1588 |
| 267 | Ga0157380_10300676 | 3300014326 | Unclassified | 1478 |
| 268 | Ga0157380_11603350 | 3300014326 | Bacteria | 706 |
| 269 | Ga0157380_11931893 | 3300014326 | Bacteria | 651 |
| 270 | Ga0157380_13500913 | 3300014326 | Bacteria | 503 |
| 271 | Ga0182008_10000536 | 3300014497 | Bacteria | 28332 |
| 272 | Ga0182008_10003506 | 3300014497 | Bacteria | 9462 |
| 273 | Ga0182008_10009042 | 3300014497 | Bacteria | 5394 |
| 274 | Ga0182008_10014187 | 3300014497 | Bacteria | 4177 |
| 275 | Ga0157379_10035897 | 3300014968 | Bacteria | 4421 |
| 276 | Ga0157376_10022402 | 3300014969 | Bacteria | 4924 |
| 277 | Ga0157376_10178359 | 3300014969 | Bacteria | 1940 |
| 278 | Ga0157376_10377226 | 3300014969 | Bacteria | 1365 |
| 279 | Ga0157376_10536789 | 3300014969 | Bacteria | 1155 |
| 280 | Ga0157376_10641213 | 3300014969 | Bacteria | 1062 |
| 281 | Ga0157376_10729550 | 3300014969 | Bacteria | 998 |
| 282 | Ga0182006_1001750 | 3300015261 | Bacteria | 12597 |
| 283 | Ga0182007_10000335 | 3300015262 | Bacteria | 29829 |
| 284 | Ga0182007_10017433 | 3300015262 | Bacteria | 2623 |
| 285 | Ga0182005_1023710 | 3300015265 | Bacteria | 1676 |
| 286 | Ga0182005_1031329 | 3300015265 | Bacteria | 1449 |
| 287 | Ga0163161_10000463 | 3300017792 | Bacteria | 33681 |
| 288 | Ga0163161_10019607 | 3300017792 | Bacteria | 4745 |
| 289 | Ga0163161_10027191 | 3300017792 | Bacteria | 4058 |
| 290 | Ga0163161_10064169 | 3300017792 | Bacteria | 2679 |
| 291 | Ga0163161_10070495 | 3300017792 | Bacteria | 2555 |
| 292 | Ga0163161_10265217 | 3300017792 | Bacteria | 1343 |
| 293 | Ga0163161_10566541 | 3300017792 | Bacteria | 933 |
| 294 | Ga0209436_103826 | 3300025208 | Bacteria | 3865 |
| 295 | Ga0209672_101347 | 3300025228 | Bacteria | 9230 |
| 296 | Ga0209147_100582 | 3300025229 | Bacteria | 20373 |
| 297 | Ga0209147_118169 | 3300025229 | Bacteria | 662 |
| 298 | Ga0209258_100133 | 3300025242 | Bacteria | 174846 |
| 299 | Ga0207425_1000392 | 3300025245 | Bacteria | 29503 |
| 300 | Ga0207425_1021681 | 3300025245 | Bacteria | 1360 |
| 301 | Ga0207425_1077659 | 3300025245 | Bacteria | 559 |
| 302 | Ga0209148_1000188 | 3300025254 | Bacteria | 117310 |
| 303 | Ga0209129_1000111 | 3300025258 | Bacteria | 148853 |
| 304 | Ga0209129_1000425 | 3300025258 | Bacteria | 32039 |
| 305 | Ga0209129_1002392 | 3300025258 | Bacteria | 9236 |
| 306 | Ga0209565_1000146 | 3300025263 | Bacteria | 97720 |
| 307 | Ga0209565_1000891 | 3300025263 | Bacteria | 16284 |
| 308 | Ga0209673_1000216 | 3300025273 | Bacteria | 114232 |
| 309 | Ga0209673_1001323 | 3300025273 | Bacteria | 24935 |
| 310 | Ga0209673_1001463 | 3300025273 | Bacteria | 22194 |
| 311 | Ga0209130_1000470 | 3300025284 | Bacteria | 41506 |
| 312 | Ga0209130_1000646 | 3300025284 | Bacteria | 32516 |
| 313 | Ga0209130_1018482 | 3300025284 | Bacteria | 1635 |
| 314 | Ga0209675_1000331 | 3300025291 | Bacteria | 41480 |
| 315 | Ga0209675_1000685 | 3300025291 | Bacteria | 23545 |
| 316 | Ga0209676_1000111 | 3300025292 | Bacteria | 213411 |
| 317 | Ga0209676_1000737 | 3300025292 | Bacteria | 44719 |
| 318 | Ga0209676_1010159 | 3300025292 | Bacteria | 3962 |
| 319 | Ga0209676_1018576 | 3300025292 | Bacteria | 2422 |
| 320 | Ga0209025_1000038 | 3300025294 | Bacteria | 380508 |
| 321 | Ga0209025_1000116 | 3300025294 | Bacteria | 218293 |
| 322 | Ga0209025_1000839 | 3300025294 | Bacteria | 48717 |
| 323 | Ga0209025_1047744 | 3300025294 | Bacteria | 1744 |
| 324 | Ga0209564_1000070 | 3300025295 | Bacteria | 303126 |
| 325 | Ga0209564_1000155 | 3300025295 | Bacteria | 165859 |
| 326 | Ga0209758_1000107 | 3300025297 | Bacteria | 218293 |
| 327 | Ga0209758_1154515 | 3300025297 | Bacteria | 578 |
| 328 | Ga0209050_1000111 | 3300025298 | Bacteria | 213411 |
| 329 | Ga0209050_1006050 | 3300025298 | Bacteria | 7326 |
| 330 | Ga0209256_1000047 | 3300025299 | Bacteria | 314709 |
| 331 | Ga0209256_1000087 | 3300025299 | Bacteria | 218290 |
| 332 | Ga0207426_1000123 | 3300025302 | Bacteria | 218290 |
| 333 | Ga0207426_1000194 | 3300025302 | Bacteria | 150009 |
| 334 | Ga0209051_1000160 | 3300025303 | Bacteria | 126473 |
| 335 | Ga0209051_1000340 | 3300025303 | Bacteria | 70080 |
| 336 | Ga0209051_1020185 | 3300025303 | Bacteria | 2880 |
| 337 | Ga0209257_1000116 | 3300025304 | Bacteria | 228733 |
| 338 | Ga0209257_1000690 | 3300025304 | Bacteria | 52373 |
| 339 | Ga0209257_1001961 | 3300025304 | Bacteria | 22193 |
| 340 | Ga0207697_10091340 | 3300025315 | Bacteria | 1290 |
| 341 | Ga0207656_10019101 | 3300025321 | Bacteria | 2708 |
| 342 | Ga0207656_10256222 | 3300025321 | Bacteria | 858 |
| 343 | Ga0207655_1005419 | 3300025728 | Bacteria | 8676 |
| 344 | Ga0207682_10425305 | 3300025893 | Bacteria | 628 |
| 345 | Ga0207642_10013191 | 3300025899 | Bacteria | 3008 |
| 346 | Ga0207680_10063631 | 3300025903 | Bacteria | 2258 |
| 347 | Ga0207680_10364063 | 3300025903 | Bacteria | 1017 |
| 348 | Ga0207680_10634058 | 3300025903 | Bacteria | 765 |
| 349 | Ga0207647_10038464 | 3300025904 | Bacteria | 3024 |
| 350 | Ga0207699_10085202 | 3300025906 | Unclassified | 1970 |
| 351 | Ga0207645_10000063 | 3300025907 | Bacteria | 76658 |
| 352 | Ga0207643_10002613 | 3300025908 | Bacteria | 9745 |
| 353 | Ga0207684_10018108 | 3300025910 | Bacteria | 6035 |
| 354 | Ga0207684_10067633 | 3300025910 | Unclassified | 3036 |
| 355 | Ga0207654_10257553 | 3300025911 | Bacteria | 1172 |
| 356 | Ga0207707_11050342 | 3300025912 | Bacteria | 666 |
| 357 | Ga0207695_10259573 | 3300025913 | Bacteria | 1635 |
| 358 | Ga0207695_10738214 | 3300025913 | Bacteria | 865 |
| 359 | Ga0207671_11142795 | 3300025914 | Bacteria | 611 |
| 360 | Ga0207681_10084152 | 3300025923 | Bacteria | 2254 |
| 361 | Ga0207681_10641298 | 3300025923 | Bacteria | 880 |
| 362 | Ga0207681_10900110 | 3300025923 | Bacteria | 741 |
| 363 | Ga0207694_10391479 | 3300025924 | Bacteria | 1155 |
| 364 | Ga0207694_11838009 | 3300025924 | Bacteria | 509 |
| 365 | Ga0207659_10090098 | 3300025926 | Bacteria | 2288 |
| 366 | Ga0207664_10136832 | 3300025929 | Unclassified | 2068 |
| 367 | Ga0207664_10162245 | 3300025929 | Bacteria | 1907 |
| 368 | Ga0207664_10383384 | 3300025929 | Unclassified | 1248 |
| 369 | Ga0207644_10117927 | 3300025931 | Bacteria | 2016 |
| 370 | Ga0207690_10044527 | 3300025932 | Bacteria | 2926 |
| 371 | Ga0207690_11514418 | 3300025932 | Bacteria | 561 |
| 372 | Ga0207706_10006703 | 3300025933 | Bacteria | 10648 |
| 373 | Ga0207706_10044723 | 3300025933 | Bacteria | 3924 |
| 374 | Ga0207686_10821858 | 3300025934 | Bacteria | 746 |
| 375 | Ga0207709_10000908 | 3300025935 | Bacteria | 22289 |
| 376 | Ga0207709_10000999 | 3300025935 | Bacteria | 21008 |
| 377 | Ga0207709_10441961 | 3300025935 | Bacteria | 1003 |
| 378 | Ga0207709_11111723 | 3300025935 | Bacteria | 649 |
| 379 | Ga0207709_11592318 | 3300025935 | Bacteria | 542 |
| 380 | Ga0207670_10358409 | 3300025936 | Bacteria | 1157 |
| 381 | Ga0207669_10642368 | 3300025937 | Bacteria | 867 |
| 382 | Ga0207669_11068025 | 3300025937 | Bacteria | 680 |
| 383 | Ga0207669_11651870 | 3300025937 | Unclassified | 547 |
| 384 | Ga0207704_10904676 | 3300025938 | Bacteria | 742 |
| 385 | Ga0207704_11456483 | 3300025938 | Bacteria | 587 |
| 386 | Ga0207691_10000050 | 3300025940 | Bacteria | 94763 |
| 387 | Ga0207691_10028829 | 3300025940 | Bacteria | 5195 |
| 388 | Ga0207711_12050503 | 3300025941 | Bacteria | 515 |
| 389 | Ga0207689_10006256 | 3300025942 | Bacteria | 10551 |
| 390 | Ga0207689_10054834 | 3300025942 | Bacteria | 3282 |
| 391 | Ga0207689_10138695 | 3300025942 | Bacteria | 2003 |
| 392 | Ga0207679_10382060 | 3300025945 | Bacteria | 1235 |
| 393 | Ga0207679_11474079 | 3300025945 | Bacteria | 624 |
| 394 | Ga0207667_10225711 | 3300025949 | Bacteria | 1919 |
| 395 | Ga0207667_10407289 | 3300025949 | Bacteria | 1384 |
| 396 | Ga0207667_11933002 | 3300025949 | Bacteria | 551 |
| 397 | Ga0207651_10107999 | 3300025960 | Bacteria | 2081 |
| 398 | Ga0207651_10552222 | 3300025960 | Bacteria | 1002 |
| 399 | Ga0207651_10553457 | 3300025960 | Bacteria | 1001 |
| 400 | Ga0207668_10008210 | 3300025972 | Bacteria | 6218 |
| 401 | Ga0207668_10202559 | 3300025972 | Unclassified | 1582 |
| 402 | Ga0207668_10429781 | 3300025972 | Bacteria | 1123 |
| 403 | Ga0207640_10095743 | 3300025981 | Bacteria | 2068 |
| 404 | Ga0207640_10098902 | 3300025981 | Bacteria | 2041 |
| 405 | Ga0207640_10858070 | 3300025981 | Unclassified | 790 |
| 406 | Ga0207658_10179543 | 3300025986 | Bacteria | 1751 |
| 407 | Ga0207658_10873589 | 3300025986 | Bacteria | 818 |
| 408 | Ga0207677_10005833 | 3300026023 | Bacteria | 6703 |
| 409 | Ga0207677_10516240 | 3300026023 | Bacteria | 1036 |
| 410 | Ga0207703_10056601 | 3300026035 | Bacteria | 3194 |
| 411 | Ga0207703_10401682 | 3300026035 | Bacteria | 1271 |
| 412 | Ga0207703_10655311 | 3300026035 | Bacteria | 996 |
| 413 | Ga0207639_11031123 | 3300026041 | Bacteria | 771 |
| 414 | Ga0207678_10001056 | 3300026067 | Bacteria | 25189 |
| 415 | Ga0207708_10506496 | 3300026075 | Unclassified | 1012 |
| 416 | Ga0207702_10931580 | 3300026078 | Unclassified | 861 |
| 417 | Ga0207641_10000209 | 3300026088 | Bacteria | 75878 |
| 418 | Ga0207641_10076996 | 3300026088 | Bacteria | 2885 |
| 419 | Ga0207641_10132443 | 3300026088 | Bacteria | 2240 |
| 420 | Ga0207641_10213791 | 3300026088 | Bacteria | 1784 |
| 421 | Ga0207641_11294334 | 3300026088 | Unclassified | 729 |
| 422 | Ga0207641_12019261 | 3300026088 | Bacteria | 578 |
| 423 | Ga0207648_10004317 | 3300026089 | Bacteria | 14637 |
| 424 | Ga0207648_10179434 | 3300026089 | Bacteria | 1874 |
| 425 | Ga0207676_10051656 | 3300026095 | Bacteria | 3210 |
| 426 | Ga0207676_10175419 | 3300026095 | Bacteria | 1871 |
| 427 | Ga0207674_10036499 | 3300026116 | Bacteria | 5118 |
| 428 | Ga0207674_10045766 | 3300026116 | Bacteria | 4498 |
| 429 | Ga0207674_10325364 | 3300026116 | Bacteria | 1487 |
| 430 | Ga0207675_100186394 | 3300026118 | Bacteria | 1989 |
| 431 | Ga0207683_10000521 | 3300026121 | Bacteria | 35599 |
| 432 | Ga0207683_10257464 | 3300026121 | Bacteria | 1593 |
| 433 | Ga0207683_10429045 | 3300026121 | Bacteria | 1218 |
| 434 | Ga0207683_10606341 | 3300026121 | Bacteria | 1013 |
| 435 | Ga0207683_11178865 | 3300026121 | Bacteria | 710 |
