F477629

General Info

Members Datasets Scaffolds Average Seq Length
725 395 724 97

Family's Representative Sequence

Representative Sequence 3300046453|Ga0495627_053601|Ga0495627_053601_332_694
Length 120
Sequence MGANGFAECSRALYCSFNNTREITMAKAYWVSAYRAVKDADKLAAYAKLAGPAITAGGGRFLARGLPAKTYEFGLTERTVLIEFDSVEQATATHDSPDYKAALAALGDGAERDLRIIEGV

Samples

Sample ID Description Type Environment
1 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
12 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
13 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
14 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
15 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
16 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
17 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
18 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
19 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
20 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
21 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
22 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
23 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
24 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
25 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
30 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
31 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
32 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
33 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
34 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
35 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
36 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
37 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
38 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
39 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
40 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
41 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
42 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
43 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
44 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
45 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
46 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
47 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
48 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
49 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
50 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
51 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
52 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
53 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
54 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
55 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
56 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
57 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
58 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
59 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
60 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
61 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
62 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
63 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
64 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
65 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
66 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
67 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
68 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
69 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
70 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
71 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
72 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
73 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
74 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
75 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
76 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
77 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
78 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
79 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
80 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
81 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
82 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
83 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
84 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
85 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
86 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
87 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
88 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
89 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
90 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
91 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
92 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
93 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
95 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
96 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
97 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
98 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
99 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
100 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
101 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
103 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
104 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
106 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
108 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
109 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
110 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
111 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
112 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
113 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
114 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
115 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
116 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
117 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
118 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
119 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
120 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
121 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
122 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
123 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
124 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
125 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
126 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
127 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
128 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
129 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
130 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
131 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
132 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
133 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
134 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
135 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
139 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
141 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
144 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
145 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
147 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
148 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
149 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
151 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
152 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
206 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
207 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
211 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
212 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
213 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
214 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
215 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
216 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
217 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
218 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
219 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
220 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
221 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
222 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
223 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
224 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
225 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
226 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
227 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
228 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
229 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
230 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
231 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
232 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
233 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
234 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
235 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
236 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
237 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
238 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
239 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
240 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
241 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
242 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
243 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
244 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
245 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
246 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
247 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
248 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
249 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
250 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
251 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
252 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
253 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
254 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
255 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
256 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
257 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
258 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
259 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
260 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
261 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
262 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
263 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
264 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
265 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
266 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
267 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
268 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
269 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
270 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
271 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
272 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
273 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
274 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
275 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
276 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
277 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
278 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
279 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
280 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
281 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
282 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
283 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
284 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
285 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
286 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
287 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
288 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
289 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
290 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
291 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
292 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
293 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
294 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
295 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
296 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
297 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
298 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
299 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
300 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
301 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
302 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
303 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
304 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
305 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
306 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
307 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
308 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
309 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
310 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
311 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
312 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
313 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
314 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
315 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
316 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
317 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
318 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
319 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
320 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
321 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
322 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
323 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
324 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
325 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
326 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
327 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
328 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
329 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
330 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
331 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
332 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
333 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
334 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
335 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
336 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
337 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
338 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
339 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
342 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
343 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
344 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
345 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
346 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
347 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
348 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
349 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
350 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
351 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
352 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
353 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
354 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
355 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
356 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
357 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
358 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
359 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
360 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
361 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
362 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
363 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
364 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
365 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
366 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
367 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
368 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
369 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
370 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
371 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
372 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
373 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
374 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
375 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
376 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
377 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
378 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
379 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
380 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
381 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
382 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
383 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
384 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
385 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
386 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
387 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
388 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