| 436 | Ga0207698_10649119 | 3300026142 | Bacteria | 1045 |
| 437 | Ga0209983_1166647 | 3300027665 | Bacteria | 505 |
| 438 | Ga0209998_10203859 | 3300027717 | Archaea | 517 |
| 439 | Ga0209813_10349111 | 3300027866 | Bacteria | 585 |
| 440 | Ga0207428_10176707 | 3300027907 | Unclassified | 1614 |
| 441 | Ga0207428_10281367 | 3300027907 | Bacteria | 1235 |
| 442 | Ga0207428_10358649 | 3300027907 | Unclassified | 1072 |
| 443 | Ga0268266_10735694 | 3300028379 | Bacteria | 951 |
| 444 | Ga0268266_12172749 | 3300028379 | Unclassified | 527 |
| 445 | Ga0268265_10007450 | 3300028380 | Bacteria | 7392 |
| 446 | Ga0268265_10144891 | 3300028380 | Bacteria | 1994 |
| 447 | Ga0268264_10000156 | 3300028381 | Bacteria | 155304 |
| 448 | Ga0268264_10034834 | 3300028381 | Bacteria | 4143 |
| 449 | Ga0268264_10040180 | 3300028381 | Bacteria | 3865 |
| 450 | Ga0307515_10439307 | 3300028794 | Bacteria | 922 |
| 451 | Ga0316177_1084928 | 3300030731 | Bacteria | 1331 |
| 452 | Ga0316176_1099510 | 3300030732 | Bacteria | 7648 |
| 453 | Ga0314311_1080241 | 3300030733 | Bacteria | 5845 |
| 454 | Ga0316179_1006693 | 3300030734 | Bacteria | 4448 |
| 455 | Ga0316183_1006724 | 3300030742 | Bacteria | 9356 |
| 456 | Ga0316181_1015734 | 3300030744 | Bacteria | 2437 |
| 457 | Ga0316182_1257738 | 3300030745 | Bacteria | 948 |
| 458 | Ga0265330_10132895 | 3300031235 | Bacteria | 1059 |
| 459 | Ga0265325_10471501 | 3300031241 | Bacteria | 546 |
| 460 | Ga0265340_10033047 | 3300031247 | Bacteria | 2578 |
| 461 | Ga0265327_10000201 | 3300031251 | Bacteria | 124359 |
| 462 | Ga0265327_10349086 | 3300031251 | Bacteria | 646 |
| 463 | Ga0307408_100071027 | 3300031548 | Bacteria | 2572 |
| 464 | Ga0307408_100255483 | 3300031548 | Bacteria | 1447 |
| 465 | Ga0307408_100342912 | 3300031548 | Bacteria | 1265 |
| 466 | Ga0307408_101492458 | 3300031548 | Unclassified | 639 |
| 467 | Ga0265313_10320421 | 3300031595 | Bacteria | 619 |
| 468 | Ga0307508_10262257 | 3300031616 | Bacteria | 1322 |
| 469 | Ga0307405_10050963 | 3300031731 | Bacteria | 2566 |
| 470 | Ga0307405_10148692 | 3300031731 | Bacteria | 1644 |
| 471 | Ga0307405_10338528 | 3300031731 | Bacteria | 1156 |
| 472 | Ga0307405_10551271 | 3300031731 | Bacteria | 933 |
| 473 | Ga0307405_10651298 | 3300031731 | Bacteria | 866 |
| 474 | Ga0307405_11904794 | 3300031731 | Bacteria | 530 |
| 475 | Ga0307413_10146049 | 3300031824 | Bacteria | 1642 |
| 476 | Ga0307413_10741604 | 3300031824 | Bacteria | 820 |
| 477 | Ga0307413_10898878 | 3300031824 | Bacteria | 752 |
| 478 | Ga0307410_10037217 | 3300031852 | Bacteria | 3176 |
| 479 | Ga0307410_10363308 | 3300031852 | Bacteria | 1160 |
| 480 | Ga0307407_10126527 | 3300031903 | Bacteria | 1628 |
| 481 | Ga0307412_10026505 | 3300031911 | Bacteria | 3603 |
| 482 | Ga0307412_10136737 | 3300031911 | Bacteria | 1789 |
| 483 | Ga0307412_12172092 | 3300031911 | Bacteria | 516 |
| 484 | Ga0307409_101133016 | 3300031995 | Bacteria | 804 |
| 485 | Ga0307409_102004386 | 3300031995 | Unclassified | 608 |
| 486 | Ga0307416_100023276 | 3300032002 | Bacteria | 4492 |
| 487 | Ga0307416_100097232 | 3300032002 | Bacteria | 2549 |
| 488 | Ga0307414_10083717 | 3300032004 | Bacteria | 2343 |
| 489 | Ga0307414_10453413 | 3300032004 | Bacteria | 1125 |
| 490 | Ga0307414_12218495 | 3300032004 | Bacteria | 513 |
| 491 | Ga0307411_10070123 | 3300032005 | Bacteria | 2370 |
| 492 | Ga0307411_10238595 | 3300032005 | Bacteria | 1422 |
| 493 | Ga0307415_100031282 | 3300032126 | Bacteria | 3427 |
| 494 | Ga0307415_100303972 | 3300032126 | Bacteria | 1323 |
| 495 | Ga0307510_10121976 | 3300033180 | Bacteria | 2307 |
| 496 | Ga0373932_0076826 | 3300035112 | Unclassified | 1047 |
| 497 | Ga0373953_0186054 | 3300035117 | Bacteria | 897 |
| 498 | Ga0373954_0137075 | 3300035118 | Unclassified | 1193 |
| 499 | Ga0373956_0066624 | 3300035119 | Unclassified | 1638 |
| 500 | Ga0373931_0142836 | 3300035691 | Bacteria | 1388 |
| 501 | Ga0373933_0826479 | 3300035724 | Unclassified | 610 |
| 502 | Ga0373947_0876770 | 3300035725 | Unclassified | 613 |
| 503 | Ga0373937_0090487 | 3300036401 | Bacteria | 2834 |
| 504 | Ga0373937_2135776 | 3300036401 | Unclassified | 506 |
| 505 | Ga0436360_0282104 | 3300039438 | Unclassified | 775 |
| 506 | Ga0436360_1221163 | 3300039438 | Bacteria | 704 |
| 507 | Ga0439439_0025543 | 3300041406 | Bacteria | 1487 |
| 508 | Ga0439447_007672 | 3300041407 | Bacteria | 3399 |
| 509 | Ga0439461_0060469 | 3300041410 | Bacteria | 859 |
| 510 | Ga0439466_0007112 | 3300041411 | Bacteria | 4236 |
| 511 | Ga0439466_0226591 | 3300041411 | Bacteria | 567 |
| 512 | Ga0439465_0000026 | 3300041413 | Bacteria | 29635 |
| 513 | Ga0451791_0356159 | 3300041451 | Bacteria | 538 |
| 514 | Ga0451797_0720147 | 3300041453 | Bacteria | 545 |
| 515 | Ga0451798_0431473 | 3300041458 | Bacteria | 726 |
| 516 | Ga0451802_0534293 | 3300041460 | Bacteria | 550 |
| 517 | Ga0451804_0836606 | 3300041463 | Unclassified | 635 |
| 518 | Ga0451843_0811403 | 3300041509 | Bacteria | 1116 |
| 519 | Ga0439431_0000034 | 3300041997 | Bacteria | 20591 |
| 520 | Ga0439433_0000067 | 3300041999 | Bacteria | 13181 |
| 521 | Ga0439442_040654 | 3300042002 | Bacteria | 977 |
| 522 | Ga0439442_143893 | 3300042002 | Bacteria | 528 |
| 523 | Ga0439445_0000146 | 3300042004 | Bacteria | 12454 |
| 524 | Ga0439448_0345253 | 3300042005 | Bacteria | 530 |
| 525 | Ga0439432_000206 | 3300042006 | Bacteria | 20983 |
| 526 | Ga0439432_023763 | 3300042006 | Bacteria | 2017 |
| 527 | Ga0439449_0000276 | 3300042007 | Bacteria | 18583 |
| 528 | Ga0439452_000641 | 3300042010 | Bacteria | 17592 |
| 529 | Ga0439457_007265 | 3300042014 | Bacteria | 2668 |
| 530 | Ga0439462_0001588 | 3300042015 | Bacteria | 5102 |
| 531 | Ga0450890_029398 | 3300042127 | Bacteria | 777 |
| 532 | Ga0439446_0016088 | 3300042156 | Bacteria | 2081 |
| 533 | Ga0450908_068025 | 3300042184 | Bacteria | 631 |
| 534 | Ga0450908_105298 | 3300042184 | Bacteria | 518 |
| 535 | Ga0439434_0000300 | 3300042435 | Bacteria | 14185 |
| 536 | Ga0439460_0113670 | 3300042461 | Bacteria | 880 |
| 537 | Ga0451577_0246794 | 3300042876 | Bacteria | 1616 |
| 538 | Ga0451577_0802576 | 3300042876 | Bacteria | 850 |
| 539 | Ga0453683_0237426 | 3300044673 | Bacteria | 1161 |
| 540 | Ga0466966_0038431 | 3300044684 | Unclassified | 3085 |
| 541 | Ga0453684_0809694 | 3300044712 | Bacteria | 1010 |
| 542 | Ga0466959_0361590 | 3300045049 | Unclassified | 989 |
| 543 | Ga0451576_0070615 | 3300045051 | Bacteria | 3635 |
| 544 | Ga0466958_0220832 | 3300045836 | Unclassified | 1209 |
| 545 | Ga0495627_053601 | 3300046453 | Bacteria | 1207 |
| 546 | Ga0495638_0024101 | 3300046460 | Bacteria | 3972 |
| 547 | Ga0495651_0023107 | 3300046462 | Bacteria | 4836 |
| 548 | Ga0495651_0150536 | 3300046462 | Bacteria | 1678 |
| 549 | Ga0495651_0333253 | 3300046462 | Bacteria | 1008 |
| 550 | Ga0495653_0535951 | 3300046463 | Bacteria | 726 |
| 551 | Ga0495580_0000672 | 3300046472 | Bacteria | 29183 |
| 552 | Ga0495639_0011620 | 3300046475 | Bacteria | 3798 |
| 553 | Ga0495610_0181380 | 3300046512 | Bacteria | 875 |
| 554 | Ga0495616_0002482 | 3300046513 | Bacteria | 12212 |
| 555 | Ga0495628_0589734 | 3300046516 | Bacteria | 795 |
| 556 | Ga0495630_0262677 | 3300046517 | Bacteria | 1319 |
| 557 | Ga0495631_0000067 | 3300046518 | Bacteria | 64990 |
| 558 | Ga0495637_0035666 | 3300046520 | Bacteria | 2170 |
| 559 | Ga0495637_0189766 | 3300046520 | Bacteria | 759 |
| 560 | Ga0495663_0034282 | 3300046525 | Bacteria | 1519 |
| 561 | Ga0495663_0315357 | 3300046525 | Bacteria | 565 |
| 562 | Ga0495654_0269455 | 3300046530 | Bacteria | 704 |
| 563 | Ga0495640_0332975 | 3300046533 | Bacteria | 939 |
| 564 | Ga0495587_0399485 | 3300046536 | Bacteria | 764 |
| 565 | Ga0495598_0051908 | 3300046537 | Bacteria | 1237 |
| 566 | Ga0495621_0001559 | 3300046539 | Bacteria | 5970 |
| 567 | Ga0495621_0049535 | 3300046539 | Bacteria | 1499 |
| 568 | Ga0495645_0864662 | 3300046543 | Unclassified | 539 |
| 569 | Ga0495622_0081789 | 3300046557 | Bacteria | 1486 |
| 570 | Ga0495622_0179473 | 3300046557 | Bacteria | 950 |
| 571 | Ga0495656_0013202 | 3300046615 | Bacteria | 3066 |
| 572 | Ga0495656_0168454 | 3300046615 | Bacteria | 1069 |
| 573 | Ga0495668_0026483 | 3300046616 | Bacteria | 3290 |
| 574 | Ga0495625_0028048 | 3300046660 | Bacteria | 4226 |
| 575 | Ga0495635_0213555 | 3300046663 | Bacteria | 1306 |
| 576 | Ga0495635_0571414 | 3300046663 | Bacteria | 740 |
| 577 | Ga0495588_0021323 | 3300046674 | Bacteria | 3192 |
| 578 | Ga0495599_0218190 | 3300046678 | Bacteria | 1168 |
| 579 | Ga0495599_0357989 | 3300046678 | Bacteria | 874 |
| 580 | Ga0495613_0811042 | 3300046689 | Bacteria | 610 |
| 581 | Ga0495624_0283854 | 3300046690 | Bacteria | 999 |
| 582 | Ga0495670_0207703 | 3300046691 | Bacteria | 1038 |
| 583 | Ga0495600_0105196 | 3300046809 | Bacteria | 1839 |
| 584 | Ga0495600_0488630 | 3300046809 | Bacteria | 758 |
| 585 | Ga0495672_0159662 | 3300047320 | Bacteria | 1160 |
| 586 | Ga0495676_0066940 | 3300047321 | Bacteria | 2781 |
| 587 | Ga0495676_0774580 | 3300047321 | Bacteria | 618 |
| 588 | Ga0495685_225916 | 3300047447 | Bacteria | 597 |
| 589 | Ga0495593_0064869 | 3300047673 | Bacteria | 1905 |
| 590 | Ga0495602_0087988 | 3300048088 | Bacteria | 2587 |
| 591 | Ga0495602_0379564 | 3300048088 | Bacteria | 1013 |
| 592 | Ga0495614_0021458 | 3300048089 | Bacteria | 2789 |
| 593 | Ga0495614_0532699 | 3300048089 | Bacteria | 561 |
| 594 | Ga0495615_0027097 | 3300048090 | Bacteria | 1342 |
| 595 | Ga0496100_1555572 | 3300048903 | Unclassified | 522 |
| 596 | Ga0496101_0001086 | 3300048904 | Bacteria | 16129 |
| 597 | Ga0496102_0042589 | 3300048905 | Bacteria | 4114 |
| 598 | Ga0496102_0265668 | 3300048905 | Bacteria | 1618 |
| 599 | Ga0496104_0005610 | 3300048907 | Bacteria | 10985 |
| 600 | Ga0496105_0001424 | 3300048908 | Bacteria | 16806 |
| 601 | Ga0496105_0702357 | 3300048908 | Bacteria | 776 |
| 602 | Ga0496105_1044442 | 3300048908 | Bacteria | 609 |
| 603 | Ga0496106_1142782 | 3300048909 | Bacteria | 609 |
| 604 | Ga0496108_0095496 | 3300048911 | Bacteria | 2531 |
| 605 | Ga0496109_0107726 | 3300048912 | Bacteria | 2589 |
| 606 | Ga0496109_0115216 | 3300048912 | Bacteria | 2501 |