389 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
390 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
391 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
392 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
393 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
394 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
395 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.86
Metatranscriptomes 0
Isolates 0.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.52
Nodule 0
Rhizoplane 3.45
Rhizosphere 70.76
Stem 0
Stem Tuber 0
Unclassified 4.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1003553 3300002773 Bacteria 5274
2 JGI25152J39213_1008447 3300002773 Bacteria 2556
3 JGI25150J39212_1000529 3300002774 Bacteria 15578
4 JGI25159J45721_1000714 3300002987 Bacteria 14510
5 JGI25159J45721_1004054 3300002987 Bacteria 4979
6 JGI25151J46595_10000648 3300003187 Bacteria 29621
7 JGI25151J46595_10001672 3300003187 Bacteria 14533
8 JGI25151J46595_10001768 3300003187 Bacteria 13990
9 JGI25151J46595_10010051 3300003187 Bacteria 4432
10 JGI25153J46596_10001378 3300003215 Bacteria 14533
11 rootH2_10084863 3300003320 Bacteria 1805
12 rootL2_10335959 3300003322 Bacteria 1330
13 rootH1_10021926 3300003323 Bacteria 3942
14 rootH1_10122036 3300003323 Bacteria 1429
15 JGI25160J50197_1001019 3300003354 Bacteria 14510
16 JGI25160J50197_1005287 3300003354 Bacteria 5400
17 JGI25161J50226_1001734 3300003374 Bacteria 6170
18 JGI25161J50226_1002393 3300003374 Bacteria 4829
19 JGI25161J50226_1003095 3300003374 Bacteria 3967
20 Ga0055527_1009080 3300003760 Bacteria 1174
21 Ga0055535_1000827 3300003761 Bacteria 22215
22 Ga0055542_1000103 3300003762 Bacteria 114989
23 Ga0055526_1001885 3300003771 Bacteria 14533
24 Ga0055526_1010803 3300003771 Bacteria 4200
25 Ga0055537_1000532 3300003773 Bacteria 22142
26 Ga0055524_1001312 3300003775 Bacteria 14533
27 Ga0055536_1000559 3300003781 Bacteria 25395
28 Ga0055536_1081886 3300003781 Bacteria 611
29 Ga0055534_1000806 3300003784 Bacteria 14533
30 Ga0055534_1004180 3300003784 Bacteria 4259
31 Ga0055528_1000780 3300003790 Bacteria 22142
32 Ga0055530_10000342 3300003791 Bacteria 42139
33 Ga0055530_10012129 3300003791 Bacteria 3030
34 Ga0055540_1001460 3300003792 Bacteria 14092
35 Ga0055540_1001885 3300003792 Bacteria 11758
36 Ga0055540_1012669 3300003792 Bacteria 2629
37 Ga0055531_10000628 3300003794 Bacteria 30386
38 Ga0055531_10002126 3300003794 Bacteria 13587
39 Ga0055531_10002147 3300003794 Bacteria 13476
40 Ga0055531_10011100 3300003794 Bacteria 4393
41 Ga0055543_1000702 3300004625 Bacteria 17034
42 Ga0055543_1000769 3300004625 Bacteria 15968
43 Ga0065165_1002519 3300005262 Bacteria 15255
44 Ga0065165_1002602 3300005262 Bacteria 14777
45 Ga0070658_10143979 3300005327 Bacteria 1992
46 Ga0070690_100331648 3300005330 Bacteria 1099
47 Ga0070670_100581499 3300005331 Bacteria 1001
48 Ga0070670_100618278 3300005331 Unclassified 970
49 Ga0068869_100055545 3300005334 Bacteria 2886
50 Ga0068869_100058931 3300005334 Bacteria 2809
51 Ga0068869_100252172 3300005334 Bacteria 1410
52 Ga0068869_100479292 3300005334 Bacteria 1036
53 Ga0068869_100490495 3300005334 Unclassified 1024
54 Ga0068869_100709691 3300005334 Unclassified 858
55 Ga0070666_10007871 3300005335 Bacteria 6583
56 Ga0070680_101747640 3300005336 Bacteria 539
57 Ga0070682_100577459 3300005337 Unclassified 884
58 Ga0068868_100002109 3300005338 Bacteria 13696
59 Ga0068868_100139682 3300005338 Bacteria 1988
60 Ga0070660_100557997 3300005339 Bacteria 956
61 Ga0070689_100362657 3300005340 Unclassified 1218
62 Ga0070689_101558577 3300005340 Bacteria 599
63 Ga0070689_101721177 3300005340 Unclassified 571
64 Ga0070691_10394681 3300005341 Unclassified 778
65 Ga0070661_100409418 3300005344 Bacteria 1073
66 Ga0070668_100005152 3300005347 Bacteria 9692
67 Ga0070668_100176210 3300005347 Unclassified 1744
68 Ga0070668_100192504 3300005347 Bacteria 1671
69 Ga0070668_101295069 3300005347 Unclassified 662
70 Ga0070669_100100404 3300005353 Bacteria 2182
71 Ga0070669_100100504 3300005353 Bacteria 2181
72 Ga0070669_100279142 3300005353 Bacteria 1338
73 Ga0070669_100838909 3300005353 Unclassified 783
74 Ga0070675_100000542 3300005354 Bacteria 25851
75 Ga0070675_102019558 3300005354 Unclassified 532
76 Ga0070671_100002141 3300005355 Bacteria 15246
77 Ga0070674_100000170 3300005356 Bacteria 30382
78 Ga0070674_100239961 3300005356 Bacteria 1418
79 Ga0070673_100000311 3300005364 Bacteria 25555
80 Ga0070673_100218080 3300005364 Bacteria 1650
81 Ga0070673_100347493 3300005364 Bacteria 1316
82 Ga0070688_100911765 3300005365 Unclassified 694
83 Ga0070659_100061334 3300005366 Bacteria 2972
84 Ga0070659_100132504 3300005366 Bacteria 2025
85 Ga0070667_100049914 3300005367 Bacteria 3525
86 Ga0070667_100063297 3300005367 Bacteria 3134
87 Ga0070667_100461459 3300005367 Bacteria 1161
88 Ga0070667_100561586 3300005367 Bacteria 1050
89 Ga0070667_101064602 3300005367 Bacteria 755
90 Ga0070667_101164662 3300005367 Bacteria 721
91 Ga0070709_10335666 3300005434 Bacteria 1113
92 Ga0070714_100642970 3300005435 Unclassified 1021
93 Ga0070713_102258684 3300005436 Bacteria 527
94 Ga0070705_100435481 3300005440 Bacteria 980
95 Ga0070700_100615715 3300005441 Unclassified 853
96 Ga0070694_100259431 3300005444 Bacteria 1318
97 Ga0070694_100498130 3300005444 Bacteria 969
98 Ga0070694_101733375 3300005444 Unclassified 532
99 Ga0070708_100181974 3300005445 Bacteria 1965
100 Ga0070708_101251544 3300005445 Bacteria 694
101 Ga0070678_100091899 3300005456 Bacteria 2330
102 Ga0070678_100382776 3300005456 Bacteria 1218
103 Ga0070678_101977108 3300005456 Bacteria 551
104 Ga0070662_100014668 3300005457 Bacteria 5236
105 Ga0070662_100201575 3300005457 Bacteria 1579
106 Ga0070662_100472456 3300005457 Bacteria 1043
107 Ga0068867_100001800 3300005459 Bacteria 14908
108 Ga0068867_100262927 3300005459 Bacteria 1407
109 Ga0070706_100075353 3300005467 Bacteria 3122
110 Ga0070706_100848951 3300005467 Unclassified 844
111 Ga0070706_102147263 3300005467 Bacteria 504
112 Ga0070707_100939480 3300005468 Unclassified 830
113 Ga0070698_100709024 3300005471 Bacteria 948
114 Ga0070699_100067054 3300005518 Bacteria 3116
115 Ga0070699_100158743 3300005518 Bacteria 2001
116 Ga0070697_100019668 3300005536 Bacteria 5334
117 Ga0070697_100377459 3300005536 Unclassified 1227
118 Ga0068853_102033145 3300005539 Bacteria 557
119 Ga0070672_100667480 3300005543 Bacteria 909
120 Ga0070672_101025453 3300005543 Bacteria 732
121 Ga0070686_100084298 3300005544 Bacteria 2111
122 Ga0070695_100518610 3300005545 Bacteria 924
123 Ga0070665_100037310 3300005548 Bacteria 4888
124 Ga0070665_100324469 3300005548 Bacteria 1544
125 Ga0070665_102352335 3300005548 Bacteria 535
126 Ga0070704_100096066 3300005549 Bacteria 2221
127 Ga0068855_100056789 3300005563 Bacteria 4591
128 Ga0068855_100467014 3300005563 Unclassified 1375
129 Ga0068855_100561829 3300005563 Bacteria 1234
130 Ga0068855_101385870 3300005563 Unclassified 725
131 Ga0068855_101933275 3300005563 Bacteria 597
132 Ga0070664_100413073 3300005564 Bacteria 1235
133 Ga0068857_100242266 3300005577 Bacteria 1651
134 Ga0068854_100131714 3300005578 Bacteria 1910
135 Ga0068854_100501279 3300005578 Bacteria 1022
136 Ga0068856_100201670 3300005614 Bacteria 2004
137 Ga0070702_100348681 3300005615 Bacteria 1042
138 Ga0068852_100005901 3300005616 Bacteria 8805
139 Ga0068852_100063610 3300005616 Bacteria 3213
140 Ga0068859_100071884 3300005617 Bacteria 3495
141 Ga0068859_100475781 3300005617 Unclassified 1345
142 Ga0068859_100770303 3300005617 Unclassified 1051
143 Ga0068859_101327482 3300005617 Bacteria 793
144 Ga0068859_101674306 3300005617 Bacteria 703
145 Ga0068864_100099102 3300005618 Bacteria 2581
146 Ga0068864_100202147 3300005618 Bacteria 1826
147 Ga0068861_100206870 3300005719 Bacteria 1651
148 Ga0068861_101012345 3300005719 Bacteria 794
149 Ga0068851_10000476 3300005834 Bacteria 17664
150 Ga0068851_10001359 3300005834 Bacteria 10676
151 Ga0068870_10088965 3300005840 Unclassified 1723
152 Ga0068870_10169266 3300005840 Bacteria 1302
153 Ga0068863_100000916 3300005841 Bacteria 29618
154 Ga0068863_100073675 3300005841 Bacteria 3231
155 Ga0068863_100085174 3300005841 Bacteria 2995
156 Ga0068863_100322907 3300005841 Bacteria 1500
157 Ga0068863_100336373 3300005841 Bacteria 1468
158 Ga0068863_100406256 3300005841 Bacteria 1333
159 Ga0068858_100037941 3300005842 Bacteria 4469
160 Ga0068858_100981113 3300005842 Bacteria 827
161 Ga0068858_101131764 3300005842 Unclassified 769
162 Ga0068858_101942296 3300005842 Bacteria 582
163 Ga0068860_100001439 3300005843 Bacteria 25753
164 Ga0068860_100004070 3300005843 Bacteria 15007
165 Ga0068860_100006251 3300005843 Bacteria 11963
166 Ga0068860_101049479 3300005843 Bacteria 834
167 Ga0068862_100011277 3300005844 Bacteria 7380
168 Ga0068862_100104652 3300005844 Bacteria 2480
169 Ga0068862_100149511 3300005844 Bacteria 2078
170 Ga0068862_100345684 3300005844 Bacteria 1379
171 Ga0070717_10633148 3300006028 Unclassified 971