| 607 | Ga0496110_0002674 | 3300048913 | Bacteria | 13459 |
| 608 | Ga0496110_0007149 | 3300048913 | Bacteria | 8887 |
| 609 | Ga0496111_0064162 | 3300048914 | Bacteria | 2664 |
| 610 | Ga0496111_0965973 | 3300048914 | Bacteria | 611 |
| 611 | Ga0496113_0434686 | 3300048916 | Bacteria | 1054 |
| 612 | Ga0496114_0220098 | 3300048917 | Bacteria | 1666 |
| 613 | Ga0496114_0747687 | 3300048917 | Bacteria | 855 |
| 614 | Ga0496115_0496142 | 3300048918 | Unclassified | 982 |
| 615 | Ga0496116_0068756 | 3300048919 | Bacteria | 2255 |
| 616 | Ga0496117_0036021 | 3300048920 | Bacteria | 3707 |
| 617 | Ga0496118_0007548 | 3300048921 | Bacteria | 11485 |
| 618 | Ga0496118_0361559 | 3300048921 | Bacteria | 769 |
| 619 | Ga0496118_0437111 | 3300048921 | Bacteria | 668 |
| 620 | Ga0496119_0007290 | 3300048922 | Bacteria | 10004 |
| 621 | Ga0496119_0163193 | 3300048922 | Bacteria | 1182 |
| 622 | Ga0496120_0113633 | 3300048923 | Unclassified | 1410 |
| 623 | Ga0496121_0056893 | 3300048924 | Bacteria | 3244 |
| 624 | Ga0496121_0078212 | 3300048924 | Bacteria | 2630 |
| 625 | Ga0496121_0271151 | 3300048924 | Bacteria | 1166 |
| 626 | Ga0496121_0687756 | 3300048924 | Bacteria | 617 |
| 627 | Ga0496122_0001985 | 3300048925 | Bacteria | 30535 |
| 628 | Ga0496122_0007594 | 3300048925 | Bacteria | 11986 |
| 629 | Ga0496122_0050320 | 3300048925 | Bacteria | 3179 |
| 630 | Ga0496122_0188718 | 3300048925 | Bacteria | 1219 |
| 631 | Ga0496123_0011920 | 3300048926 | Bacteria | 7466 |
| 632 | Ga0496123_0013891 | 3300048926 | Bacteria | 6711 |
| 633 | Ga0496123_0127542 | 3300048926 | Bacteria | 1417 |
| 634 | Ga0496124_0004029 | 3300048927 | Bacteria | 17475 |
| 635 | Ga0496124_0020609 | 3300048927 | Bacteria | 6086 |
| 636 | Ga0496125_0020118 | 3300048928 | Bacteria | 6275 |
| 637 | Ga0496125_0525422 | 3300048928 | Bacteria | 661 |
| 638 | Ga0501034_0290922 | 3300049571 | Bacteria | 1572 |
| 639 | Ga0501039_0426431 | 3300049575 | Bacteria | 1042 |
| 640 | Ga0501039_0627896 | 3300049575 | Bacteria | 842 |
| 641 | Ga0501046_1236081 | 3300049580 | Unclassified | 512 |
| 642 | Ga0501071_1310056 | 3300049587 | Bacteria | 559 |
| 643 | Ga0501072_0114790 | 3300049588 | Bacteria | 2144 |
| 644 | Ga0501075_1018021 | 3300049591 | Unclassified | 629 |
| 645 | Ga0501076_0107024 | 3300049592 | Bacteria | 2258 |
| 646 | Ga0501076_0442989 | 3300049592 | Bacteria | 1069 |
| 647 | Ga0501076_0555452 | 3300049592 | Bacteria | 947 |
| 648 | Ga0501227_157031 | 3300049665 | Bacteria | 631 |
| 649 | Ga0501238_012789 | 3300049671 | Bacteria | 1139 |
| 650 | Ga0501081_0333953 | 3300049743 | Bacteria | 1115 |
| 651 | Ga0501083_0561696 | 3300049744 | Unclassified | 743 |
| 652 | Ga0501241_098697 | 3300049758 | Bacteria | 627 |
| 653 | nmdc:mga03683_307380_c1 | 3300050489 | Bacteria | 745 |
| 654 | nmdc:mga03n38_15066_c1 | 3300050490 | Bacteria | 2979 |
| 655 | nmdc:mga03n38_88249_c1 | 3300050490 | Bacteria | 1471 |
| 656 | nmdc:mga00v17_13311_c1 | 3300050491 | Bacteria | 4564 |
| 657 | nmdc:mga00v17_462008_c1 | 3300050491 | Bacteria | 824 |
| 658 | nmdc:mga0yw44_1462_c1 | 3300050492 | Bacteria | 9399 |
| 659 | nmdc:mga0k408_117191_c1 | 3300050493 | Bacteria | 1576 |
| 660 | nmdc:mga0k408_256707_c1 | 3300050493 | Bacteria | 1044 |
| 661 | nmdc:mga0k408_3020_c1 | 3300050493 | Bacteria | 8922 |
| 662 | nmdc:mga0k408_373780_c1 | 3300050493 | Bacteria | 849 |
| 663 | nmdc:mga06z11_222786_c1 | 3300050494 | Bacteria | 1103 |
| 664 | nmdc:mga06z11_299145_c1 | 3300050494 | Bacteria | 956 |
| 665 | nmdc:mga06z11_43894_c1 | 3300050494 | Bacteria | 2252 |
| 666 | nmdc:mga06z11_732382_c1 | 3300050494 | Bacteria | 602 |
| 667 | nmdc:mga07m45_107421_c1 | 3300050496 | Bacteria | 1606 |
| 668 | nmdc:mga07m45_10975_c1 | 3300050496 | Bacteria | 4747 |
| 669 | nmdc:mga07m45_3692_c2 | 3300050496 | Bacteria | 6479 |
| 670 | nmdc:mga07m45_61979_c1 | 3300050496 | Bacteria | 2119 |
| 671 | nmdc:mga07m45_7175_c1 | 3300050496 | Bacteria | 5678 |
| 672 | nmdc:mga07m45_809909_c1 | 3300050496 | Bacteria | 537 |
| 673 | nmdc:mga05p37_1075729_c1 | 3300050507 | Bacteria | 845 |
| 674 | nmdc:mga05p37_515_c1 | 3300050507 | Bacteria | 42751 |
| 675 | nmdc:mga09592_100270_c1 | 3300050508 | Unclassified | 2480 |
| 676 | nmdc:mga0qj67_274983_c1 | 3300050509 | Bacteria | 1365 |
| 677 | nmdc:mga0qj67_32999_c1 | 3300050509 | Bacteria | 4039 |
| 678 | nmdc:mga06r32_1360753_c1 | 3300050510 | Unclassified | 652 |
| 679 | nmdc:mga06r32_27384_c1 | 3300050510 | Bacteria | 5325 |
| 680 | nmdc:mga06r32_28_c1 | 3300050510 | Bacteria | 87379 |
| 681 | nmdc:mga06r32_460826_c1 | 3300050510 | Bacteria | 1250 |
| 682 | nmdc:mga08y16_124_c2 | 3300050511 | Bacteria | 38531 |
| 683 | nmdc:mga08y16_31708_c1 | 3300050511 | Bacteria | 5557 |
| 684 | nmdc:mga0n895_12706_c1 | 3300050512 | Bacteria | 7561 |
| 685 | nmdc:mga0n895_32298_c1 | 3300050512 | Bacteria | 5024 |
| 686 | nmdc:mga0n895_84346_c1 | 3300050512 | Bacteria | 3170 |
| 687 | nmdc:mga0rr50_184085_c1 | 3300050513 | Bacteria | 1709 |
| 688 | nmdc:mga0rr50_64150_c1 | 3300050513 | Bacteria | 2777 |
| 689 | nmdc:mga0rr50_803324_c1 | 3300050513 | Bacteria | 803 |
| 690 | nmdc:mga08x19_349404_c1 | 3300050514 | Bacteria | 1032 |
| 691 | nmdc:mga0a205_152492_c1 | 3300050515 | Bacteria | 2210 |
| 692 | nmdc:mga0sz30_478830_c1 | 3300050516 | Bacteria | 559 |
| 693 | nmdc:mga0sz30_61358_c1 | 3300050516 | Bacteria | 1606 |
| 694 | Ga0500610_0005809 | 3300053079 | Bacteria | 5100 |
| 695 | Ga0500643_002697 | 3300053087 | Bacteria | 8922 |
| 696 | Ga0500651_0000040 | 3300053093 | Bacteria | 92649 |
| 697 | Ga0500566_0030418 | 3300053094 | Bacteria | 3149 |
| 698 | Ga0500641_0020396 | 3300053096 | Unclassified | 2516 |
| 699 | Ga0500560_202416 | 3300053107 | Bacteria | 641 |
| 700 | Ga0500562_003280 | 3300053108 | Bacteria | 4043 |
| 701 | Ga0500571_000361 | 3300053110 | Bacteria | 17946 |
| 702 | Ga0500572_040610 | 3300053111 | Bacteria | 1347 |
| 703 | Ga0500594_0005565 | 3300053118 | Bacteria | 2795 |
| 704 | Ga0500597_131211 | 3300053120 | Bacteria | 1083 |
| 705 | Ga0500608_013301 | 3300053122 | Bacteria | 3645 |
| 706 | Ga0500618_096093 | 3300053125 | Bacteria | 666 |
| 707 | Ga0500626_026523 | 3300053128 | Bacteria | 2608 |
| 708 | Ga0500655_000193 | 3300053133 | Bacteria | 14640 |
| 709 | Ga0500658_0000095 | 3300053134 | Bacteria | 40317 |
| 710 | Ga0500658_0000122 | 3300053134 | Bacteria | 37279 |
| 711 | Ga0500559_0004405 | 3300053136 | Bacteria | 6693 |
| 712 | Ga0500564_023889 | 3300053138 | Bacteria | 2805 |
| 713 | Ga0500568_0000569 | 3300053139 | Bacteria | 27012 |
| 714 | Ga0500573_0212992 | 3300053140 | Bacteria | 1018 |
| 715 | Ga0500574_002739 | 3300053141 | Bacteria | 2970 |
| 716 | Ga0500574_003374 | 3300053141 | Bacteria | 2813 |
| 717 | Ga0500604_0154337 | 3300053151 | Bacteria | 781 |
| 718 | Ga0500616_0308902 | 3300053153 | Bacteria | 654 |
| 719 | Ga0500619_241441 | 3300053154 | Bacteria | 597 |
| 720 | Ga0500624_018686 | 3300053157 | Bacteria | 1095 |
| 721 | Ga0500634_0000914 | 3300053161 | Bacteria | 10573 |
| 722 | Ga0500638_056159 | 3300053162 | Bacteria | 1897 |
| 723 | Ga0500636_0023537 | 3300053177 | Bacteria | 3641 |
| 724 | Ga0500565_040940 | 3300053734 | Bacteria | 648 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005445 | Ga0070708_100181974 | Ga0070708_1001819742 | 95 |
| 2 | 3300005467 | Ga0070706_100848951 | Ga0070706_1008489513 | 95 |
| 3 | 3300005468 | Ga0070707_100939480 | Ga0070707_1009394802 | 95 |
| 4 | 3300005518 | Ga0070699_100158743 | Ga0070699_1001587432 | 95 |
| 5 | 3300002773 | JGI25152J39213_1003553 | JGI25152J39213_10035533 | 96 |
| 6 | 3300002773 | JGI25152J39213_1008447 | JGI25152J39213_10084476 | 96 |
| 7 | 3300002774 | JGI25150J39212_1000529 | JGI25150J39212_100052911 | 96 |
| 8 | 3300002987 | JGI25159J45721_1000714 | JGI25159J45721_100071411 | 96 |
| 9 | 3300002987 | JGI25159J45721_1004054 | JGI25159J45721_10040547 | 96 |
| 10 | 3300003187 | JGI25151J46595_10000648 | JGI25151J46595_1000064811 | 96 |
| 11 | 3300003187 | JGI25151J46595_10001672 | JGI25151J46595_1000167211 | 96 |
| 12 | 3300003187 | JGI25151J46595_10001768 | JGI25151J46595_100017682 | 96 |
| 13 | 3300003187 | JGI25151J46595_10010051 | JGI25151J46595_100100515 | 96 |
| 14 | 3300003215 | JGI25153J46596_10001378 | JGI25153J46596_1000137811 | 96 |
| 15 | 3300003320 | rootH2_10084863 | rootH2_100848631 | 96 |
| 16 | 3300003322 | rootL2_10335959 | rootL2_103359592 | 96 |
| 17 | 3300003323 | rootH1_10021926 | rootH1_100219264 | 96 |
| 18 | 3300003323 | rootH1_10122036 | rootH1_101220362 | 96 |
| 19 | 3300003354 | JGI25160J50197_1001019 | JGI25160J50197_100101911 | 96 |
| 20 | 3300003354 | JGI25160J50197_1005287 | JGI25160J50197_10052873 | 96 |
| 21 | 3300003374 | JGI25161J50226_1001734 | JGI25161J50226_10017346 | 96 |
| 22 | 3300003374 | JGI25161J50226_1002393 | JGI25161J50226_10023936 | 96 |
| 23 | 3300003374 | JGI25161J50226_1003095 | JGI25161J50226_10030953 | 96 |
| 24 | 3300003760 | Ga0055527_1009080 | Ga0055527_10090803 | 96 |
| 25 | 3300003761 | Ga0055535_1000827 | Ga0055535_10008278 | 96 |
| 26 | 3300003762 | Ga0055542_1000103 | Ga0055542_100010314 | 96 |
| 27 | 3300003771 | Ga0055526_1001885 | Ga0055526_100188511 | 96 |
| 28 | 3300003771 | Ga0055526_1010803 | Ga0055526_10108033 | 96 |
| 29 | 3300003773 | Ga0055537_1000532 | Ga0055537_100053211 | 96 |
| 30 | 3300003775 | Ga0055524_1001312 | Ga0055524_100131211 | 96 |
| 31 | 3300003781 | Ga0055536_1000559 | Ga0055536_10005599 | 96 |
| 32 | 3300003781 | Ga0055536_1081886 | Ga0055536_10818862 | 96 |
| 33 | 3300003784 | Ga0055534_1000806 | Ga0055534_100080611 | 96 |
| 34 | 3300003784 | Ga0055534_1004180 | Ga0055534_10041806 | 96 |
| 35 | 3300003790 | Ga0055528_1000780 | Ga0055528_100078011 | 96 |
| 36 | 3300003791 | Ga0055530_10000342 | Ga0055530_1000034218 | 96 |
| 37 | 3300003791 | Ga0055530_10012129 | Ga0055530_100121292 | 96 |
| 38 | 3300003792 | Ga0055540_1001460 | Ga0055540_10014609 | 96 |
| 39 | 3300003792 | Ga0055540_1001885 | Ga0055540_10018857 | 96 |
| 40 | 3300003792 | Ga0055540_1012669 | Ga0055540_10126692 | 96 |
| 41 | 3300003794 | Ga0055531_10000628 | Ga0055531_1000062818 | 96 |
| 42 | 3300003794 | Ga0055531_10002126 | Ga0055531_100021268 | 96 |
| 43 | 3300003794 | Ga0055531_10002147 | Ga0055531_100021477 | 96 |
| 44 | 3300003794 | Ga0055531_10011100 | Ga0055531_100111006 | 96 |
| 45 | 3300004625 | Ga0055543_1000702 | Ga0055543_10007025 | 96 |
| 46 | 3300004625 | Ga0055543_1000769 | Ga0055543_10007693 | 96 |
| 47 | 3300005262 | Ga0065165_1002519 | Ga0065165_100251911 | 96 |
| 48 | 3300005262 | Ga0065165_1002602 | Ga0065165_10026026 | 96 |
| 49 | 3300005327 | Ga0070658_10143979 | Ga0070658_101439792 | 96 |
| 50 | 3300005330 | Ga0070690_100331648 | Ga0070690_1003316482 | 96 |
| 51 | 3300005331 | Ga0070670_100581499 | Ga0070670_1005814991 | 96 |
| 52 | 3300005331 | Ga0070670_100618278 | Ga0070670_1006182782 | 96 |
| 53 | 3300005334 | Ga0068869_100055545 | Ga0068869_1000555452 | 96 |
| 54 | 3300005334 | Ga0068869_100058931 | Ga0068869_1000589315 | 96 |
| 55 | 3300005334 | Ga0068869_100252172 | Ga0068869_1002521722 | 96 |
| 56 | 3300005334 | Ga0068869_100479292 | Ga0068869_1004792922 | 96 |
| 57 | 3300005334 | Ga0068869_100490495 | Ga0068869_1004904952 | 96 |
| 58 | 3300005334 | Ga0068869_100709691 | Ga0068869_1007096911 | 96 |
| 59 | 3300005335 | Ga0070666_10007871 | Ga0070666_1000787112 | 96 |
| 60 | 3300005336 | Ga0070680_101747640 | Ga0070680_1017476401 | 96 |
| 61 | 3300005337 | Ga0070682_100577459 | Ga0070682_1005774592 | 96 |
| 62 | 3300005338 | Ga0068868_100002109 | Ga0068868_1000021098 | 96 |
| 63 | 3300005338 | Ga0068868_100139682 | Ga0068868_1001396822 | 96 |
| 64 | 3300005339 | Ga0070660_100557997 | Ga0070660_1005579971 | 96 |
| 65 | 3300005340 | Ga0070689_100362657 | Ga0070689_1003626572 | 96 |
| 66 | 3300005340 | Ga0070689_101558577 | Ga0070689_1015585772 | 96 |
| 67 | 3300005340 | Ga0070689_101721177 | Ga0070689_1017211771 | 96 |
| 68 | 3300005341 | Ga0070691_10394681 | Ga0070691_103946812 | 96 |
| 69 | 3300005344 | Ga0070661_100409418 | Ga0070661_1004094182 | 96 |
| 70 | 3300005347 | Ga0070668_100005152 | Ga0070668_1000051524 | 96 |
| 71 | 3300005347 | Ga0070668_100176210 | Ga0070668_1001762102 | 96 |
| 72 | 3300005347 | Ga0070668_100192504 | Ga0070668_1001925042 | 96 |
| 73 | 3300005347 | Ga0070668_101295069 | Ga0070668_1012950691 | 96 |
| 74 | 3300005353 | Ga0070669_100100404 | Ga0070669_1001004043 | 96 |
| 75 | 3300005353 | Ga0070669_100100504 | Ga0070669_1001005042 | 96 |
| 76 | 3300005353 | Ga0070669_100279142 | Ga0070669_1002791423 | 96 |
| 77 | 3300005353 | Ga0070669_100838909 | Ga0070669_1008389092 | 96 |
| 78 | 3300005354 | Ga0070675_100000542 | Ga0070675_10000054238 | 96 |
| 79 | 3300005354 | Ga0070675_102019558 | Ga0070675_1020195581 | 96 |
| 80 | 3300005355 | Ga0070671_100002141 | Ga0070671_10000214117 | 96 |
| 81 | 3300005356 | Ga0070674_100000170 | Ga0070674_10000017036 | 96 |
| 82 | 3300005356 | Ga0070674_100239961 | Ga0070674_1002399611 | 96 |
| 83 | 3300005364 | Ga0070673_100000311 | Ga0070673_10000031118 | 96 |
| 84 | 3300005364 | Ga0070673_100218080 | Ga0070673_1002180802 | 96 |
| 85 | 3300005364 | Ga0070673_100347493 | Ga0070673_1003474932 | 96 |
| 86 | 3300005365 | Ga0070688_100911765 | Ga0070688_1009117651 | 96 |
| 87 | 3300005366 | Ga0070659_100061334 | Ga0070659_1000613342 | 96 |
| 88 | 3300005366 | Ga0070659_100132504 | Ga0070659_1001325042 | 96 |
| 89 | 3300005367 | Ga0070667_100049914 | Ga0070667_1000499146 | 96 |
| 90 | 3300005367 | Ga0070667_100063297 | Ga0070667_1000632974 | 96 |
| 91 | 3300005367 | Ga0070667_100461459 | Ga0070667_1004614592 | 96 |
| 92 | 3300005367 | Ga0070667_100561586 | Ga0070667_1005615861 | 96 |
| 93 | 3300005367 | Ga0070667_101064602 | Ga0070667_1010646022 | 96 |
| 94 | 3300005367 | Ga0070667_101164662 | Ga0070667_1011646622 | 96 |
| 95 | 3300005434 | Ga0070709_10335666 | Ga0070709_103356661 | 96 |
| 96 | 3300005435 | Ga0070714_100642970 | Ga0070714_1006429702 | 96 |
| 97 | 3300005436 | Ga0070713_102258684 | Ga0070713_1022586841 | 96 |
| 98 | 3300005440 | Ga0070705_100435481 | Ga0070705_1004354812 | 96 |
| 99 | 3300005441 | Ga0070700_100615715 | Ga0070700_1006157151 | 96 |
| 100 | 3300005444 | Ga0070694_100259431 | Ga0070694_1002594314 | 96 |
| 101 | 3300005444 | Ga0070694_100498130 | Ga0070694_1004981302 | 96 |
| 102 | 3300005444 | Ga0070694_101733375 | Ga0070694_1017333751 | 96 |
| 103 | 3300005445 | Ga0070708_101251544 | Ga0070708_1012515442 | 96 |
| 104 | 3300005456 | Ga0070678_100091899 | Ga0070678_1000918993 | 96 |
| 105 | 3300005456 | Ga0070678_100382776 | Ga0070678_1003827761 | 96 |
| 106 | 3300005456 | Ga0070678_101977108 | Ga0070678_1019771081 | 96 |
| 107 | 3300005457 | Ga0070662_100014668 | Ga0070662_1000146683 | 96 |
| 108 | 3300005457 | Ga0070662_100201575 | Ga0070662_1002015752 | 96 |
| 109 | 3300005457 | Ga0070662_100472456 | Ga0070662_1004724562 | 96 |
| 110 | 3300005459 | Ga0068867_100001800 | Ga0068867_10000180032 | 96 |
| 111 | 3300005459 | Ga0068867_100262927 | Ga0068867_1002629273 | 96 |
| 112 | 3300005467 | Ga0070706_100075353 | Ga0070706_1000753534 | 96 |
| 113 | 3300005467 | Ga0070706_102147263 | Ga0070706_1021472632 | 96 |
| 114 | 3300005471 | Ga0070698_100709024 | Ga0070698_1007090242 | 96 |
| 115 | 3300005518 | Ga0070699_100067054 | Ga0070699_1000670544 | 96 |
| 116 | 3300005536 | Ga0070697_100019668 | Ga0070697_1000196683 | 96 |
| 117 | 3300005536 | Ga0070697_100377459 | Ga0070697_1003774591 | 96 |
| 118 | 3300005539 | Ga0068853_102033145 | Ga0068853_1020331452 | 96 |
| 119 | 3300005543 | Ga0070672_100667480 | Ga0070672_1006674802 | 96 |
| 120 | 3300005543 | Ga0070672_101025453 | Ga0070672_1010254532 | 96 |
| 121 | 3300005544 | Ga0070686_100084298 | Ga0070686_1000842982 | 96 |
| 122 | 3300005545 | Ga0070695_100518610 | Ga0070695_1005186102 | 96 |
| 123 | 3300005548 | Ga0070665_100037310 | Ga0070665_1000373105 | 96 |
| 124 | 3300005548 | Ga0070665_100324469 | Ga0070665_1003244693 | 96 |
| 125 | 3300005548 | Ga0070665_102352335 | Ga0070665_1023523351 | 96 |
| 126 | 3300005549 | Ga0070704_100096066 | Ga0070704_1000960665 | 96 |
| 127 | 3300005563 | Ga0068855_100056789 | Ga0068855_1000567896 | 96 |
| 128 | 3300005563 | Ga0068855_100467014 | Ga0068855_1004670142 | 96 |
| 129 | 3300005563 | Ga0068855_100561829 | Ga0068855_1005618291 | 96 |
| 130 | 3300005563 | Ga0068855_101385870 | Ga0068855_1013858701 | 96 |
| 131 | 3300005563 | Ga0068855_101933275 | Ga0068855_1019332751 | 96 |
| 132 | 3300005564 | Ga0070664_100413073 | Ga0070664_1004130732 | 96 |
| 133 | 3300005577 | Ga0068857_100242266 | Ga0068857_1002422664 | 96 |
| 134 | 3300005578 | Ga0068854_100131714 | Ga0068854_1001317143 | 96 |
| 135 | 3300005578 | Ga0068854_100501279 | Ga0068854_1005012792 | 96 |
| 136 | 3300005614 | Ga0068856_100201670 | Ga0068856_1002016702 | 96 |
| 137 | 3300005615 | Ga0070702_100348681 | Ga0070702_1003486811 | 96 |
| 138 | 3300005616 | Ga0068852_100005901 | Ga0068852_10000590117 | 96 |
| 139 | 3300005616 | Ga0068852_100063610 | Ga0068852_1000636104 | 96 |
| 140 | 3300005617 | Ga0068859_100071884 | Ga0068859_1000718849 | 96 |
| 141 | 3300005617 | Ga0068859_100475781 | Ga0068859_1004757813 | 96 |
| 142 | 3300005617 | Ga0068859_100770303 | Ga0068859_1007703031 | 96 |
| 143 | 3300005617 | Ga0068859_101327482 | Ga0068859_1013274822 | 96 |
| 144 | 3300005617 | Ga0068859_101674306 | Ga0068859_1016743061 | 96 |
| 145 | 3300005618 | Ga0068864_100099102 | Ga0068864_1000991022 | 96 |
| 146 | 3300005618 | Ga0068864_100202147 | Ga0068864_1002021472 | 96 |
| 147 | 3300005719 | Ga0068861_100206870 | Ga0068861_1002068703 | 96 |
| 148 | 3300005719 | Ga0068861_101012345 | Ga0068861_1010123452 | 96 |
| 149 | 3300005834 | Ga0068851_10000476 | Ga0068851_1000047639 | 96 |
| 150 | 3300005834 | Ga0068851_10001359 | Ga0068851_100013598 | 96 |
| 151 | 3300005840 | Ga0068870_10088965 | Ga0068870_100889652 | 96 |
| 152 | 3300005840 | Ga0068870_10169266 | Ga0068870_101692662 | 96 |
| 153 | 3300005841 | Ga0068863_100000916 | Ga0068863_10000091629 | 96 |
| 154 | 3300005841 | Ga0068863_100073675 | Ga0068863_1000736753 | 96 |
| 155 | 3300005841 | Ga0068863_100085174 | Ga0068863_1000851745 | 96 |
| 156 | 3300005841 | Ga0068863_100322907 | Ga0068863_1003229072 | 96 |
| 157 | 3300005841 | Ga0068863_100336373 | Ga0068863_1003363733 | 96 |
| 158 | 3300005841 | Ga0068863_100406256 | Ga0068863_1004062563 | 96 |
| 159 | 3300005842 | Ga0068858_100037941 | Ga0068858_1000379413 | 96 |
| 160 | 3300005842 | Ga0068858_100981113 | Ga0068858_1009811132 | 96 |
| 161 | 3300005842 | Ga0068858_101131764 | Ga0068858_1011317641 | 96 |
| 162 | 3300005842 | Ga0068858_101942296 | Ga0068858_1019422962 | 96 |
| 163 | 3300005843 | Ga0068860_100001439 | Ga0068860_10000143910 | 96 |
| 164 | 3300005843 | Ga0068860_100004070 | Ga0068860_1000040703 | 96 |
| 165 | 3300005843 | Ga0068860_100006251 | Ga0068860_10000625114 | 96 |
| 166 | 3300005843 | Ga0068860_101049479 | Ga0068860_1010494791 | 96 |
| 167 | 3300005844 | Ga0068862_100011277 | Ga0068862_1000112776 | 96 |
| 168 | 3300005844 | Ga0068862_100104652 | Ga0068862_1001046522 | 96 |
| 169 | 3300005844 | Ga0068862_100149511 | Ga0068862_1001495112 | 96 |
| 170 | 3300005844 | Ga0068862_100345684 | Ga0068862_1003456842 | 96 |
| 171 | 3300006028 | Ga0070717_10633148 | Ga0070717_106331482 | 96 |
| 172 | 3300006038 | Ga0075365_10007356 | Ga0075365_100073563 | 96 |
| 173 | 3300006042 | Ga0075368_10426573 | Ga0075368_104265732 | 96 |
| 174 | 3300006048 | Ga0075363_100016251 | Ga0075363_1000162512 | 96 |
| 175 | 3300006048 | Ga0075363_100242056 | Ga0075363_1002420562 | 96 |
| 176 | 3300006048 | Ga0075363_100773327 | Ga0075363_1007733272 | 96 |
| 177 | 3300006051 | Ga0075364_10003516 | Ga0075364_100035168 | 96 |
| 178 | 3300006058 | Ga0075432_10019998 | Ga0075432_100199982 | 96 |
| 179 | 3300006173 | Ga0070716_100908045 | Ga0070716_1009080452 | 96 |
| 180 | 3300006178 | Ga0075367_10059577 | Ga0075367_100595772 | 96 |
| 181 | 3300006178 | Ga0075367_10540448 | Ga0075367_105404482 | 96 |
| 182 | 3300006195 | Ga0075366_10010380 | Ga0075366_100103807 | 96 |
| 183 | 3300006195 | Ga0075366_10019852 | Ga0075366_100198523 | 96 |
| 184 | 3300006195 | Ga0075366_10420009 | Ga0075366_104200091 | 96 |
| 185 | 3300006237 | Ga0097621_100006254 | Ga0097621_10000625413 | 96 |
| 186 | 3300006237 | Ga0097621_100013732 | Ga0097621_1000137327 | 96 |
| 187 | 3300006237 | Ga0097621_102235631 | Ga0097621_1022356312 | 96 |