172 Ga0075365_10007356 3300006038 Bacteria 6160
173 Ga0075368_10426573 3300006042 Bacteria 585
174 Ga0075363_100016251 3300006048 Bacteria 3674
175 Ga0075363_100242056 3300006048 Bacteria 1037
176 Ga0075363_100773327 3300006048 Bacteria 583
177 Ga0075364_10003516 3300006051 Bacteria 8918
178 Ga0075432_10019998 3300006058 Bacteria 2289
179 Ga0070716_100908045 3300006173 Bacteria 690
180 Ga0075367_10059577 3300006178 Bacteria 2273
181 Ga0075367_10540448 3300006178 Bacteria 740
182 Ga0075366_10010380 3300006195 Bacteria 5228
183 Ga0075366_10019852 3300006195 Bacteria 3893
184 Ga0075366_10420009 3300006195 Bacteria 824
185 Ga0097621_100006254 3300006237 Bacteria 8450
186 Ga0097621_100013732 3300006237 Bacteria 6046
187 Ga0097621_102235631 3300006237 Unclassified 523
188 Ga0075370_10002892 3300006353 Bacteria 8057
189 Ga0075370_10003792 3300006353 Bacteria 7238
190 Ga0075370_10003831 3300006353 Bacteria 7193
191 Ga0075370_10004452 3300006353 Bacteria 6807
192 Ga0075370_10041438 3300006353 Bacteria 2599
193 Ga0068871_100002954 3300006358 Bacteria 11667
194 Ga0068871_100778273 3300006358 Bacteria 881
195 Ga0075428_100059829 3300006844 Bacteria 4171
196 Ga0075428_100659398 3300006844 Bacteria 1116
197 Ga0075430_100178297 3300006846 Bacteria 1768
198 Ga0075430_100195026 3300006846 Bacteria 1683
199 Ga0075431_100280265 3300006847 Bacteria 1688
200 Ga0075431_100324710 3300006847 Bacteria 1551
201 Ga0075431_101425613 3300006847 Unclassified 652
202 Ga0075433_10174797 3300006852 Bacteria 1911
203 Ga0068865_100097611 3300006881 Bacteria 2145
204 Ga0068865_100112428 3300006881 Bacteria 2011
205 Ga0068865_100382162 3300006881 Bacteria 1149
206 Ga0068865_101981906 3300006881 Bacteria 528
207 Ga0097620_100071884 3300006931 Bacteria 3495
208 Ga0097620_100475731 3300006931 Unclassified 1345
209 Ga0097620_100770368 3300006931 Unclassified 1051
210 Ga0097620_101327624 3300006931 Bacteria 793
211 Ga0097620_101674287 3300006931 Bacteria 703
212 Ga0105244_10003954 3300009036 Bacteria 10393
213 Ga0105244_10026489 3300009036 Bacteria 3137
214 Ga0105244_10469483 3300009036 Bacteria 579
215 Ga0105240_10041594 3300009093 Bacteria 5865
216 Ga0105240_10174675 3300009093 Bacteria 2541
217 Ga0111539_10219863 3300009094 Bacteria 2212
218 Ga0111539_12068630 3300009094 Unclassified 660
219 Ga0105245_10354792 3300009098 Bacteria 1454
220 Ga0114129_11504672 3300009147 Bacteria 827
221 Ga0105243_10000385 3300009148 Bacteria 47177
222 Ga0105243_10030905 3300009148 Bacteria 4127
223 Ga0105243_10461052 3300009148 Bacteria 1195
224 Ga0105243_10506919 3300009148 Bacteria 1145
225 Ga0105243_10648725 3300009148 Bacteria 1023
226 Ga0105243_11010719 3300009148 Bacteria 835
227 Ga0105241_11143763 3300009174 Bacteria 735
228 Ga0105242_10066651 3300009176 Bacteria 2974
229 Ga0105242_10541419 3300009176 Bacteria 1114
230 Ga0105242_11319236 3300009176 Bacteria 746
231 Ga0105248_10222563 3300009177 Bacteria 2125
232 Ga0105248_10516452 3300009177 Bacteria 1347
233 Ga0105237_10044342 3300009545 Bacteria 4478
234 Ga0105238_10519878 3300009551 Bacteria 1193
235 Ga0105249_10016212 3300009553 Bacteria 6608
236 Ga0105249_10281820 3300009553 Unclassified 1660
237 Ga0105249_10342956 3300009553 Bacteria 1511
238 Ga0105249_10796876 3300009553 Bacteria 1009
239 Ga0105239_10218755 3300010375 Bacteria 2136
240 Ga0105239_10327973 3300010375 Bacteria 1726
241 Ga0105246_10038608 3300011119 Bacteria 3212
242 Ga0105246_10256765 3300011119 Bacteria 1390
243 Ga0105246_10370212 3300011119 Bacteria 1180
244 Ga0157327_1070785 3300012512 Bacteria 541
245 Ga0157373_10012427 3300013100 Bacteria 6259
246 Ga0157373_10057182 3300013100 Bacteria 2767
247 Ga0157373_10132012 3300013100 Bacteria 1756
248 Ga0157371_10016208 3300013102 Bacteria 5568
249 Ga0157370_10010652 3300013104 Bacteria 9679
250 Ga0157370_10145566 3300013104 Bacteria 2206
251 Ga0157369_10001788 3300013105 Bacteria 26005
252 Ga0157378_10023616 3300013297 Bacteria 5408
253 Ga0157378_10266161 3300013297 Unclassified 1646
254 Ga0157378_10698950 3300013297 Bacteria 1033
255 Ga0157378_11332547 3300013297 Bacteria 759
256 Ga0163162_10082115 3300013306 Bacteria 3295
257 Ga0163162_10098434 3300013306 Bacteria 3014
258 Ga0163162_10581621 3300013306 Bacteria 1247
259 Ga0163162_13195259 3300013306 Bacteria 526
260 Ga0157372_10103425 3300013307 Bacteria 3254
261 Ga0157375_10192933 3300013308 Bacteria 2192
262 Ga0157375_10758042 3300013308 Bacteria 1121
263 Ga0163163_10360389 3300014325 Unclassified 1510
264 Ga0163163_10406154 3300014325 Bacteria 1420
265 Ga0157380_10255346 3300014326 Bacteria 1589
266 Ga0157380_10255764 3300014326 Bacteria 1588
267 Ga0157380_10300676 3300014326 Unclassified 1478
268 Ga0157380_11603350 3300014326 Bacteria 706
269 Ga0157380_11931893 3300014326 Bacteria 651
270 Ga0157380_13500913 3300014326 Bacteria 503
271 Ga0182008_10000536 3300014497 Bacteria 28332
272 Ga0182008_10003506 3300014497 Bacteria 9462
273 Ga0182008_10009042 3300014497 Bacteria 5394
274 Ga0182008_10014187 3300014497 Bacteria 4177
275 Ga0157379_10035897 3300014968 Bacteria 4421
276 Ga0157376_10022402 3300014969 Bacteria 4924
277 Ga0157376_10178359 3300014969 Bacteria 1940
278 Ga0157376_10377226 3300014969 Bacteria 1365
279 Ga0157376_10536789 3300014969 Bacteria 1155
280 Ga0157376_10641213 3300014969 Bacteria 1062
281 Ga0157376_10729550 3300014969 Bacteria 998
282 Ga0182006_1001750 3300015261 Bacteria 12597
283 Ga0182007_10000335 3300015262 Bacteria 29829
284 Ga0182007_10017433 3300015262 Bacteria 2623
285 Ga0182005_1023710 3300015265 Bacteria 1676
286 Ga0182005_1031329 3300015265 Bacteria 1449
287 Ga0163161_10000463 3300017792 Bacteria 33681
288 Ga0163161_10019607 3300017792 Bacteria 4745
289 Ga0163161_10027191 3300017792 Bacteria 4058
290 Ga0163161_10064169 3300017792 Bacteria 2679
291 Ga0163161_10070495 3300017792 Bacteria 2555
292 Ga0163161_10265217 3300017792 Bacteria 1343
293 Ga0163161_10566541 3300017792 Bacteria 933
294 Ga0209436_103826 3300025208 Bacteria 3865
295 Ga0209672_101347 3300025228 Bacteria 9230
296 Ga0209147_100582 3300025229 Bacteria 20373
297 Ga0209147_118169 3300025229 Bacteria 662
298 Ga0209258_100133 3300025242 Bacteria 174846
299 Ga0207425_1000392 3300025245 Bacteria 29503
300 Ga0207425_1021681 3300025245 Bacteria 1360
301 Ga0207425_1077659 3300025245 Bacteria 559
302 Ga0209148_1000188 3300025254 Bacteria 117310
303 Ga0209129_1000111 3300025258 Bacteria 148853
304 Ga0209129_1000425 3300025258 Bacteria 32039
305 Ga0209129_1002392 3300025258 Bacteria 9236
306 Ga0209565_1000146 3300025263 Bacteria 97720
307 Ga0209565_1000891 3300025263 Bacteria 16284
308 Ga0209673_1000216 3300025273 Bacteria 114232
309 Ga0209673_1001323 3300025273 Bacteria 24935
310 Ga0209673_1001463 3300025273 Bacteria 22194
311 Ga0209130_1000470 3300025284 Bacteria 41506
312 Ga0209130_1000646 3300025284 Bacteria 32516
313 Ga0209130_1018482 3300025284 Bacteria 1635
314 Ga0209675_1000331 3300025291 Bacteria 41480
315 Ga0209675_1000685 3300025291 Bacteria 23545
316 Ga0209676_1000111 3300025292 Bacteria 213411
317 Ga0209676_1000737 3300025292 Bacteria 44719
318 Ga0209676_1010159 3300025292 Bacteria 3962
319 Ga0209676_1018576 3300025292 Bacteria 2422
320 Ga0209025_1000038 3300025294 Bacteria 380508
321 Ga0209025_1000116 3300025294 Bacteria 218293
322 Ga0209025_1000839 3300025294 Bacteria 48717
323 Ga0209025_1047744 3300025294 Bacteria 1744
324 Ga0209564_1000070 3300025295 Bacteria 303126
325 Ga0209564_1000155 3300025295 Bacteria 165859
326 Ga0209758_1000107 3300025297 Bacteria 218293
327 Ga0209758_1154515 3300025297 Bacteria 578
328 Ga0209050_1000111 3300025298 Bacteria 213411
329 Ga0209050_1006050 3300025298 Bacteria 7326
330 Ga0209256_1000047 3300025299 Bacteria 314709
331 Ga0209256_1000087 3300025299 Bacteria 218290
332 Ga0207426_1000123 3300025302 Bacteria 218290
333 Ga0207426_1000194 3300025302 Bacteria 150009
334 Ga0209051_1000160 3300025303 Bacteria 126473
335 Ga0209051_1000340 3300025303 Bacteria 70080
336 Ga0209051_1020185 3300025303 Bacteria 2880
337 Ga0209257_1000116 3300025304 Bacteria 228733
338 Ga0209257_1000690 3300025304 Bacteria 52373
339 Ga0209257_1001961 3300025304 Bacteria 22193
340 Ga0207697_10091340 3300025315 Bacteria 1290
341 Ga0207656_10019101 3300025321 Bacteria 2708
342 Ga0207656_10256222 3300025321 Bacteria 858
343 Ga0207655_1005419 3300025728 Bacteria 8676
344 Ga0207682_10425305 3300025893 Bacteria 628
345 Ga0207642_10013191 3300025899 Bacteria 3008
346 Ga0207680_10063631 3300025903 Bacteria 2258
347 Ga0207680_10364063 3300025903 Bacteria 1017
348 Ga0207680_10634058 3300025903 Bacteria 765
349 Ga0207647_10038464 3300025904 Bacteria 3024
350 Ga0207699_10085202 3300025906 Unclassified 1970
351 Ga0207645_10000063 3300025907 Bacteria 76658
352 Ga0207643_10002613 3300025908 Bacteria 9745
353 Ga0207684_10018108 3300025910 Bacteria 6035
354 Ga0207684_10067633 3300025910 Unclassified 3036
355 Ga0207654_10257553 3300025911 Bacteria 1172
356 Ga0207707_11050342 3300025912 Bacteria 666
357 Ga0207695_10259573 3300025913 Bacteria 1635