| 188 | 3300006353 | Ga0075370_10002892 | Ga0075370_1000289210 | 96 |
| 189 | 3300006353 | Ga0075370_10003792 | Ga0075370_100037926 | 96 |
| 190 | 3300006353 | Ga0075370_10003831 | Ga0075370_100038313 | 96 |
| 191 | 3300006353 | Ga0075370_10004452 | Ga0075370_100044526 | 96 |
| 192 | 3300006353 | Ga0075370_10041438 | Ga0075370_100414383 | 96 |
| 193 | 3300006358 | Ga0068871_100002954 | Ga0068871_10000295423 | 96 |
| 194 | 3300006358 | Ga0068871_100778273 | Ga0068871_1007782732 | 96 |
| 195 | 3300006844 | Ga0075428_100059829 | Ga0075428_1000598295 | 96 |
| 196 | 3300006844 | Ga0075428_100659398 | Ga0075428_1006593982 | 96 |
| 197 | 3300006846 | Ga0075430_100178297 | Ga0075430_1001782972 | 96 |
| 198 | 3300006846 | Ga0075430_100195026 | Ga0075430_1001950262 | 96 |
| 199 | 3300006847 | Ga0075431_100280265 | Ga0075431_1002802652 | 96 |
| 200 | 3300006847 | Ga0075431_100324710 | Ga0075431_1003247102 | 96 |
| 201 | 3300006847 | Ga0075431_101425613 | Ga0075431_1014256131 | 96 |
| 202 | 3300006852 | Ga0075433_10174797 | Ga0075433_101747973 | 96 |
| 203 | 3300006881 | Ga0068865_100097611 | Ga0068865_1000976114 | 96 |
| 204 | 3300006881 | Ga0068865_100112428 | Ga0068865_1001124282 | 96 |
| 205 | 3300006881 | Ga0068865_100382162 | Ga0068865_1003821622 | 96 |
| 206 | 3300006881 | Ga0068865_101981906 | Ga0068865_1019819061 | 96 |
| 207 | 3300006931 | Ga0097620_100071884 | Ga0097620_1000718842 | 96 |
| 208 | 3300006931 | Ga0097620_100475731 | Ga0097620_1004757313 | 96 |
| 209 | 3300006931 | Ga0097620_100770368 | Ga0097620_1007703681 | 96 |
| 210 | 3300006931 | Ga0097620_101327624 | Ga0097620_1013276242 | 96 |
| 211 | 3300006931 | Ga0097620_101674287 | Ga0097620_1016742871 | 96 |
| 212 | 3300009036 | Ga0105244_10003954 | Ga0105244_100039543 | 96 |
| 213 | 3300009036 | Ga0105244_10026489 | Ga0105244_100264894 | 96 |
| 214 | 3300009036 | Ga0105244_10469483 | Ga0105244_104694831 | 96 |
| 215 | 3300009093 | Ga0105240_10041594 | Ga0105240_100415946 | 96 |
| 216 | 3300009093 | Ga0105240_10174675 | Ga0105240_101746753 | 96 |
| 217 | 3300009094 | Ga0111539_10219863 | Ga0111539_102198632 | 96 |
| 218 | 3300009094 | Ga0111539_12068630 | Ga0111539_120686302 | 96 |
| 219 | 3300009098 | Ga0105245_10354792 | Ga0105245_103547923 | 96 |
| 220 | 3300009147 | Ga0114129_11504672 | Ga0114129_115046721 | 96 |
| 221 | 3300009148 | Ga0105243_10000385 | Ga0105243_1000038521 | 96 |
| 222 | 3300009148 | Ga0105243_10030905 | Ga0105243_100309057 | 96 |
| 223 | 3300009148 | Ga0105243_10461052 | Ga0105243_104610523 | 96 |
| 224 | 3300009148 | Ga0105243_10506919 | Ga0105243_105069192 | 96 |
| 225 | 3300009148 | Ga0105243_10648725 | Ga0105243_106487252 | 96 |
| 226 | 3300009148 | Ga0105243_11010719 | Ga0105243_110107191 | 96 |
| 227 | 3300009174 | Ga0105241_11143763 | Ga0105241_111437632 | 96 |
| 228 | 3300009176 | Ga0105242_10066651 | Ga0105242_100666514 | 96 |
| 229 | 3300009176 | Ga0105242_10541419 | Ga0105242_105414192 | 96 |
| 230 | 3300009176 | Ga0105242_11319236 | Ga0105242_113192362 | 96 |
| 231 | 3300009177 | Ga0105248_10222563 | Ga0105248_102225635 | 96 |
| 232 | 3300009177 | Ga0105248_10516452 | Ga0105248_105164522 | 96 |
| 233 | 3300009545 | Ga0105237_10044342 | Ga0105237_100443425 | 96 |
| 234 | 3300009551 | Ga0105238_10519878 | Ga0105238_105198782 | 96 |
| 235 | 3300009553 | Ga0105249_10016212 | Ga0105249_100162129 | 96 |
| 236 | 3300009553 | Ga0105249_10281820 | Ga0105249_102818202 | 96 |
| 237 | 3300009553 | Ga0105249_10342956 | Ga0105249_103429562 | 96 |
| 238 | 3300009553 | Ga0105249_10796876 | Ga0105249_107968761 | 96 |
| 239 | 3300010375 | Ga0105239_10218755 | Ga0105239_102187553 | 96 |
| 240 | 3300010375 | Ga0105239_10327973 | Ga0105239_103279733 | 96 |
| 241 | 3300011119 | Ga0105246_10038608 | Ga0105246_100386085 | 96 |
| 242 | 3300011119 | Ga0105246_10256765 | Ga0105246_102567652 | 96 |
| 243 | 3300011119 | Ga0105246_10370212 | Ga0105246_103702122 | 96 |
| 244 | 3300012512 | Ga0157327_1070785 | Ga0157327_10707851 | 96 |
| 245 | 3300013100 | Ga0157373_10012427 | Ga0157373_100124276 | 96 |
| 246 | 3300013100 | Ga0157373_10057182 | Ga0157373_100571822 | 96 |
| 247 | 3300013100 | Ga0157373_10132012 | Ga0157373_101320122 | 96 |
| 248 | 3300013102 | Ga0157371_10016208 | Ga0157371_100162085 | 96 |
| 249 | 3300013104 | Ga0157370_10010652 | Ga0157370_100106528 | 96 |
| 250 | 3300013104 | Ga0157370_10145566 | Ga0157370_101455662 | 96 |
| 251 | 3300013105 | Ga0157369_10001788 | Ga0157369_1000178810 | 96 |
| 252 | 3300013297 | Ga0157378_10023616 | Ga0157378_100236167 | 96 |
| 253 | 3300013297 | Ga0157378_10266161 | Ga0157378_102661613 | 96 |
| 254 | 3300013297 | Ga0157378_10698950 | Ga0157378_106989502 | 96 |
| 255 | 3300013297 | Ga0157378_11332547 | Ga0157378_113325472 | 96 |
| 256 | 3300013306 | Ga0163162_10082115 | Ga0163162_100821157 | 96 |
| 257 | 3300013306 | Ga0163162_10098434 | Ga0163162_100984342 | 96 |
| 258 | 3300013306 | Ga0163162_10581621 | Ga0163162_105816213 | 96 |
| 259 | 3300013306 | Ga0163162_13195259 | Ga0163162_131952591 | 96 |
| 260 | 3300013307 | Ga0157372_10103425 | Ga0157372_101034254 | 96 |
| 261 | 3300013308 | Ga0157375_10192933 | Ga0157375_101929333 | 96 |
| 262 | 3300013308 | Ga0157375_10758042 | Ga0157375_107580422 | 96 |
| 263 | 3300014325 | Ga0163163_10360389 | Ga0163163_103603892 | 96 |
| 264 | 3300014325 | Ga0163163_10406154 | Ga0163163_104061542 | 96 |
| 265 | 3300014326 | Ga0157380_10255346 | Ga0157380_102553463 | 96 |
| 266 | 3300014326 | Ga0157380_10255764 | Ga0157380_102557643 | 96 |
| 267 | 3300014326 | Ga0157380_10300676 | Ga0157380_103006763 | 96 |
| 268 | 3300014326 | Ga0157380_11603350 | Ga0157380_116033502 | 96 |
| 269 | 3300014326 | Ga0157380_11931893 | Ga0157380_119318931 | 96 |
| 270 | 3300014326 | Ga0157380_13500913 | Ga0157380_135009131 | 96 |
| 271 | 3300014497 | Ga0182008_10000536 | Ga0182008_100005369 | 96 |
| 272 | 3300014497 | Ga0182008_10003506 | Ga0182008_100035063 | 96 |
| 273 | 3300014497 | Ga0182008_10009042 | Ga0182008_100090426 | 96 |
| 274 | 3300014497 | Ga0182008_10014187 | Ga0182008_100141873 | 96 |
| 275 | 3300014968 | Ga0157379_10035897 | Ga0157379_100358974 | 96 |
| 276 | 3300014969 | Ga0157376_10022402 | Ga0157376_100224029 | 96 |
| 277 | 3300014969 | Ga0157376_10178359 | Ga0157376_101783594 | 96 |
| 278 | 3300014969 | Ga0157376_10377226 | Ga0157376_103772262 | 96 |
| 279 | 3300014969 | Ga0157376_10536789 | Ga0157376_105367892 | 96 |
| 280 | 3300014969 | Ga0157376_10641213 | Ga0157376_106412132 | 96 |
| 281 | 3300014969 | Ga0157376_10729550 | Ga0157376_107295502 | 96 |
| 282 | 3300015261 | Ga0182006_1001750 | Ga0182006_10017506 | 96 |
| 283 | 3300015262 | Ga0182007_10000335 | Ga0182007_1000033513 | 96 |
| 284 | 3300015262 | Ga0182007_10017433 | Ga0182007_100174333 | 96 |
| 285 | 3300015265 | Ga0182005_1023710 | Ga0182005_10237102 | 96 |
| 286 | 3300015265 | Ga0182005_1031329 | Ga0182005_10313292 | 96 |
| 287 | 3300017792 | Ga0163161_10000463 | Ga0163161_1000046324 | 96 |
| 288 | 3300017792 | Ga0163161_10019607 | Ga0163161_100196077 | 96 |
| 289 | 3300017792 | Ga0163161_10027191 | Ga0163161_100271917 | 96 |
| 290 | 3300017792 | Ga0163161_10064169 | Ga0163161_100641692 | 96 |
| 291 | 3300017792 | Ga0163161_10070495 | Ga0163161_100704956 | 96 |
| 292 | 3300017792 | Ga0163161_10265217 | Ga0163161_102652173 | 96 |
| 293 | 3300017792 | Ga0163161_10566541 | Ga0163161_105665412 | 96 |
| 294 | 3300025208 | Ga0209436_103826 | Ga0209436_1038266 | 96 |
| 295 | 3300025228 | Ga0209672_101347 | Ga0209672_1013476 | 96 |
| 296 | 3300025229 | Ga0209147_100582 | Ga0209147_1005827 | 96 |
| 297 | 3300025229 | Ga0209147_118169 | Ga0209147_1181692 | 96 |
| 298 | 3300025242 | Ga0209258_100133 | Ga0209258_100133147 | 96 |
| 299 | 3300025245 | Ga0207425_1000392 | Ga0207425_100039214 | 96 |
| 300 | 3300025245 | Ga0207425_1021681 | Ga0207425_10216812 | 96 |
| 301 | 3300025245 | Ga0207425_1077659 | Ga0207425_10776591 | 96 |
| 302 | 3300025254 | Ga0209148_1000188 | Ga0209148_100018815 | 96 |
| 303 | 3300025258 | Ga0209129_1000111 | Ga0209129_100011128 | 96 |
| 304 | 3300025258 | Ga0209129_1000425 | Ga0209129_100042528 | 96 |
| 305 | 3300025258 | Ga0209129_1002392 | Ga0209129_10023926 | 96 |
| 306 | 3300025263 | Ga0209565_1000146 | Ga0209565_100014636 | 96 |
| 307 | 3300025263 | Ga0209565_1000891 | Ga0209565_100089110 | 96 |
| 308 | 3300025273 | Ga0209673_1000216 | Ga0209673_100021694 | 96 |
| 309 | 3300025273 | Ga0209673_1001323 | Ga0209673_100132311 | 96 |
| 310 | 3300025273 | Ga0209673_1001463 | Ga0209673_100146311 | 96 |
| 311 | 3300025284 | Ga0209130_1000470 | Ga0209130_100047018 | 96 |
| 312 | 3300025284 | Ga0209130_1000646 | Ga0209130_100064624 | 96 |
| 313 | 3300025284 | Ga0209130_1018482 | Ga0209130_10184822 | 96 |
| 314 | 3300025291 | Ga0209675_1000331 | Ga0209675_100033115 | 96 |
| 315 | 3300025291 | Ga0209675_1000685 | Ga0209675_10006857 | 96 |
| 316 | 3300025292 | Ga0209676_1000111 | Ga0209676_1000111173 | 96 |
| 317 | 3300025292 | Ga0209676_1000737 | Ga0209676_10007375 | 96 |
| 318 | 3300025292 | Ga0209676_1010159 | Ga0209676_10101592 | 96 |
| 319 | 3300025292 | Ga0209676_1018576 | Ga0209676_10185762 | 96 |
| 320 | 3300025294 | Ga0209025_1000038 | Ga0209025_1000038141 | 96 |
| 321 | 3300025294 | Ga0209025_1000116 | Ga0209025_100011636 | 96 |
| 322 | 3300025294 | Ga0209025_1000839 | Ga0209025_100083928 | 96 |
| 323 | 3300025294 | Ga0209025_1047744 | Ga0209025_10477443 | 96 |
| 324 | 3300025295 | Ga0209564_1000070 | Ga0209564_1000070147 | 96 |
| 325 | 3300025295 | Ga0209564_1000155 | Ga0209564_100015536 | 96 |
| 326 | 3300025297 | Ga0209758_1000107 | Ga0209758_100010736 | 96 |
| 327 | 3300025297 | Ga0209758_1154515 | Ga0209758_11545152 | 96 |
| 328 | 3300025298 | Ga0209050_1000111 | Ga0209050_100011118 | 96 |
| 329 | 3300025298 | Ga0209050_1006050 | Ga0209050_10060505 | 96 |
| 330 | 3300025299 | Ga0209256_1000047 | Ga0209256_1000047159 | 96 |
| 331 | 3300025299 | Ga0209256_1000087 | Ga0209256_100008736 | 96 |
| 332 | 3300025302 | Ga0207426_1000123 | Ga0207426_100012336 | 96 |
| 333 | 3300025302 | Ga0207426_1000194 | Ga0207426_1000194118 | 96 |
| 334 | 3300025303 | Ga0209051_1000160 | Ga0209051_10001606 | 96 |