358 Ga0207695_10738214 3300025913 Bacteria 865
359 Ga0207671_11142795 3300025914 Bacteria 611
360 Ga0207681_10084152 3300025923 Bacteria 2254
361 Ga0207681_10641298 3300025923 Bacteria 880
362 Ga0207681_10900110 3300025923 Bacteria 741
363 Ga0207694_10391479 3300025924 Bacteria 1155
364 Ga0207694_11838009 3300025924 Bacteria 509
365 Ga0207659_10090098 3300025926 Bacteria 2288
366 Ga0207664_10136832 3300025929 Unclassified 2068
367 Ga0207664_10162245 3300025929 Bacteria 1907
368 Ga0207664_10383384 3300025929 Unclassified 1248
369 Ga0207644_10117927 3300025931 Bacteria 2016
370 Ga0207690_10044527 3300025932 Bacteria 2926
371 Ga0207690_11514418 3300025932 Bacteria 561
372 Ga0207706_10006703 3300025933 Bacteria 10648
373 Ga0207706_10044723 3300025933 Bacteria 3924
374 Ga0207686_10821858 3300025934 Bacteria 746
375 Ga0207709_10000908 3300025935 Bacteria 22289
376 Ga0207709_10000999 3300025935 Bacteria 21008
377 Ga0207709_10441961 3300025935 Bacteria 1003
378 Ga0207709_11111723 3300025935 Bacteria 649
379 Ga0207709_11592318 3300025935 Bacteria 542
380 Ga0207670_10358409 3300025936 Bacteria 1157
381 Ga0207669_10642368 3300025937 Bacteria 867
382 Ga0207669_11068025 3300025937 Bacteria 680
383 Ga0207669_11651870 3300025937 Unclassified 547
384 Ga0207704_10904676 3300025938 Bacteria 742
385 Ga0207704_11456483 3300025938 Bacteria 587
386 Ga0207691_10000050 3300025940 Bacteria 94763
387 Ga0207691_10028829 3300025940 Bacteria 5195
388 Ga0207711_12050503 3300025941 Bacteria 515
389 Ga0207689_10006256 3300025942 Bacteria 10551
390 Ga0207689_10054834 3300025942 Bacteria 3282
391 Ga0207689_10138695 3300025942 Bacteria 2003
392 Ga0207679_10382060 3300025945 Bacteria 1235
393 Ga0207679_11474079 3300025945 Bacteria 624
394 Ga0207667_10225711 3300025949 Bacteria 1919
395 Ga0207667_10407289 3300025949 Bacteria 1384
396 Ga0207667_11933002 3300025949 Bacteria 551
397 Ga0207651_10107999 3300025960 Bacteria 2081
398 Ga0207651_10552222 3300025960 Bacteria 1002
399 Ga0207651_10553457 3300025960 Bacteria 1001
400 Ga0207668_10008210 3300025972 Bacteria 6218
401 Ga0207668_10202559 3300025972 Unclassified 1582
402 Ga0207668_10429781 3300025972 Bacteria 1123
403 Ga0207640_10095743 3300025981 Bacteria 2068
404 Ga0207640_10098902 3300025981 Bacteria 2041
405 Ga0207640_10858070 3300025981 Unclassified 790
406 Ga0207658_10179543 3300025986 Bacteria 1751
407 Ga0207658_10873589 3300025986 Bacteria 818
408 Ga0207677_10005833 3300026023 Bacteria 6703
409 Ga0207677_10516240 3300026023 Bacteria 1036
410 Ga0207703_10056601 3300026035 Bacteria 3194
411 Ga0207703_10401682 3300026035 Bacteria 1271
412 Ga0207703_10655311 3300026035 Bacteria 996
413 Ga0207639_11031123 3300026041 Bacteria 771
414 Ga0207678_10001056 3300026067 Bacteria 25189
415 Ga0207708_10506496 3300026075 Unclassified 1012
416 Ga0207702_10931580 3300026078 Unclassified 861
417 Ga0207641_10000209 3300026088 Bacteria 75878
418 Ga0207641_10076996 3300026088 Bacteria 2885
419 Ga0207641_10132443 3300026088 Bacteria 2240
420 Ga0207641_10213791 3300026088 Bacteria 1784
421 Ga0207641_11294334 3300026088 Unclassified 729
422 Ga0207641_12019261 3300026088 Bacteria 578
423 Ga0207648_10004317 3300026089 Bacteria 14637
424 Ga0207648_10179434 3300026089 Bacteria 1874
425 Ga0207676_10051656 3300026095 Bacteria 3210
426 Ga0207676_10175419 3300026095 Bacteria 1871
427 Ga0207674_10036499 3300026116 Bacteria 5118
428 Ga0207674_10045766 3300026116 Bacteria 4498
429 Ga0207674_10325364 3300026116 Bacteria 1487
430 Ga0207675_100186394 3300026118 Bacteria 1989
431 Ga0207683_10000521 3300026121 Bacteria 35599
432 Ga0207683_10257464 3300026121 Bacteria 1593
433 Ga0207683_10429045 3300026121 Bacteria 1218
434 Ga0207683_10606341 3300026121 Bacteria 1013
435 Ga0207683_11178865 3300026121 Bacteria 710
436 Ga0207698_10649119 3300026142 Bacteria 1045
437 Ga0209983_1166647 3300027665 Bacteria 505
438 Ga0209998_10203859 3300027717 Archaea 517
439 Ga0209813_10349111 3300027866 Bacteria 585
440 Ga0207428_10176707 3300027907 Unclassified 1614
441 Ga0207428_10281367 3300027907 Bacteria 1235
442 Ga0207428_10358649 3300027907 Unclassified 1072
443 Ga0268266_10735694 3300028379 Bacteria 951
444 Ga0268266_12172749 3300028379 Unclassified 527
445 Ga0268265_10007450 3300028380 Bacteria 7392
446 Ga0268265_10144891 3300028380 Bacteria 1994
447 Ga0268264_10000156 3300028381 Bacteria 155304
448 Ga0268264_10034834 3300028381 Bacteria 4143
449 Ga0268264_10040180 3300028381 Bacteria 3865
450 Ga0307515_10439307 3300028794 Bacteria 922
451 Ga0316177_1084928 3300030731 Bacteria 1331
452 Ga0316176_1099510 3300030732 Bacteria 7648
453 Ga0314311_1080241 3300030733 Bacteria 5845
454 Ga0316179_1006693 3300030734 Bacteria 4448
455 Ga0316183_1006724 3300030742 Bacteria 9356
456 Ga0316181_1015734 3300030744 Bacteria 2437
457 Ga0316182_1257738 3300030745 Bacteria 948
458 Ga0265330_10132895 3300031235 Bacteria 1059
459 Ga0265325_10471501 3300031241 Bacteria 546
460 Ga0265340_10033047 3300031247 Bacteria 2578
461 Ga0265327_10000201 3300031251 Bacteria 124359
462 Ga0265327_10349086 3300031251 Bacteria 646
463 Ga0307408_100071027 3300031548 Bacteria 2572
464 Ga0307408_100255483 3300031548 Bacteria 1447
465 Ga0307408_100342912 3300031548 Bacteria 1265
466 Ga0307408_101492458 3300031548 Unclassified 639
467 Ga0265313_10320421 3300031595 Bacteria 619
468 Ga0307508_10262257 3300031616 Bacteria 1322
469 Ga0307405_10050963 3300031731 Bacteria 2566
470 Ga0307405_10148692 3300031731 Bacteria 1644
471 Ga0307405_10338528 3300031731 Bacteria 1156
472 Ga0307405_10551271 3300031731 Bacteria 933
473 Ga0307405_10651298 3300031731 Bacteria 866
474 Ga0307405_11904794 3300031731 Bacteria 530
475 Ga0307413_10146049 3300031824 Bacteria 1642
476 Ga0307413_10741604 3300031824 Bacteria 820
477 Ga0307413_10898878 3300031824 Bacteria 752
478 Ga0307410_10037217 3300031852 Bacteria 3176
479 Ga0307410_10363308 3300031852 Bacteria 1160
480 Ga0307407_10126527 3300031903 Bacteria 1628
481 Ga0307412_10026505 3300031911 Bacteria 3603
482 Ga0307412_10136737 3300031911 Bacteria 1789
483 Ga0307412_12172092 3300031911 Bacteria 516
484 Ga0307409_101133016 3300031995 Bacteria 804
485 Ga0307409_102004386 3300031995 Unclassified 608
486 Ga0307416_100023276 3300032002 Bacteria 4492
487 Ga0307416_100097232 3300032002 Bacteria 2549
488 Ga0307414_10083717 3300032004 Bacteria 2343
489 Ga0307414_10453413 3300032004 Bacteria 1125
490 Ga0307414_12218495 3300032004 Bacteria 513
491 Ga0307411_10070123 3300032005 Bacteria 2370
492 Ga0307411_10238595 3300032005 Bacteria 1422
493 Ga0307415_100031282 3300032126 Bacteria 3427
494 Ga0307415_100303972 3300032126 Bacteria 1323
495 Ga0307510_10121976 3300033180 Bacteria 2307
496 Ga0373932_0076826 3300035112 Unclassified 1047
497 Ga0373953_0186054 3300035117 Bacteria 897
498 Ga0373954_0137075 3300035118 Unclassified 1193
499 Ga0373956_0066624 3300035119 Unclassified 1638
500 Ga0373931_0142836 3300035691 Bacteria 1388
501 Ga0373933_0826479 3300035724 Unclassified 610
502 Ga0373947_0876770 3300035725 Unclassified 613
503 Ga0373937_0090487 3300036401 Bacteria 2834
504 Ga0373937_2135776 3300036401 Unclassified 506
505 Ga0436360_0282104 3300039438 Unclassified 775
506 Ga0436360_1221163 3300039438 Bacteria 704
507 Ga0439439_0025543 3300041406 Bacteria 1487
508 Ga0439447_007672 3300041407 Bacteria 3399
509 Ga0439461_0060469 3300041410 Bacteria 859
510 Ga0439466_0007112 3300041411 Bacteria 4236
511 Ga0439466_0226591 3300041411 Bacteria 567
512 Ga0439465_0000026 3300041413 Bacteria 29635
513 Ga0451791_0356159 3300041451 Bacteria 538
514 Ga0451797_0720147 3300041453 Bacteria 545
515 Ga0451798_0431473 3300041458 Bacteria 726
516 Ga0451802_0534293 3300041460 Bacteria 550
517 Ga0451804_0836606 3300041463 Unclassified 635
518 Ga0451843_0811403 3300041509 Bacteria 1116
519 Ga0439431_0000034 3300041997 Bacteria 20591
520 Ga0439433_0000067 3300041999 Bacteria 13181
521 Ga0439442_040654 3300042002 Bacteria 977
522 Ga0439442_143893 3300042002 Bacteria 528
523 Ga0439445_0000146 3300042004 Bacteria 12454
524 Ga0439448_0345253 3300042005 Bacteria 530
525 Ga0439432_000206 3300042006 Bacteria 20983
526 Ga0439432_023763 3300042006 Bacteria 2017
527 Ga0439449_0000276 3300042007 Bacteria 18583
528 Ga0439452_000641 3300042010 Bacteria 17592
529 Ga0439457_007265 3300042014 Bacteria 2668
530 Ga0439462_0001588 3300042015 Bacteria 5102
531 Ga0450890_029398 3300042127 Bacteria 777
532 Ga0439446_0016088 3300042156 Bacteria 2081
533 Ga0450908_068025 3300042184 Bacteria 631
534 Ga0450908_105298 3300042184 Bacteria 518
535 Ga0439434_0000300 3300042435 Bacteria 14185
536 Ga0439460_0113670 3300042461 Bacteria 880
537 Ga0451577_0246794 3300042876 Bacteria 1616
538 Ga0451577_0802576 3300042876 Bacteria 850
539 Ga0453683_0237426 3300044673 Bacteria 1161
540 Ga0466966_0038431 3300044684 Unclassified 3085
541 Ga0453684_0809694 3300044712 Bacteria 1010
542 Ga0466959_0361590 3300045049 Unclassified 989
543 Ga0451576_0070615 3300045051 Bacteria 3635
544 Ga0466958_0220832 3300045836 Unclassified 1209