| 335 | 3300025303 | Ga0209051_1000340 | Ga0209051_100034052 | 96 |
| 336 | 3300025303 | Ga0209051_1020185 | Ga0209051_10201854 | 96 |
| 337 | 3300025304 | Ga0209257_1000116 | Ga0209257_1000116117 | 96 |
| 338 | 3300025304 | Ga0209257_1000690 | Ga0209257_100069018 | 96 |
| 339 | 3300025304 | Ga0209257_1001961 | Ga0209257_100196111 | 96 |
| 340 | 3300025315 | Ga0207697_10091340 | Ga0207697_100913403 | 96 |
| 341 | 3300025321 | Ga0207656_10019101 | Ga0207656_100191012 | 96 |
| 342 | 3300025321 | Ga0207656_10256222 | Ga0207656_102562222 | 96 |
| 343 | 3300025728 | Ga0207655_1005419 | Ga0207655_10054198 | 96 |
| 344 | 3300025893 | Ga0207682_10425305 | Ga0207682_104253052 | 96 |
| 345 | 3300025899 | Ga0207642_10013191 | Ga0207642_100131915 | 96 |
| 346 | 3300025903 | Ga0207680_10063631 | Ga0207680_100636315 | 96 |
| 347 | 3300025903 | Ga0207680_10364063 | Ga0207680_103640633 | 96 |
| 348 | 3300025903 | Ga0207680_10634058 | Ga0207680_106340582 | 96 |
| 349 | 3300025904 | Ga0207647_10038464 | Ga0207647_100384642 | 96 |
| 350 | 3300025906 | Ga0207699_10085202 | Ga0207699_100852022 | 96 |
| 351 | 3300025907 | Ga0207645_10000063 | Ga0207645_1000006372 | 96 |
| 352 | 3300025908 | Ga0207643_10002613 | Ga0207643_100026136 | 96 |
| 353 | 3300025910 | Ga0207684_10018108 | Ga0207684_100181084 | 96 |
| 354 | 3300025910 | Ga0207684_10067633 | Ga0207684_100676334 | 96 |
| 355 | 3300025911 | Ga0207654_10257553 | Ga0207654_102575532 | 96 |
| 356 | 3300025912 | Ga0207707_11050342 | Ga0207707_110503421 | 96 |
| 357 | 3300025913 | Ga0207695_10259573 | Ga0207695_102595732 | 96 |
| 358 | 3300025913 | Ga0207695_10738214 | Ga0207695_107382142 | 96 |
| 359 | 3300025914 | Ga0207671_11142795 | Ga0207671_111427952 | 96 |
| 360 | 3300025923 | Ga0207681_10084152 | Ga0207681_100841523 | 96 |
| 361 | 3300025923 | Ga0207681_10641298 | Ga0207681_106412982 | 96 |
| 362 | 3300025923 | Ga0207681_10900110 | Ga0207681_109001102 | 96 |
| 363 | 3300025924 | Ga0207694_10391479 | Ga0207694_103914792 | 96 |
| 364 | 3300025924 | Ga0207694_11838009 | Ga0207694_118380091 | 96 |
| 365 | 3300025926 | Ga0207659_10090098 | Ga0207659_100900982 | 96 |
| 366 | 3300025929 | Ga0207664_10136832 | Ga0207664_101368323 | 96 |
| 367 | 3300025929 | Ga0207664_10162245 | Ga0207664_101622453 | 96 |
| 368 | 3300025929 | Ga0207664_10383384 | Ga0207664_103833842 | 96 |
| 369 | 3300025931 | Ga0207644_10117927 | Ga0207644_101179274 | 96 |
| 370 | 3300025932 | Ga0207690_10044527 | Ga0207690_100445272 | 96 |
| 371 | 3300025932 | Ga0207690_11514418 | Ga0207690_115144182 | 96 |
| 372 | 3300025933 | Ga0207706_10006703 | Ga0207706_100067035 | 96 |
| 373 | 3300025933 | Ga0207706_10044723 | Ga0207706_100447235 | 96 |
| 374 | 3300025934 | Ga0207686_10821858 | Ga0207686_108218582 | 96 |
| 375 | 3300025935 | Ga0207709_10000908 | Ga0207709_100009082 | 96 |
| 376 | 3300025935 | Ga0207709_10000999 | Ga0207709_1000099927 | 96 |
| 377 | 3300025935 | Ga0207709_10441961 | Ga0207709_104419612 | 96 |
| 378 | 3300025935 | Ga0207709_11111723 | Ga0207709_111117232 | 96 |
| 379 | 3300025935 | Ga0207709_11592318 | Ga0207709_115923181 | 96 |
| 380 | 3300025936 | Ga0207670_10358409 | Ga0207670_103584092 | 96 |
| 381 | 3300025937 | Ga0207669_10642368 | Ga0207669_106423683 | 96 |
| 382 | 3300025937 | Ga0207669_11068025 | Ga0207669_110680251 | 96 |
| 383 | 3300025937 | Ga0207669_11651870 | Ga0207669_116518702 | 96 |
| 384 | 3300025938 | Ga0207704_10904676 | Ga0207704_109046762 | 96 |
| 385 | 3300025938 | Ga0207704_11456483 | Ga0207704_114564832 | 96 |
| 386 | 3300025940 | Ga0207691_10000050 | Ga0207691_10000050111 | 96 |
| 387 | 3300025940 | Ga0207691_10028829 | Ga0207691_100288292 | 96 |
| 388 | 3300025941 | Ga0207711_12050503 | Ga0207711_120505032 | 96 |
| 389 | 3300025942 | Ga0207689_10006256 | Ga0207689_100062569 | 96 |
| 390 | 3300025942 | Ga0207689_10054834 | Ga0207689_100548344 | 96 |
| 391 | 3300025942 | Ga0207689_10138695 | Ga0207689_101386954 | 96 |
| 392 | 3300025945 | Ga0207679_10382060 | Ga0207679_103820603 | 96 |
| 393 | 3300025945 | Ga0207679_11474079 | Ga0207679_114740792 | 96 |
| 394 | 3300025949 | Ga0207667_10225711 | Ga0207667_102257113 | 96 |
| 395 | 3300025949 | Ga0207667_10407289 | Ga0207667_104072893 | 96 |
| 396 | 3300025949 | Ga0207667_11933002 | Ga0207667_119330021 | 96 |
| 397 | 3300025960 | Ga0207651_10107999 | Ga0207651_101079995 | 96 |
| 398 | 3300025960 | Ga0207651_10552222 | Ga0207651_105522222 | 96 |
| 399 | 3300025960 | Ga0207651_10553457 | Ga0207651_105534572 | 96 |
| 400 | 3300025972 | Ga0207668_10008210 | Ga0207668_1000821012 | 96 |
| 401 | 3300025972 | Ga0207668_10202559 | Ga0207668_102025594 | 96 |
| 402 | 3300025972 | Ga0207668_10429781 | Ga0207668_104297811 | 96 |
| 403 | 3300025981 | Ga0207640_10095743 | Ga0207640_100957432 | 96 |
| 404 | 3300025981 | Ga0207640_10098902 | Ga0207640_100989023 | 96 |
| 405 | 3300025981 | Ga0207640_10858070 | Ga0207640_108580701 | 96 |
| 406 | 3300025986 | Ga0207658_10179543 | Ga0207658_101795432 | 96 |
| 407 | 3300025986 | Ga0207658_10873589 | Ga0207658_108735892 | 96 |
| 408 | 3300026023 | Ga0207677_10005833 | Ga0207677_100058334 | 96 |
| 409 | 3300026023 | Ga0207677_10516240 | Ga0207677_105162401 | 96 |
| 410 | 3300026035 | Ga0207703_10056601 | Ga0207703_100566013 | 96 |
| 411 | 3300026035 | Ga0207703_10401682 | Ga0207703_104016822 | 96 |
| 412 | 3300026035 | Ga0207703_10655311 | Ga0207703_106553112 | 96 |
| 413 | 3300026041 | Ga0207639_11031123 | Ga0207639_110311231 | 96 |
| 414 | 3300026067 | Ga0207678_10001056 | Ga0207678_1000105617 | 96 |
| 415 | 3300026075 | Ga0207708_10506496 | Ga0207708_105064962 | 96 |
| 416 | 3300026078 | Ga0207702_10931580 | Ga0207702_109315802 | 96 |
| 417 | 3300026088 | Ga0207641_10000209 | Ga0207641_1000020953 | 96 |
| 418 | 3300026088 | Ga0207641_10076996 | Ga0207641_100769963 | 96 |
| 419 | 3300026088 | Ga0207641_10132443 | Ga0207641_101324433 | 96 |
| 420 | 3300026088 | Ga0207641_10213791 | Ga0207641_102137912 | 96 |
| 421 | 3300026088 | Ga0207641_11294334 | Ga0207641_112943341 | 96 |
| 422 | 3300026088 | Ga0207641_12019261 | Ga0207641_120192612 | 96 |
| 423 | 3300026089 | Ga0207648_10004317 | Ga0207648_1000431720 | 96 |
| 424 | 3300026089 | Ga0207648_10179434 | Ga0207648_101794342 | 96 |
| 425 | 3300026095 | Ga0207676_10051656 | Ga0207676_100516561 | 96 |
| 426 | 3300026095 | Ga0207676_10175419 | Ga0207676_101754192 | 96 |
| 427 | 3300026116 | Ga0207674_10036499 | Ga0207674_100364992 | 96 |
| 428 | 3300026116 | Ga0207674_10045766 | Ga0207674_100457662 | 96 |
| 429 | 3300026116 | Ga0207674_10325364 | Ga0207674_103253642 | 96 |
| 430 | 3300026118 | Ga0207675_100186394 | Ga0207675_1001863943 | 96 |
| 431 | 3300026121 | Ga0207683_10000521 | Ga0207683_1000052151 | 96 |
| 432 | 3300026121 | Ga0207683_10257464 | Ga0207683_102574643 | 96 |
| 433 | 3300026121 | Ga0207683_10429045 | Ga0207683_104290451 | 96 |
| 434 | 3300026121 | Ga0207683_10606341 | Ga0207683_106063411 | 96 |
| 435 | 3300026121 | Ga0207683_11178865 | Ga0207683_111788652 | 96 |
| 436 | 3300026142 | Ga0207698_10649119 | Ga0207698_106491192 | 96 |
| 437 | 3300027665 | Ga0209983_1166647 | Ga0209983_11666471 | 96 |
| 438 | 3300027717 | Ga0209998_10203859 | Ga0209998_102038591 | 96 |
| 439 | 3300027866 | Ga0209813_10349111 | Ga0209813_103491112 | 96 |
| 440 | 3300027907 | Ga0207428_10176707 | Ga0207428_101767073 | 96 |
| 441 | 3300027907 | Ga0207428_10281367 | Ga0207428_102813672 | 96 |
| 442 | 3300027907 | Ga0207428_10358649 | Ga0207428_103586492 | 96 |
| 443 | 3300028379 | Ga0268266_10735694 | Ga0268266_107356942 | 96 |
| 444 | 3300028379 | Ga0268266_12172749 | Ga0268266_121727491 | 96 |
| 445 | 3300028380 | Ga0268265_10007450 | Ga0268265_100074506 | 96 |
| 446 | 3300028380 | Ga0268265_10144891 | Ga0268265_101448913 | 96 |
| 447 | 3300028381 | Ga0268264_10000156 | Ga0268264_10000156129 | 96 |
| 448 | 3300028381 | Ga0268264_10034834 | Ga0268264_100348342 | 96 |
| 449 | 3300028381 | Ga0268264_10040180 | Ga0268264_100401803 | 96 |
| 450 | 3300028794 | Ga0307515_10439307 | Ga0307515_104393071 | 96 |
| 451 | 3300030731 | Ga0316177_1084928 | Ga0316177_10849282 | 96 |
| 452 | 3300030732 | Ga0316176_1099510 | Ga0316176_10995103 | 96 |
| 453 | 3300030733 | Ga0314311_1080241 | Ga0314311_108024113 | 96 |
| 454 | 3300030734 | Ga0316179_1006693 | Ga0316179_10066932 | 96 |
| 455 | 3300030742 | Ga0316183_1006724 | Ga0316183_100672413 | 96 |
| 456 | 3300030744 | Ga0316181_1015734 | Ga0316181_10157343 | 96 |
| 457 | 3300030745 | Ga0316182_1257738 | Ga0316182_12577381 | 96 |
| 458 | 3300031235 | Ga0265330_10132895 | Ga0265330_101328952 | 96 |
| 459 | 3300031241 | Ga0265325_10471501 | Ga0265325_104715011 | 96 |
| 460 | 3300031247 | Ga0265340_10033047 | Ga0265340_100330472 | 96 |
| 461 | 3300031251 | Ga0265327_10000201 | Ga0265327_100002019 | 96 |
| 462 | 3300031251 | Ga0265327_10349086 | Ga0265327_103490862 | 96 |
| 463 | 3300031548 | Ga0307408_100071027 | Ga0307408_1000710272 | 96 |
| 464 | 3300031548 | Ga0307408_100255483 | Ga0307408_1002554833 | 96 |
| 465 | 3300031548 | Ga0307408_100342912 | Ga0307408_1003429123 | 96 |
| 466 | 3300031548 | Ga0307408_101492458 | Ga0307408_1014924582 | 96 |
| 467 | 3300031595 | Ga0265313_10320421 | Ga0265313_103204212 | 96 |
| 468 | 3300031616 | Ga0307508_10262257 | Ga0307508_102622572 | 96 |
| 469 | 3300031731 | Ga0307405_10050963 | Ga0307405_100509631 | 96 |
| 470 | 3300031731 | Ga0307405_10148692 | Ga0307405_101486922 | 96 |
| 471 | 3300031731 | Ga0307405_10338528 | Ga0307405_103385282 | 96 |
| 472 | 3300031731 | Ga0307405_10551271 | Ga0307405_105512712 | 96 |
| 473 | 3300031731 | Ga0307405_10651298 | Ga0307405_106512981 | 96 |
| 474 | 3300031731 | Ga0307405_11904794 | Ga0307405_119047942 | 96 |
| 475 | 3300031824 | Ga0307413_10146049 | Ga0307413_101460493 | 96 |
| 476 | 3300031824 | Ga0307413_10741604 | Ga0307413_107416041 | 96 |
| 477 | 3300031824 | Ga0307413_10898878 | Ga0307413_108988781 | 96 |
| 478 | 3300031852 | Ga0307410_10037217 | Ga0307410_100372174 | 96 |
| 479 | 3300031852 | Ga0307410_10363308 | Ga0307410_103633083 | 96 |
| 480 | 3300031903 | Ga0307407_10126527 | Ga0307407_101265272 | 96 |
| 481 | 3300031911 | Ga0307412_10026505 | Ga0307412_100265053 | 96 |
| 482 | 3300031911 | Ga0307412_10136737 | Ga0307412_101367373 | 96 |
| 483 | 3300031911 | Ga0307412_12172092 | Ga0307412_121720922 | 96 |
| 484 | 3300031995 | Ga0307409_101133016 | Ga0307409_1011330162 | 96 |
| 485 | 3300031995 | Ga0307409_102004386 | Ga0307409_1020043862 | 96 |
| 486 | 3300032002 | Ga0307416_100023276 | Ga0307416_1000232762 | 96 |
| 487 | 3300032002 | Ga0307416_100097232 | Ga0307416_1000972322 | 96 |
| 488 | 3300032004 | Ga0307414_10083717 | Ga0307414_100837174 | 96 |
| 489 | 3300032004 | Ga0307414_10453413 | Ga0307414_104534131 | 96 |
| 490 | 3300032004 | Ga0307414_12218495 | Ga0307414_122184951 | 96 |
| 491 | 3300032005 | Ga0307411_10070123 | Ga0307411_100701232 | 96 |
| 492 | 3300032005 | Ga0307411_10238595 | Ga0307411_102385952 | 96 |
| 493 | 3300032126 | Ga0307415_100031282 | Ga0307415_1000312822 | 96 |
| 494 | 3300032126 | Ga0307415_100303972 | Ga0307415_1003039723 | 96 |
| 495 | 3300033180 | Ga0307510_10121976 | Ga0307510_101219763 | 96 |
| 496 | 3300035112 | Ga0373932_0076826 | Ga0373932_0076826_509_799 | 96 |
| 497 | 3300035117 | Ga0373953_0186054 | Ga0373953_0186054_300_590 | 96 |
| 498 | 3300035118 | Ga0373954_0137075 | Ga0373954_0137075_498_788 | 96 |
| 499 | 3300035119 | Ga0373956_0066624 | Ga0373956_0066624_654_944 | 96 |
| 500 | 3300035691 | Ga0373931_0142836 | Ga0373931_0142836_646_936 | 96 |
| 501 | 3300035724 | Ga0373933_0826479 | Ga0373933_0826479_204_497 | 96 |
| 502 | 3300035725 | Ga0373947_0876770 | Ga0373947_0876770_250_540 | 96 |
| 503 | 3300036401 | Ga0373937_0090487 | Ga0373937_0090487_1315_1605 | 96 |
| 504 | 3300036401 | Ga0373937_2135776 | Ga0373937_2135776_130_420 | 96 |
| 505 | 3300039438 | Ga0436360_0282104 | Ga0436360_0282104_51_341 | 96 |
| 506 | 3300039438 | Ga0436360_1221163 | Ga0436360_1221163_98_391 | 96 |
| 507 | 3300041406 | Ga0439439_0025543 | Ga0439439_0025543_649_939 | 96 |
| 508 | 3300041407 | Ga0439447_007672 | Ga0439447_007672_205_525 | 96 |
| 509 | 3300041410 | Ga0439461_0060469 | Ga0439461_0060469_13_333 | 96 |
| 510 | 3300041411 | Ga0439466_0007112 | Ga0439466_0007112_3581_3901 | 96 |
| 511 | 3300041411 | Ga0439466_0226591 | Ga0439466_0226591_119_409 | 96 |
| 512 | 3300041413 | Ga0439465_0000026 | Ga0439465_0000026_8114_8434 | 96 |
| 513 | 3300041451 | Ga0451791_0356159 | Ga0451791_0356159_36_326 | 96 |
| 514 | 3300041453 | Ga0451797_0720147 | Ga0451797_0720147_210_500 | 96 |
| 515 | 3300041458 | Ga0451798_0431473 | Ga0451798_0431473_385_675 | 96 |
| 516 | 3300041460 | Ga0451802_0534293 | Ga0451802_0534293_137_427 | 96 |
| 517 | 3300041463 | Ga0451804_0836606 | Ga0451804_0836606_130_420 | 96 |
| 518 | 3300041509 | Ga0451843_0811403 | Ga0451843_0811403_394_687 | 96 |
| 519 | 3300041997 | Ga0439431_0000034 | Ga0439431_0000034_10330_10650 | 96 |
| 520 | 3300041999 | Ga0439433_0000067 | Ga0439433_0000067_10831_11151 | 96 |
| 521 | 3300042002 | Ga0439442_040654 | Ga0439442_040654_380_670 | 96 |
| 522 | 3300042002 | Ga0439442_143893 | Ga0439442_143893_185_505 | 96 |
| 523 | 3300042004 | Ga0439445_0000146 | Ga0439445_0000146_6532_6852 | 96 |
| 524 | 3300042005 | Ga0439448_0345253 | Ga0439448_0345253_180_473 | 96 |
| 525 | 3300042006 | Ga0439432_000206 | Ga0439432_000206_12128_12448 | 96 |
| 526 | 3300042006 | Ga0439432_023763 | Ga0439432_023763_607_897 | 96 |
| 527 | 3300042007 | Ga0439449_0000276 | Ga0439449_0000276_6294_6614 | 96 |
| 528 | 3300042010 | Ga0439452_000641 | Ga0439452_000641_6394_6714 | 96 |
| 529 | 3300042014 | Ga0439457_007265 | Ga0439457_007265_1273_1593 | 96 |
| 530 | 3300042015 | Ga0439462_0001588 | Ga0439462_0001588_1361_1681 | 96 |
| 531 | 3300042127 | Ga0450890_029398 | Ga0450890_029398_270_590 | 96 |
| 532 | 3300042156 | Ga0439446_0016088 | Ga0439446_0016088_1077_1397 | 96 |
| 533 | 3300042184 | Ga0450908_068025 | Ga0450908_068025_35_325 | 96 |
| 534 | 3300042184 | Ga0450908_105298 | Ga0450908_105298_132_422 | 96 |
| 535 | 3300042435 | Ga0439434_0000300 | Ga0439434_0000300_8100_8420 | 96 |
| 536 | 3300042461 | Ga0439460_0113670 | Ga0439460_0113670_192_485 | 96 |
| 537 | 3300042876 | Ga0451577_0246794 | Ga0451577_0246794_263_553 | 96 |
| 538 | 3300042876 | Ga0451577_0802576 | Ga0451577_0802576_532_825 | 96 |
| 539 | 3300044673 | Ga0453683_0237426 | Ga0453683_0237426_758_1051 | 96 |
| 540 | 3300044684 | Ga0466966_0038431 | Ga0466966_0038431_219_512 | 96 |
| 541 | 3300044712 | Ga0453684_0809694 | Ga0453684_0809694_270_563 | 96 |
| 542 | 3300045049 | Ga0466959_0361590 | Ga0466959_0361590_16_309 | 96 |
| 543 | 3300045051 | Ga0451576_0070615 | Ga0451576_0070615_1126_1416 | 96 |
| 544 | 3300045836 | Ga0466958_0220832 | Ga0466958_0220832_700_993 | 96 |
| 545 | 3300046453 | Ga0495627_053601 | Ga0495627_053601_332_694 | 96 |
| 546 | 3300046460 | Ga0495638_0024101 | Ga0495638_0024101_3546_3836 | 96 |
| 547 | 3300046462 | Ga0495651_0023107 | Ga0495651_0023107_3863_4153 | 96 |
| 548 | 3300046462 | Ga0495651_0150536 | Ga0495651_0150536_1030_1320 | 96 |
| 549 | 3300046462 | Ga0495651_0333253 | Ga0495651_0333253_20_310 | 96 |
| 550 | 3300046463 | Ga0495653_0535951 | Ga0495653_0535951_391_681 | 96 |
| 551 | 3300046472 | Ga0495580_0000672 | Ga0495580_0000672_27594_27884 | 96 |
| 552 | 3300046475 | Ga0495639_0011620 | Ga0495639_0011620_3461_3751 | 96 |
| 553 | 3300046512 | Ga0495610_0181380 | Ga0495610_0181380_399_689 | 96 |
| 554 | 3300046513 | Ga0495616_0002482 | Ga0495616_0002482_5096_5386 | 96 |
| 555 | 3300046516 | Ga0495628_0589734 | Ga0495628_0589734_195_485 | 96 |
| 556 | 3300046517 | Ga0495630_0262677 | Ga0495630_0262677_572_862 | 96 |
| 557 | 3300046518 | Ga0495631_0000067 | Ga0495631_0000067_24633_24923 | 96 |
| 558 | 3300046520 | Ga0495637_0035666 | Ga0495637_0035666_1578_1868 | 96 |
| 559 | 3300046520 | Ga0495637_0189766 | Ga0495637_0189766_106_396 | 96 |
| 560 | 3300046525 | Ga0495663_0034282 | Ga0495663_0034282_930_1220 | 96 |
| 561 | 3300046525 | Ga0495663_0315357 | Ga0495663_0315357_21_311 | 96 |
| 562 | 3300046530 | Ga0495654_0269455 | Ga0495654_0269455_70_360 | 96 |
| 563 | 3300046533 | Ga0495640_0332975 | Ga0495640_0332975_339_629 | 96 |
| 564 | 3300046536 | Ga0495587_0399485 | Ga0495587_0399485_354_644 | 96 |
| 565 | 3300046537 | Ga0495598_0051908 | Ga0495598_0051908_145_435 | 96 |
| 566 | 3300046539 | Ga0495621_0001559 | Ga0495621_0001559_5531_5821 | 96 |
| 567 | 3300046539 | Ga0495621_0049535 | Ga0495621_0049535_912_1202 | 96 |
| 568 | 3300046543 | Ga0495645_0864662 | Ga0495645_0864662_58_348 | 96 |
| 569 | 3300046557 | Ga0495622_0081789 | Ga0495622_0081789_252_542 | 96 |
| 570 | 3300046557 | Ga0495622_0179473 | Ga0495622_0179473_610_900 | 96 |
| 571 | 3300046615 | Ga0495656_0013202 | Ga0495656_0013202_2283_2573 | 96 |
| 572 | 3300046615 | Ga0495656_0168454 | Ga0495656_0168454_302_592 | 96 |
| 573 | 3300046616 | Ga0495668_0026483 | Ga0495668_0026483_2431_2721 | 96 |
| 574 | 3300046660 | Ga0495625_0028048 | Ga0495625_0028048_1704_1994 | 96 |
| 575 | 3300046663 | Ga0495635_0213555 | Ga0495635_0213555_766_1056 | 96 |
| 576 | 3300046663 | Ga0495635_0571414 | Ga0495635_0571414_138_428 | 96 |
| 577 | 3300046674 | Ga0495588_0021323 | Ga0495588_0021323_1193_1483 | 96 |
| 578 | 3300046678 | Ga0495599_0218190 | Ga0495599_0218190_31_321 | 96 |
| 579 | 3300046678 | Ga0495599_0357989 | Ga0495599_0357989_151_441 | 96 |
| 580 | 3300046689 | Ga0495613_0811042 | Ga0495613_0811042_82_372 | 96 |
| 581 | 3300046690 | Ga0495624_0283854 | Ga0495624_0283854_434_724 | 96 |
| 582 | 3300046691 | Ga0495670_0207703 | Ga0495670_0207703_478_768 | 96 |
| 583 | 3300046809 | Ga0495600_0105196 | Ga0495600_0105196_207_497 | 96 |
| 584 | 3300046809 | Ga0495600_0488630 | Ga0495600_0488630_119_409 | 96 |
| 585 | 3300047320 | Ga0495672_0159662 | Ga0495672_0159662_424_786 | 96 |
| 586 | 3300047321 | Ga0495676_0066940 | Ga0495676_0066940_2404_2694 | 96 |
| 587 | 3300047321 | Ga0495676_0774580 | Ga0495676_0774580_88_378 | 96 |
| 588 | 3300047447 | Ga0495685_225916 | Ga0495685_225916_226_516 | 96 |
| 589 | 3300047673 | Ga0495593_0064869 | Ga0495593_0064869_173_463 | 96 |
| 590 | 3300048088 | Ga0495602_0087988 | Ga0495602_0087988_233_523 | 96 |
| 591 | 3300048088 | Ga0495602_0379564 | Ga0495602_0379564_496_786 | 96 |
| 592 | 3300048089 | Ga0495614_0021458 | Ga0495614_0021458_942_1232 | 96 |
| 593 | 3300048089 | Ga0495614_0532699 | Ga0495614_0532699_227_517 | 96 |
| 594 | 3300048090 | Ga0495615_0027097 | Ga0495615_0027097_233_523 | 96 |
| 595 | 3300048903 | Ga0496100_1555572 | Ga0496100_1555572_161_451 | 96 |
| 596 | 3300048904 | Ga0496101_0001086 | Ga0496101_0001086_6306_6596 | 96 |
| 597 | 3300048905 | Ga0496102_0042589 | Ga0496102_0042589_3656_3946 | 96 |
| 598 | 3300048905 | Ga0496102_0265668 | Ga0496102_0265668_141_431 | 96 |
| 599 | 3300048907 | Ga0496104_0005610 | Ga0496104_0005610_3035_3325 | 96 |
| 600 | 3300048908 | Ga0496105_0001424 | Ga0496105_0001424_8991_9281 | 96 |
| 601 | 3300048908 | Ga0496105_0702357 | Ga0496105_0702357_467_757 | 96 |
| 602 | 3300048908 | Ga0496105_1044442 | Ga0496105_1044442_157_447 | 96 |
| 603 | 3300048909 | Ga0496106_1142782 | Ga0496106_1142782_62_352 | 96 |
| 604 | 3300048911 | Ga0496108_0095496 | Ga0496108_0095496_59_349 | 96 |
| 605 | 3300048912 | Ga0496109_0107726 | Ga0496109_0107726_97_387 | 96 |
| 606 | 3300048912 | Ga0496109_0115216 | Ga0496109_0115216_2138_2428 | 96 |
| 607 | 3300048913 | Ga0496110_0002674 | Ga0496110_0002674_9926_10216 | 96 |
| 608 | 3300048913 | Ga0496110_0007149 | Ga0496110_0007149_4586_4876 | 96 |
| 609 | 3300048914 | Ga0496111_0064162 | Ga0496111_0064162_1606_1896 | 96 |
| 610 | 3300048914 | Ga0496111_0965973 | Ga0496111_0965973_163_453 | 96 |
| 611 | 3300048916 | Ga0496113_0434686 | Ga0496113_0434686_421_711 | 96 |
| 612 | 3300048917 | Ga0496114_0220098 | Ga0496114_0220098_727_1017 | 96 |
| 613 | 3300048917 | Ga0496114_0747687 | Ga0496114_0747687_540_830 | 96 |
| 614 | 3300048918 | Ga0496115_0496142 | Ga0496115_0496142_453_743 | 96 |
| 615 | 3300048919 | Ga0496116_0068756 | Ga0496116_0068756_445_735 | 96 |
| 616 | 3300048920 | Ga0496117_0036021 | Ga0496117_0036021_1340_1630 | 96 |
| 617 | 3300048921 | Ga0496118_0007548 | Ga0496118_0007548_4610_4900 | 96 |
| 618 | 3300048921 | Ga0496118_0361559 | Ga0496118_0361559_128_418 | 96 |
| 619 | 3300048921 | Ga0496118_0437111 | Ga0496118_0437111_61_351 | 96 |