545 Ga0495627_053601 3300046453 Bacteria 1207
546 Ga0495638_0024101 3300046460 Bacteria 3972
547 Ga0495651_0023107 3300046462 Bacteria 4836
548 Ga0495651_0150536 3300046462 Bacteria 1678
549 Ga0495651_0333253 3300046462 Bacteria 1008
550 Ga0495653_0535951 3300046463 Bacteria 726
551 Ga0495580_0000672 3300046472 Bacteria 29183
552 Ga0495639_0011620 3300046475 Bacteria 3798
553 Ga0495610_0181380 3300046512 Bacteria 875
554 Ga0495616_0002482 3300046513 Bacteria 12212
555 Ga0495628_0589734 3300046516 Bacteria 795
556 Ga0495630_0262677 3300046517 Bacteria 1319
557 Ga0495631_0000067 3300046518 Bacteria 64990
558 Ga0495637_0035666 3300046520 Bacteria 2170
559 Ga0495637_0189766 3300046520 Bacteria 759
560 Ga0495663_0034282 3300046525 Bacteria 1519
561 Ga0495663_0315357 3300046525 Bacteria 565
562 Ga0495654_0269455 3300046530 Bacteria 704
563 Ga0495640_0332975 3300046533 Bacteria 939
564 Ga0495587_0399485 3300046536 Bacteria 764
565 Ga0495598_0051908 3300046537 Bacteria 1237
566 Ga0495621_0001559 3300046539 Bacteria 5970
567 Ga0495621_0049535 3300046539 Bacteria 1499
568 Ga0495645_0864662 3300046543 Unclassified 539
569 Ga0495622_0081789 3300046557 Bacteria 1486
570 Ga0495622_0179473 3300046557 Bacteria 950
571 Ga0495656_0013202 3300046615 Bacteria 3066
572 Ga0495656_0168454 3300046615 Bacteria 1069
573 Ga0495668_0026483 3300046616 Bacteria 3290
574 Ga0495625_0028048 3300046660 Bacteria 4226
575 Ga0495635_0213555 3300046663 Bacteria 1306
576 Ga0495635_0571414 3300046663 Bacteria 740
577 Ga0495588_0021323 3300046674 Bacteria 3192
578 Ga0495599_0218190 3300046678 Bacteria 1168
579 Ga0495599_0357989 3300046678 Bacteria 874
580 Ga0495613_0811042 3300046689 Bacteria 610
581 Ga0495624_0283854 3300046690 Bacteria 999
582 Ga0495670_0207703 3300046691 Bacteria 1038
583 Ga0495600_0105196 3300046809 Bacteria 1839
584 Ga0495600_0488630 3300046809 Bacteria 758
585 Ga0495672_0159662 3300047320 Bacteria 1160
586 Ga0495676_0066940 3300047321 Bacteria 2781
587 Ga0495676_0774580 3300047321 Bacteria 618
588 Ga0495685_225916 3300047447 Bacteria 597
589 Ga0495593_0064869 3300047673 Bacteria 1905
590 Ga0495602_0087988 3300048088 Bacteria 2587
591 Ga0495602_0379564 3300048088 Bacteria 1013
592 Ga0495614_0021458 3300048089 Bacteria 2789
593 Ga0495614_0532699 3300048089 Bacteria 561
594 Ga0495615_0027097 3300048090 Bacteria 1342
595 Ga0496100_1555572 3300048903 Unclassified 522
596 Ga0496101_0001086 3300048904 Bacteria 16129
597 Ga0496102_0042589 3300048905 Bacteria 4114
598 Ga0496102_0265668 3300048905 Bacteria 1618
599 Ga0496104_0005610 3300048907 Bacteria 10985
600 Ga0496105_0001424 3300048908 Bacteria 16806
601 Ga0496105_0702357 3300048908 Bacteria 776
602 Ga0496105_1044442 3300048908 Bacteria 609
603 Ga0496106_1142782 3300048909 Bacteria 609
604 Ga0496108_0095496 3300048911 Bacteria 2531
605 Ga0496109_0107726 3300048912 Bacteria 2589
606 Ga0496109_0115216 3300048912 Bacteria 2501
607 Ga0496110_0002674 3300048913 Bacteria 13459
608 Ga0496110_0007149 3300048913 Bacteria 8887
609 Ga0496111_0064162 3300048914 Bacteria 2664
610 Ga0496111_0965973 3300048914 Bacteria 611
611 Ga0496113_0434686 3300048916 Bacteria 1054
612 Ga0496114_0220098 3300048917 Bacteria 1666
613 Ga0496114_0747687 3300048917 Bacteria 855
614 Ga0496115_0496142 3300048918 Unclassified 982
615 Ga0496116_0068756 3300048919 Bacteria 2255
616 Ga0496117_0036021 3300048920 Bacteria 3707
617 Ga0496118_0007548 3300048921 Bacteria 11485
618 Ga0496118_0361559 3300048921 Bacteria 769
619 Ga0496118_0437111 3300048921 Bacteria 668
620 Ga0496119_0007290 3300048922 Bacteria 10004
621 Ga0496119_0163193 3300048922 Bacteria 1182
622 Ga0496120_0113633 3300048923 Unclassified 1410
623 Ga0496121_0056893 3300048924 Bacteria 3244
624 Ga0496121_0078212 3300048924 Bacteria 2630
625 Ga0496121_0271151 3300048924 Bacteria 1166
626 Ga0496121_0687756 3300048924 Bacteria 617
627 Ga0496122_0001985 3300048925 Bacteria 30535
628 Ga0496122_0007594 3300048925 Bacteria 11986
629 Ga0496122_0050320 3300048925 Bacteria 3179
630 Ga0496122_0188718 3300048925 Bacteria 1219
631 Ga0496123_0011920 3300048926 Bacteria 7466
632 Ga0496123_0013891 3300048926 Bacteria 6711
633 Ga0496123_0127542 3300048926 Bacteria 1417
634 Ga0496124_0004029 3300048927 Bacteria 17475
635 Ga0496124_0020609 3300048927 Bacteria 6086
636 Ga0496125_0020118 3300048928 Bacteria 6275
637 Ga0496125_0525422 3300048928 Bacteria 661
638 Ga0501034_0290922 3300049571 Bacteria 1572
639 Ga0501039_0426431 3300049575 Bacteria 1042
640 Ga0501039_0627896 3300049575 Bacteria 842
641 Ga0501046_1236081 3300049580 Unclassified 512
642 Ga0501071_1310056 3300049587 Bacteria 559
643 Ga0501072_0114790 3300049588 Bacteria 2144
644 Ga0501075_1018021 3300049591 Unclassified 629
645 Ga0501076_0107024 3300049592 Bacteria 2258
646 Ga0501076_0442989 3300049592 Bacteria 1069
647 Ga0501076_0555452 3300049592 Bacteria 947
648 Ga0501227_157031 3300049665 Bacteria 631
649 Ga0501238_012789 3300049671 Bacteria 1139
650 Ga0501081_0333953 3300049743 Bacteria 1115
651 Ga0501083_0561696 3300049744 Unclassified 743
652 Ga0501241_098697 3300049758 Bacteria 627
653 nmdc:mga03683_307380_c1 3300050489 Bacteria 745
654 nmdc:mga03n38_15066_c1 3300050490 Bacteria 2979
655 nmdc:mga03n38_88249_c1 3300050490 Bacteria 1471
656 nmdc:mga00v17_13311_c1 3300050491 Bacteria 4564
657 nmdc:mga00v17_462008_c1 3300050491 Bacteria 824
658 nmdc:mga0yw44_1462_c1 3300050492 Bacteria 9399
659 nmdc:mga0k408_117191_c1 3300050493 Bacteria 1576
660 nmdc:mga0k408_256707_c1 3300050493 Bacteria 1044
661 nmdc:mga0k408_3020_c1 3300050493 Bacteria 8922
662 nmdc:mga0k408_373780_c1 3300050493 Bacteria 849
663 nmdc:mga06z11_222786_c1 3300050494 Bacteria 1103
664 nmdc:mga06z11_299145_c1 3300050494 Bacteria 956
665 nmdc:mga06z11_43894_c1 3300050494 Bacteria 2252
666 nmdc:mga06z11_732382_c1 3300050494 Bacteria 602
667 nmdc:mga07m45_107421_c1 3300050496 Bacteria 1606
668 nmdc:mga07m45_10975_c1 3300050496 Bacteria 4747
669 nmdc:mga07m45_3692_c2 3300050496 Bacteria 6479
670 nmdc:mga07m45_61979_c1 3300050496 Bacteria 2119
671 nmdc:mga07m45_7175_c1 3300050496 Bacteria 5678
672 nmdc:mga07m45_809909_c1 3300050496 Bacteria 537
673 nmdc:mga05p37_1075729_c1 3300050507 Bacteria 845
674 nmdc:mga05p37_515_c1 3300050507 Bacteria 42751
675 nmdc:mga09592_100270_c1 3300050508 Unclassified 2480
676 nmdc:mga0qj67_274983_c1 3300050509 Bacteria 1365
677 nmdc:mga0qj67_32999_c1 3300050509 Bacteria 4039
678 nmdc:mga06r32_1360753_c1 3300050510 Unclassified 652
679 nmdc:mga06r32_27384_c1 3300050510 Bacteria 5325
680 nmdc:mga06r32_28_c1 3300050510 Bacteria 87379
681 nmdc:mga06r32_460826_c1 3300050510 Bacteria 1250
682 nmdc:mga08y16_124_c2 3300050511 Bacteria 38531
683 nmdc:mga08y16_31708_c1 3300050511 Bacteria 5557
684 nmdc:mga0n895_12706_c1 3300050512 Bacteria 7561
685 nmdc:mga0n895_32298_c1 3300050512 Bacteria 5024
686 nmdc:mga0n895_84346_c1 3300050512 Bacteria 3170
687 nmdc:mga0rr50_184085_c1 3300050513 Bacteria 1709
688 nmdc:mga0rr50_64150_c1 3300050513 Bacteria 2777
689 nmdc:mga0rr50_803324_c1 3300050513 Bacteria 803
690 nmdc:mga08x19_349404_c1 3300050514 Bacteria 1032
691 nmdc:mga0a205_152492_c1 3300050515 Bacteria 2210
692 nmdc:mga0sz30_478830_c1 3300050516 Bacteria 559
693 nmdc:mga0sz30_61358_c1 3300050516 Bacteria 1606
694 Ga0500610_0005809 3300053079 Bacteria 5100
695 Ga0500643_002697 3300053087 Bacteria 8922
696 Ga0500651_0000040 3300053093 Bacteria 92649
697 Ga0500566_0030418 3300053094 Bacteria 3149
698 Ga0500641_0020396 3300053096 Unclassified 2516
699 Ga0500560_202416 3300053107 Bacteria 641
700 Ga0500562_003280 3300053108 Bacteria 4043
701 Ga0500571_000361 3300053110 Bacteria 17946
702 Ga0500572_040610 3300053111 Bacteria 1347
703 Ga0500594_0005565 3300053118 Bacteria 2795
704 Ga0500597_131211 3300053120 Bacteria 1083
705 Ga0500608_013301 3300053122 Bacteria 3645
706 Ga0500618_096093 3300053125 Bacteria 666
707 Ga0500626_026523 3300053128 Bacteria 2608
708 Ga0500655_000193 3300053133 Bacteria 14640
709 Ga0500658_0000095 3300053134 Bacteria 40317
710 Ga0500658_0000122 3300053134 Bacteria 37279
711 Ga0500559_0004405 3300053136 Bacteria 6693
712 Ga0500564_023889 3300053138 Bacteria 2805
713 Ga0500568_0000569 3300053139 Bacteria 27012
714 Ga0500573_0212992 3300053140 Bacteria 1018
715 Ga0500574_002739 3300053141 Bacteria 2970
716 Ga0500574_003374 3300053141 Bacteria 2813
717 Ga0500604_0154337 3300053151 Bacteria 781
718 Ga0500616_0308902 3300053153 Bacteria 654
719 Ga0500619_241441 3300053154 Bacteria 597
720 Ga0500624_018686 3300053157 Bacteria 1095
721 Ga0500634_0000914 3300053161 Bacteria 10573
722 Ga0500638_056159 3300053162 Bacteria 1897
723 Ga0500636_0023537 3300053177 Bacteria 3641
724 Ga0500565_040940 3300053734 Bacteria 648

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005445 Ga0070708_100181974 Ga0070708_1001819742 95
2 3300005467 Ga0070706_100848951 Ga0070706_1008489513 95
3 3300005468 Ga0070707_100939480 Ga0070707_1009394802 95
4 3300005518 Ga0070699_100158743 Ga0070699_1001587432 95
5 3300002773 JGI25152J39213_1003553 JGI25152J39213_10035533 96
6 3300002773 JGI25152J39213_1008447 JGI25152J39213_10084476 96
7 3300002774 JGI25150J39212_1000529 JGI25150J39212_100052911 96
8 3300002987 JGI25159J45721_1000714 JGI25159J45721_100071411 96
9 3300002987 JGI25159J45721_1004054 JGI25159J45721_10040547 96
10 3300003187 JGI25151J46595_10000648 JGI25151J46595_1000064811 96
11 3300003187 JGI25151J46595_10001672 JGI25151J46595_1000167211 96
12 3300003187 JGI25151J46595_10001768 JGI25151J46595_100017682 96
13 3300003187 JGI25151J46595_10010051 JGI25151J46595_100100515 96
14 3300003215 JGI25153J46596_10001378 JGI25153J46596_1000137811 96
15 3300003320 rootH2_10084863 rootH2_100848631 96
16 3300003322 rootL2_10335959 rootL2_103359592 96
17 3300003323 rootH1_10021926 rootH1_100219264 96
18 3300003323 rootH1_10122036 rootH1_101220362 96
19 3300003354 JGI25160J50197_1001019 JGI25160J50197_100101911 96
20 3300003354 JGI25160J50197_1005287 JGI25160J50197_10052873 96
21 3300003374 JGI25161J50226_1001734 JGI25161J50226_10017346 96
22 3300003374 JGI25161J50226_1002393 JGI25161J50226_10023936 96
23 3300003374 JGI25161J50226_1003095 JGI25161J50226_10030953 96
24 3300003760 Ga0055527_1009080 Ga0055527_10090803 96
25 3300003761 Ga0055535_1000827 Ga0055535_10008278 96
26 3300003762 Ga0055542_1000103 Ga0055542_100010314 96
27 3300003771 Ga0055526_1001885 Ga0055526_100188511 96
28 3300003771 Ga0055526_1010803 Ga0055526_10108033 96
29 3300003773 Ga0055537_1000532 Ga0055537_100053211 96
30 3300003775 Ga0055524_1001312 Ga0055524_100131211 96
31 3300003781 Ga0055536_1000559 Ga0055536_10005599 96
32 3300003781 Ga0055536_1081886 Ga0055536_10818862 96
33 3300003784 Ga0055534_1000806 Ga0055534_100080611 96
34 3300003784 Ga0055534_1004180 Ga0055534_10041806 96
35 3300003790 Ga0055528_1000780 Ga0055528_100078011 96
36 3300003791 Ga0055530_10000342 Ga0055530_1000034218 96
37 3300003791 Ga0055530_10012129 Ga0055530_100121292 96
38 3300003792 Ga0055540_1001460 Ga0055540_10014609 96
39 3300003792 Ga0055540_1001885 Ga0055540_10018857 96
40 3300003792 Ga0055540_1012669 Ga0055540_10126692 96
41 3300003794 Ga0055531_10000628 Ga0055531_1000062818 96
42 3300003794 Ga0055531_10002126 Ga0055531_100021268 96
43 3300003794 Ga0055531_10002147 Ga0055531_100021477 96
44 3300003794 Ga0055531_10011100 Ga0055531_100111006 96
45 3300004625 Ga0055543_1000702 Ga0055543_10007025 96
46 3300004625 Ga0055543_1000769 Ga0055543_10007693 96
47 3300005262 Ga0065165_1002519 Ga0065165_100251911 96
48 3300005262 Ga0065165_1002602 Ga0065165_10026026 96
49 3300005327 Ga0070658_10143979 Ga0070658_101439792 96
50 3300005330 Ga0070690_100331648 Ga0070690_1003316482 96
51 3300005331 Ga0070670_100581499 Ga0070670_1005814991 96
52 3300005331 Ga0070670_100618278 Ga0070670_1006182782 96
53 3300005334 Ga0068869_100055545 Ga0068869_1000555452 96
54 3300005334 Ga0068869_100058931 Ga0068869_1000589315 96
55 3300005334 Ga0068869_100252172 Ga0068869_1002521722 96
56 3300005334 Ga0068869_100479292 Ga0068869_1004792922 96
57 3300005334 Ga0068869_100490495 Ga0068869_1004904952 96
58 3300005334 Ga0068869_100709691 Ga0068869_1007096911 96
59 3300005335 Ga0070666_10007871 Ga0070666_1000787112 96
60 3300005336 Ga0070680_101747640 Ga0070680_1017476401 96
61 3300005337 Ga0070682_100577459 Ga0070682_1005774592 96
62 3300005338 Ga0068868_100002109 Ga0068868_1000021098 96
63 3300005338 Ga0068868_100139682 Ga0068868_1001396822 96
64 3300005339 Ga0070660_100557997 Ga0070660_1005579971 96
65 3300005340 Ga0070689_100362657 Ga0070689_1003626572 96
66 3300005340 Ga0070689_101558577 Ga0070689_1015585772 96
67 3300005340 Ga0070689_101721177 Ga0070689_1017211771 96
68 3300005341 Ga0070691_10394681 Ga0070691_103946812 96
69 3300005344 Ga0070661_100409418 Ga0070661_1004094182 96
70 3300005347 Ga0070668_100005152 Ga0070668_1000051524 96
71 3300005347 Ga0070668_100176210 Ga0070668_1001762102 96
72 3300005347 Ga0070668_100192504 Ga0070668_1001925042 96
73 3300005347 Ga0070668_101295069 Ga0070668_1012950691 96
74 3300005353 Ga0070669_100100404 Ga0070669_1001004043 96
75 3300005353 Ga0070669_100100504 Ga0070669_1001005042 96
76 3300005353 Ga0070669_100279142 Ga0070669_1002791423 96
77 3300005353 Ga0070669_100838909 Ga0070669_1008389092 96
78 3300005354 Ga0070675_100000542 Ga0070675_10000054238 96
79 3300005354 Ga0070675_102019558 Ga0070675_1020195581 96
80 3300005355 Ga0070671_100002141 Ga0070671_10000214117 96
81 3300005356 Ga0070674_100000170 Ga0070674_10000017036 96
82 3300005356 Ga0070674_100239961 Ga0070674_1002399611 96
83 3300005364 Ga0070673_100000311 Ga0070673_10000031118 96
84 3300005364 Ga0070673_100218080 Ga0070673_1002180802 96
85 3300005364 Ga0070673_100347493 Ga0070673_1003474932 96
86 3300005365 Ga0070688_100911765 Ga0070688_1009117651 96
87 3300005366 Ga0070659_100061334 Ga0070659_1000613342 96
88 3300005366 Ga0070659_100132504 Ga0070659_1001325042 96
89 3300005367 Ga0070667_100049914 Ga0070667_1000499146 96
90 3300005367 Ga0070667_100063297 Ga0070667_1000632974 96
91 3300005367 Ga0070667_100461459 Ga0070667_1004614592 96
92 3300005367 Ga0070667_100561586 Ga0070667_1005615861 96
93 3300005367 Ga0070667_101064602 Ga0070667_1010646022 96
94 3300005367 Ga0070667_101164662 Ga0070667_1011646622 96
95 3300005434 Ga0070709_10335666 Ga0070709_103356661 96
96 3300005435 Ga0070714_100642970 Ga0070714_1006429702 96
97 3300005436 Ga0070713_102258684 Ga0070713_1022586841 96
98 3300005440 Ga0070705_100435481 Ga0070705_1004354812 96
99 3300005441 Ga0070700_100615715 Ga0070700_1006157151 96
100 3300005444 Ga0070694_100259431 Ga0070694_1002594314 96
101 3300005444 Ga0070694_100498130 Ga0070694_1004981302 96
102 3300005444 Ga0070694_101733375 Ga0070694_1017333751 96
103 3300005445 Ga0070708_101251544 Ga0070708_1012515442 96
104 3300005456 Ga0070678_100091899 Ga0070678_1000918993 96
105 3300005456 Ga0070678_100382776 Ga0070678_1003827761 96
106 3300005456 Ga0070678_101977108 Ga0070678_1019771081 96
107 3300005457 Ga0070662_100014668 Ga0070662_1000146683 96
108 3300005457 Ga0070662_100201575 Ga0070662_1002015752 96
109 3300005457 Ga0070662_100472456 Ga0070662_1004724562 96
110 3300005459 Ga0068867_100001800 Ga0068867_10000180032 96
111 3300005459 Ga0068867_100262927 Ga0068867_1002629273 96
112 3300005467 Ga0070706_100075353 Ga0070706_1000753534 96
113 3300005467 Ga0070706_102147263 Ga0070706_1021472632 96
114 3300005471 Ga0070698_100709024 Ga0070698_1007090242 96
115 3300005518 Ga0070699_100067054 Ga0070699_1000670544 96
116 3300005536 Ga0070697_100019668 Ga0070697_1000196683 96
117 3300005536 Ga0070697_100377459 Ga0070697_1003774591 96
118 3300005539 Ga0068853_102033145 Ga0068853_1020331452 96
119 3300005543 Ga0070672_100667480 Ga0070672_1006674802 96
120 3300005543 Ga0070672_101025453 Ga0070672_1010254532 96
121 3300005544 Ga0070686_100084298 Ga0070686_1000842982 96
122 3300005545 Ga0070695_100518610 Ga0070695_1005186102 96
123 3300005548 Ga0070665_100037310 Ga0070665_1000373105 96
124 3300005548 Ga0070665_100324469 Ga0070665_1003244693 96
125 3300005548 Ga0070665_102352335 Ga0070665_1023523351 96
126 3300005549 Ga0070704_100096066 Ga0070704_1000960665 96
127 3300005563 Ga0068855_100056789 Ga0068855_1000567896 96
128 3300005563 Ga0068855_100467014 Ga0068855_1004670142 96
129 3300005563 Ga0068855_100561829 Ga0068855_1005618291 96
130 3300005563 Ga0068855_101385870 Ga0068855_1013858701 96
131 3300005563 Ga0068855_101933275 Ga0068855_1019332751 96
132 3300005564 Ga0070664_100413073 Ga0070664_1004130732 96
133 3300005577 Ga0068857_100242266 Ga0068857_1002422664 96
134 3300005578 Ga0068854_100131714 Ga0068854_1001317143 96
135 3300005578 Ga0068854_100501279 Ga0068854_1005012792 96
136 3300005614 Ga0068856_100201670 Ga0068856_1002016702 96
137 3300005615 Ga0070702_100348681 Ga0070702_1003486811 96
138 3300005616 Ga0068852_100005901 Ga0068852_10000590117 96
139 3300005616 Ga0068852_100063610 Ga0068852_1000636104 96
140 3300005617 Ga0068859_100071884 Ga0068859_1000718849 96
141 3300005617 Ga0068859_100475781 Ga0068859_1004757813 96
142 3300005617 Ga0068859_100770303 Ga0068859_1007703031 96
143 3300005617 Ga0068859_101327482 Ga0068859_1013274822 96
144 3300005617 Ga0068859_101674306 Ga0068859_1016743061 96
145 3300005618 Ga0068864_100099102 Ga0068864_1000991022 96
146 3300005618 Ga0068864_100202147 Ga0068864_1002021472 96
147 3300005719 Ga0068861_100206870 Ga0068861_1002068703 96
148 3300005719 Ga0068861_101012345 Ga0068861_1010123452 96
149 3300005834 Ga0068851_10000476 Ga0068851_1000047639 96
150 3300005834 Ga0068851_10001359 Ga0068851_100013598 96
151 3300005840 Ga0068870_10088965 Ga0068870_100889652 96
152 3300005840 Ga0068870_10169266 Ga0068870_101692662 96
153 3300005841 Ga0068863_100000916 Ga0068863_10000091629 96
154 3300005841 Ga0068863_100073675 Ga0068863_1000736753 96
155 3300005841 Ga0068863_100085174 Ga0068863_1000851745 96
156 3300005841 Ga0068863_100322907 Ga0068863_1003229072 96
157 3300005841 Ga0068863_100336373 Ga0068863_1003363733 96
158 3300005841 Ga0068863_100406256 Ga0068863_1004062563 96
159 3300005842 Ga0068858_100037941 Ga0068858_1000379413 96
160 3300005842 Ga0068858_100981113 Ga0068858_1009811132 96
161 3300005842 Ga0068858_101131764 Ga0068858_1011317641 96
162 3300005842 Ga0068858_101942296 Ga0068858_1019422962 96
163 3300005843 Ga0068860_100001439 Ga0068860_10000143910 96
164 3300005843 Ga0068860_100004070 Ga0068860_1000040703 96
165 3300005843 Ga0068860_100006251 Ga0068860_10000625114 96
166 3300005843 Ga0068860_101049479 Ga0068860_1010494791 96
167 3300005844 Ga0068862_100011277 Ga0068862_1000112776 96
168 3300005844 Ga0068862_100104652 Ga0068862_1001046522 96
169 3300005844 Ga0068862_100149511 Ga0068862_1001495112 96
170 3300005844 Ga0068862_100345684 Ga0068862_1003456842 96
171 3300006028 Ga0070717_10633148 Ga0070717_106331482 96
172 3300006038 Ga0075365_10007356 Ga0075365_100073563 96
173 3300006042 Ga0075368_10426573 Ga0075368_104265732 96
174 3300006048 Ga0075363_100016251 Ga0075363_1000162512 96
175 3300006048 Ga0075363_100242056 Ga0075363_1002420562 96
176 3300006048 Ga0075363_100773327 Ga0075363_1007733272 96
177 3300006051 Ga0075364_10003516 Ga0075364_100035168 96
178 3300006058 Ga0075432_10019998 Ga0075432_100199982 96
179 3300006173 Ga0070716_100908045 Ga0070716_1009080452 96
180 3300006178 Ga0075367_10059577 Ga0075367_100595772 96
181 3300006178 Ga0075367_10540448 Ga0075367_105404482 96
182 3300006195 Ga0075366_10010380 Ga0075366_100103807 96
183 3300006195 Ga0075366_10019852 Ga0075366_100198523 96
184 3300006195 Ga0075366_10420009 Ga0075366_104200091 96
185 3300006237 Ga0097621_100006254 Ga0097621_10000625413 96
186 3300006237 Ga0097621_100013732 Ga0097621_1000137327 96
187 3300006237 Ga0097621_102235631 Ga0097621_1022356312 96
188 3300006353 Ga0075370_10002892 Ga0075370_1000289210 96
189 3300006353 Ga0075370_10003792 Ga0075370_100037926 96
190 3300006353 Ga0075370_10003831 Ga0075370_100038313 96
191 3300006353 Ga0075370_10004452 Ga0075370_100044526 96
192 3300006353 Ga0075370_10041438 Ga0075370_100414383 96
193 3300006358 Ga0068871_100002954 Ga0068871_10000295423 96
194 3300006358 Ga0068871_100778273 Ga0068871_1007782732 96
195 3300006844 Ga0075428_100059829 Ga0075428_1000598295 96
196 3300006844 Ga0075428_100659398 Ga0075428_1006593982 96
197 3300006846 Ga0075430_100178297 Ga0075430_1001782972 96
198 3300006846 Ga0075430_100195026 Ga0075430_1001950262 96
199 3300006847 Ga0075431_100280265 Ga0075431_1002802652 96
200 3300006847 Ga0075431_100324710 Ga0075431_1003247102 96
201 3300006847 Ga0075431_101425613 Ga0075431_1014256131 96
202 3300006852 Ga0075433_10174797 Ga0075433_101747973 96
203 3300006881 Ga0068865_100097611 Ga0068865_1000976114 96
204 3300006881 Ga0068865_100112428 Ga0068865_1001124282 96
205 3300006881 Ga0068865_100382162 Ga0068865_1003821622 96
206 3300006881 Ga0068865_101981906 Ga0068865_1019819061 96
207 3300006931 Ga0097620_100071884 Ga0097620_1000718842 96
208 3300006931 Ga0097620_100475731 Ga0097620_1004757313 96
209 3300006931 Ga0097620_100770368 Ga0097620_1007703681 96
210 3300006931 Ga0097620_101327624 Ga0097620_1013276242 96
211 3300006931 Ga0097620_101674287 Ga0097620_1016742871 96
212 3300009036 Ga0105244_10003954 Ga0105244_100039543 96
213 3300009036 Ga0105244_10026489 Ga0105244_100264894 96
214 3300009036 Ga0105244_10469483 Ga0105244_104694831 96
215 3300009093 Ga0105240_10041594 Ga0105240_100415946 96
216 3300009093 Ga0105240_10174675 Ga0105240_101746753 96
217 3300009094 Ga0111539_10219863 Ga0111539_102198632 96
218 3300009094 Ga0111539_12068630 Ga0111539_120686302 96
219 3300009098 Ga0105245_10354792 Ga0105245_103547923 96
220 3300009147 Ga0114129_11504672 Ga0114129_115046721 96
221 3300009148 Ga0105243_10000385 Ga0105243_1000038521 96
222 3300009148 Ga0105243_10030905 Ga0105243_100309057 96
223 3300009148 Ga0105243_10461052 Ga0105243_104610523 96
224 3300009148 Ga0105243_10506919 Ga0105243_105069192 96
225 3300009148 Ga0105243_10648725 Ga0105243_106487252 96
226 3300009148 Ga0105243_11010719 Ga0105243_110107191 96
227 3300009174 Ga0105241_11143763 Ga0105241_111437632 96
228 3300009176 Ga0105242_10066651 Ga0105242_100666514 96
229 3300009176 Ga0105242_10541419 Ga0105242_105414192 96
230 3300009176 Ga0105242_11319236 Ga0105242_113192362 96
231 3300009177 Ga0105248_10222563 Ga0105248_102225635 96
232 3300009177 Ga0105248_10516452 Ga0105248_105164522 96
233 3300009545 Ga0105237_10044342 Ga0105237_100443425 96
234 3300009551 Ga0105238_10519878 Ga0105238_105198782 96
235 3300009553 Ga0105249_10016212 Ga0105249_100162129 96
236 3300009553 Ga0105249_10281820 Ga0105249_102818202 96
237 3300009553 Ga0105249_10342956 Ga0105249_103429562 96
238 3300009553 Ga0105249_10796876 Ga0105249_107968761 96
239 3300010375 Ga0105239_10218755 Ga0105239_102187553 96
240 3300010375 Ga0105239_10327973 Ga0105239_103279733 96
241 3300011119 Ga0105246_10038608 Ga0105246_100386085 96
242 3300011119 Ga0105246_10256765 Ga0105246_102567652 96
243 3300011119 Ga0105246_10370212 Ga0105246_103702122 96
244 3300012512 Ga0157327_1070785 Ga0157327_10707851 96
245 3300013100 Ga0157373_10012427 Ga0157373_100124276 96
246 3300013100 Ga0157373_10057182 Ga0157373_100571822 96
247 3300013100 Ga0157373_10132012 Ga0157373_101320122 96
248 3300013102 Ga0157371_10016208 Ga0157371_100162085 96
249 3300013104 Ga0157370_10010652 Ga0157370_100106528 96
250 3300013104 Ga0157370_10145566 Ga0157370_101455662 96
251 3300013105 Ga0157369_10001788 Ga0157369_1000178810 96
252 3300013297 Ga0157378_10023616 Ga0157378_100236167 96
253 3300013297 Ga0157378_10266161 Ga0157378_102661613 96
254 3300013297 Ga0157378_10698950 Ga0157378_106989502 96
255 3300013297 Ga0157378_11332547 Ga0157378_113325472 96
256 3300013306 Ga0163162_10082115 Ga0163162_100821157 96
257 3300013306 Ga0163162_10098434 Ga0163162_100984342 96
258 3300013306 Ga0163162_10581621 Ga0163162_105816213 96
259 3300013306 Ga0163162_13195259 Ga0163162_131952591 96
260 3300013307 Ga0157372_10103425 Ga0157372_101034254 96
261 3300013308 Ga0157375_10192933 Ga0157375_101929333 96
262 3300013308 Ga0157375_10758042 Ga0157375_107580422 96
263 3300014325 Ga0163163_10360389 Ga0163163_103603892 96
264 3300014325 Ga0163163_10406154 Ga0163163_104061542 96
265 3300014326 Ga0157380_10255346 Ga0157380_102553463 96
266 3300014326 Ga0157380_10255764 Ga0157380_102557643 96
267 3300014326 Ga0157380_10300676 Ga0157380_103006763 96
268 3300014326 Ga0157380_11603350 Ga0157380_116033502 96
269 3300014326 Ga0157380_11931893 Ga0157380_119318931 96
270 3300014326 Ga0157380_13500913 Ga0157380_135009131 96
271 3300014497 Ga0182008_10000536 Ga0182008_100005369 96
272 3300014497 Ga0182008_10003506 Ga0182008_100035063 96
273 3300014497 Ga0182008_10009042 Ga0182008_100090426 96
274 3300014497 Ga0182008_10014187 Ga0182008_100141873 96
275 3300014968 Ga0157379_10035897 Ga0157379_100358974 96
276 3300014969 Ga0157376_10022402 Ga0157376_100224029 96
277 3300014969 Ga0157376_10178359 Ga0157376_101783594 96
278 3300014969 Ga0157376_10377226 Ga0157376_103772262 96
279 3300014969 Ga0157376_10536789 Ga0157376_105367892 96
280 3300014969 Ga0157376_10641213 Ga0157376_106412132 96
281 3300014969 Ga0157376_10729550 Ga0157376_107295502 96
282 3300015261 Ga0182006_1001750 Ga0182006_10017506 96
283 3300015262 Ga0182007_10000335 Ga0182007_1000033513 96
284 3300015262 Ga0182007_10017433 Ga0182007_100174333 96
285 3300015265 Ga0182005_1023710 Ga0182005_10237102 96
286 3300015265 Ga0182005_1031329 Ga0182005_10313292 96
287 3300017792 Ga0163161_10000463 Ga0163161_1000046324 96
288 3300017792 Ga0163161_10019607 Ga0163161_100196077 96
289 3300017792 Ga0163161_10027191 Ga0163161_100271917 96
290 3300017792 Ga0163161_10064169 Ga0163161_100641692 96
291 3300017792 Ga0163161_10070495 Ga0163161_100704956 96
292 3300017792 Ga0163161_10265217 Ga0163161_102652173 96
293 3300017792 Ga0163161_10566541 Ga0163161_105665412 96
294 3300025208 Ga0209436_103826 Ga0209436_1038266 96
295 3300025228 Ga0209672_101347 Ga0209672_1013476 96
296 3300025229 Ga0209147_100582 Ga0209147_1005827 96
297 3300025229 Ga0209147_118169 Ga0209147_1181692 96
298 3300025242 Ga0209258_100133 Ga0209258_100133147 96
299 3300025245 Ga0207425_1000392 Ga0207425_100039214 96
300 3300025245 Ga0207425_1021681 Ga0207425_10216812 96
301 3300025245 Ga0207425_1077659 Ga0207425_10776591 96
302 3300025254 Ga0209148_1000188 Ga0209148_100018815 96
303 3300025258 Ga0209129_1000111 Ga0209129_100011128 96
304 3300025258 Ga0209129_1000425 Ga0209129_100042528 96
305 3300025258 Ga0209129_1002392 Ga0209129_10023926 96
306 3300025263 Ga0209565_1000146 Ga0209565_100014636 96
307 3300025263 Ga0209565_1000891 Ga0209565_100089110 96
308 3300025273 Ga0209673_1000216 Ga0209673_100021694 96
309 3300025273 Ga0209673_1001323 Ga0209673_100132311 96
310 3300025273 Ga0209673_1001463 Ga0209673_100146311 96
311 3300025284 Ga0209130_1000470 Ga0209130_100047018 96
312 3300025284 Ga0209130_1000646 Ga0209130_100064624 96
313 3300025284 Ga0209130_1018482 Ga0209130_10184822 96
314 3300025291 Ga0209675_1000331 Ga0209675_100033115 96
315 3300025291 Ga0