| 620 | 3300048922 | Ga0496119_0007290 | Ga0496119_0007290_5508_5798 | 96 |
| 621 | 3300048922 | Ga0496119_0163193 | Ga0496119_0163193_618_908 | 96 |
| 622 | 3300048923 | Ga0496120_0113633 | Ga0496120_0113633_593_883 | 96 |
| 623 | 3300048924 | Ga0496121_0056893 | Ga0496121_0056893_615_905 | 96 |
| 624 | 3300048924 | Ga0496121_0078212 | Ga0496121_0078212_605_1054 | 96 |
| 625 | 3300048924 | Ga0496121_0271151 | Ga0496121_0271151_616_906 | 96 |
| 626 | 3300048924 | Ga0496121_0687756 | Ga0496121_0687756_92_382 | 96 |
| 627 | 3300048925 | Ga0496122_0001985 | Ga0496122_0001985_27680_27970 | 96 |
| 628 | 3300048925 | Ga0496122_0007594 | Ga0496122_0007594_3071_3433 | 96 |
| 629 | 3300048925 | Ga0496122_0050320 | Ga0496122_0050320_2322_2612 | 96 |
| 630 | 3300048925 | Ga0496122_0188718 | Ga0496122_0188718_671_961 | 96 |
| 631 | 3300048926 | Ga0496123_0011920 | Ga0496123_0011920_2464_2754 | 96 |
| 632 | 3300048926 | Ga0496123_0013891 | Ga0496123_0013891_894_1184 | 96 |
| 633 | 3300048926 | Ga0496123_0127542 | Ga0496123_0127542_309_599 | 96 |
| 634 | 3300048927 | Ga0496124_0004029 | Ga0496124_0004029_1362_1652 | 96 |
| 635 | 3300048927 | Ga0496124_0020609 | Ga0496124_0020609_2911_3216 | 96 |
| 636 | 3300048928 | Ga0496125_0020118 | Ga0496125_0020118_3608_3898 | 96 |
| 637 | 3300048928 | Ga0496125_0525422 | Ga0496125_0525422_261_551 | 96 |
| 638 | 3300049571 | Ga0501034_0290922 | Ga0501034_0290922_1216_1506 | 96 |
| 639 | 3300049575 | Ga0501039_0426431 | Ga0501039_0426431_373_666 | 96 |
| 640 | 3300049575 | Ga0501039_0627896 | Ga0501039_0627896_467_760 | 96 |
| 641 | 3300049580 | Ga0501046_1236081 | Ga0501046_1236081_116_409 | 96 |
| 642 | 3300049587 | Ga0501071_1310056 | Ga0501071_1310056_175_468 | 96 |
| 643 | 3300049588 | Ga0501072_0114790 | Ga0501072_0114790_1272_1565 | 96 |
| 644 | 3300049591 | Ga0501075_1018021 | Ga0501075_1018021_166_459 | 96 |
| 645 | 3300049592 | Ga0501076_0107024 | Ga0501076_0107024_1882_2175 | 96 |
| 646 | 3300049592 | Ga0501076_0442989 | Ga0501076_0442989_74_367 | 96 |
| 647 | 3300049592 | Ga0501076_0555452 | Ga0501076_0555452_318_611 | 96 |
| 648 | 3300049665 | Ga0501227_157031 | Ga0501227_157031_160_450 | 96 |
| 649 | 3300049671 | Ga0501238_012789 | Ga0501238_012789_376_666 | 96 |
| 650 | 3300049743 | Ga0501081_0333953 | Ga0501081_0333953_145_441 | 96 |
| 651 | 3300049744 | Ga0501083_0561696 | Ga0501083_0561696_266_556 | 96 |
| 652 | 3300049758 | Ga0501241_098697 | Ga0501241_098697_212_502 | 96 |
| 653 | 3300050489 | nmdc:mga03683_307380_c1 | nmdc:mga03683_307380_c1_105_395 | 96 |
| 654 | 3300050490 | nmdc:mga03n38_15066_c1 | nmdc:mga03n38_15066_c1_525_815 | 96 |
| 655 | 3300050490 | nmdc:mga03n38_88249_c1 | nmdc:mga03n38_88249_c1_1053_1343 | 96 |
| 656 | 3300050491 | nmdc:mga00v17_13311_c1 | nmdc:mga00v17_13311_c1_232_522 | 96 |
| 657 | 3300050491 | nmdc:mga00v17_462008_c1 | nmdc:mga00v17_462008_c1_45_335 | 96 |
| 658 | 3300050492 | nmdc:mga0yw44_1462_c1 | nmdc:mga0yw44_1462_c1_8019_8309 | 96 |
| 659 | 3300050493 | nmdc:mga0k408_117191_c1 | nmdc:mga0k408_117191_c1_61_351 | 96 |
| 660 | 3300050493 | nmdc:mga0k408_256707_c1 | nmdc:mga0k408_256707_c1_417_707 | 96 |
| 661 | 3300050493 | nmdc:mga0k408_3020_c1 | nmdc:mga0k408_3020_c1_4915_5205 | 96 |
| 662 | 3300050493 | nmdc:mga0k408_373780_c1 | nmdc:mga0k408_373780_c1_522_812 | 96 |
| 663 | 3300050494 | nmdc:mga06z11_222786_c1 | nmdc:mga06z11_222786_c1_355_645 | 96 |
| 664 | 3300050494 | nmdc:mga06z11_299145_c1 | nmdc:mga06z11_299145_c1_263_553 | 96 |
| 665 | 3300050494 | nmdc:mga06z11_43894_c1 | nmdc:mga06z11_43894_c1_474_764 | 96 |
| 666 | 3300050494 | nmdc:mga06z11_732382_c1 | nmdc:mga06z11_732382_c1_216_506 | 96 |
| 667 | 3300050496 | nmdc:mga07m45_107421_c1 | nmdc:mga07m45_107421_c1_819_1109 | 96 |
| 668 | 3300050496 | nmdc:mga07m45_10975_c1 | nmdc:mga07m45_10975_c1_73_363 | 96 |
| 669 | 3300050496 | nmdc:mga07m45_3692_c2 | nmdc:mga07m45_3692_c2_1429_1719 | 96 |
| 670 | 3300050496 | nmdc:mga07m45_61979_c1 | nmdc:mga07m45_61979_c1_873_1163 | 96 |
| 671 | 3300050496 | nmdc:mga07m45_7175_c1 | nmdc:mga07m45_7175_c1_4940_5230 | 96 |
| 672 | 3300050496 | nmdc:mga07m45_809909_c1 | nmdc:mga07m45_809909_c1_150_440 | 96 |
| 673 | 3300050507 | nmdc:mga05p37_1075729_c1 | nmdc:mga05p37_1075729_c1_324_617 | 96 |
| 674 | 3300050507 | nmdc:mga05p37_515_c1 | nmdc:mga05p37_515_c1_12366_12659 | 96 |
| 675 | 3300050508 | nmdc:mga09592_100270_c1 | nmdc:mga09592_100270_c1_449_742 | 96 |
| 676 | 3300050509 | nmdc:mga0qj67_274983_c1 | nmdc:mga0qj67_274983_c1_340_639 | 96 |
| 677 | 3300050509 | nmdc:mga0qj67_32999_c1 | nmdc:mga0qj67_32999_c1_1551_1844 | 96 |
| 678 | 3300050510 | nmdc:mga06r32_1360753_c1 | nmdc:mga06r32_1360753_c1_44_337 | 96 |
| 679 | 3300050510 | nmdc:mga06r32_27384_c1 | nmdc:mga06r32_27384_c1_3854_4150 | 96 |
| 680 | 3300050510 | nmdc:mga06r32_28_c1 | nmdc:mga06r32_28_c1_19716_20009 | 96 |
| 681 | 3300050510 | nmdc:mga06r32_460826_c1 | nmdc:mga06r32_460826_c1_236_544 | 96 |
| 682 | 3300050511 | nmdc:mga08y16_124_c2 | nmdc:mga08y16_124_c2_29667_29960 | 96 |
| 683 | 3300050511 | nmdc:mga08y16_31708_c1 | nmdc:mga08y16_31708_c1_2024_2323 | 96 |
| 684 | 3300050512 | nmdc:mga0n895_12706_c1 | nmdc:mga0n895_12706_c1_1328_1618 | 96 |
| 685 | 3300050512 | nmdc:mga0n895_32298_c1 | nmdc:mga0n895_32298_c1_1146_1436 | 96 |
| 686 | 3300050512 | nmdc:mga0n895_84346_c1 | nmdc:mga0n895_84346_c1_2637_2927 | 96 |
| 687 | 3300050513 | nmdc:mga0rr50_184085_c1 | nmdc:mga0rr50_184085_c1_1384_1674 | 96 |
| 688 | 3300050513 | nmdc:mga0rr50_64150_c1 | nmdc:mga0rr50_64150_c1_1597_1887 | 96 |
| 689 | 3300050513 | nmdc:mga0rr50_803324_c1 | nmdc:mga0rr50_803324_c1_337_627 | 96 |
| 690 | 3300050514 | nmdc:mga08x19_349404_c1 | nmdc:mga08x19_349404_c1_233_526 | 96 |
| 691 | 3300050515 | nmdc:mga0a205_152492_c1 | nmdc:mga0a205_152492_c1_147_437 | 96 |
| 692 | 3300050516 | nmdc:mga0sz30_478830_c1 | nmdc:mga0sz30_478830_c1_216_506 | 96 |
| 693 | 3300050516 | nmdc:mga0sz30_61358_c1 | nmdc:mga0sz30_61358_c1_1033_1326 | 96 |
| 694 | 3300053079 | Ga0500610_0005809 | Ga0500610_0005809_926_1216 | 96 |
| 695 | 3300053087 | Ga0500643_002697 | Ga0500643_002697_2425_2715 | 96 |
| 696 | 3300053093 | Ga0500651_0000040 | Ga0500651_0000040_22820_23110 | 96 |
| 697 | 3300053094 | Ga0500566_0030418 | Ga0500566_0030418_1153_1443 | 96 |
| 698 | 3300053096 | Ga0500641_0020396 | Ga0500641_0020396_602_892 | 96 |
| 699 | 3300053107 | Ga0500560_202416 | Ga0500560_202416_297_587 | 96 |
| 700 | 3300053108 | Ga0500562_003280 | Ga0500562_003280_3556_3846 | 96 |
| 701 | 3300053110 | Ga0500571_000361 | Ga0500571_000361_6391_6681 | 96 |
| 702 | 3300053111 | Ga0500572_040610 | Ga0500572_040610_923_1213 | 96 |
| 703 | 3300053118 | Ga0500594_0005565 | Ga0500594_0005565_2238_2528 | 96 |
| 704 | 3300053120 | Ga0500597_131211 | Ga0500597_131211_654_944 | 96 |
| 705 | 3300053122 | Ga0500608_013301 | Ga0500608_013301_2281_2571 | 96 |
| 706 | 3300053125 | Ga0500618_096093 | Ga0500618_096093_356_646 | 96 |
| 707 | 3300053128 | Ga0500626_026523 | Ga0500626_026523_654_944 | 96 |
| 708 | 3300053133 | Ga0500655_000193 | Ga0500655_000193_3281_3571 | 96 |
| 709 | 3300053134 | Ga0500658_0000095 | Ga0500658_0000095_22116_22406 | 96 |
| 710 | 3300053134 | Ga0500658_0000122 | Ga0500658_0000122_21064_21354 | 96 |
| 711 | 3300053136 | Ga0500559_0004405 | Ga0500559_0004405_4738_5028 | 96 |
| 712 | 3300053138 | Ga0500564_023889 | Ga0500564_023889_1392_1682 | 96 |
| 713 | 3300053139 | Ga0500568_0000569 | Ga0500568_0000569_9959_10249 | 96 |
| 714 | 3300053140 | Ga0500573_0212992 | Ga0500573_0212992_136_426 | 96 |
| 715 | 3300053141 | Ga0500574_002739 | Ga0500574_002739_2610_2900 | 96 |
| 716 | 3300053141 | Ga0500574_003374 | Ga0500574_003374_1975_2265 | 96 |
| 717 | 3300053151 | Ga0500604_0154337 | Ga0500604_0154337_319_609 | 96 |
| 718 | 3300053153 | Ga0500616_0308902 | Ga0500616_0308902_345_635 | 96 |
| 719 | 3300053154 | Ga0500619_241441 | Ga0500619_241441_189_479 | 96 |
| 720 | 3300053157 | Ga0500624_018686 | Ga0500624_018686_210_500 | 96 |
| 721 | 3300053161 | Ga0500634_0000914 | Ga0500634_0000914_2320_2610 | 96 |
| 722 | 3300053162 | Ga0500638_056159 | Ga0500638_056159_1328_1618 | 96 |
| 723 | 3300053177 | Ga0500636_0023537 | Ga0500636_0023537_1377_1667 | 96 |
| 724 | 3300053734 | Ga0500565_040940 | Ga0500565_040940_329_619 | 96 |
| 725 | iso_pu_bacteria | 2885192300 | 2885195675 | 96 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2fiu-assembly1.cif.gz_B | crystal structure of the conserved protein of unknown function atu0297 from agrobacterium tumefaciens | 0.9382 | 1 | 96 |
| 3lo3-assembly2.cif.gz_C | the crystal structure of a conserved functionally unknown protein from colwellia psychrerythraea 34h. | 0.9012 | 3 | 93 |
| 3lo3-assembly2.cif.gz_C | the crystal structure of a conserved functionally unknown protein from colwellia psychrerythraea 34h. | 0.8571 | 3 | 93 |
| 3hhl-assembly2.cif.gz_C | crystal structure of methylated rpa0582 protein | 0.7663 | 2 | 96 |
| 3dca-assembly2.cif.gz_D | crystal structure of the rpa0582- protein of unknown function from rhodopseudomonas palustris- a structural genomics target | 0.7543 | 2 | 96 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2fiuB00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9034 | 3 | 96 | 3.30.70.100 |
| 3lo3U00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.8832 | 3 | 93 | 3.30.70.100 |
| 2fiuB00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.8763 | 3 | 96 | 3.30.70.100 |
| 3lo3U00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.8402 | 3 | 93 | 3.30.70.100 |
| af_Q54CJ9_3_103_3.30.70.100 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.7379 | 1 | 94 | 3.30.70.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6J4NLL1-F1-model_v4 | DUF1330 domain-containing protein | 1.001 | 3 | 96 |
|
| AF-A0A537FW42-F1-model_v4 | DUF1330 domain-containing protein | 0.9992 | 1 | 96 |
|
| AF-A0A7Y9J7Z7-F1-model_v4 | Uncharacterized protein (DUF1330 family) | 0.9936 | 3 | 96 |
|
| AF-A0A6J4H4X6-F1-model_v4 | DUF1330 domain-containing protein | 0.9929 | 1 | 96 |
|
| AF-A0A6M4FJN2-F1-model_v4 | DUF1330 domain-containing protein | 0.9905 | 1 | 96 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar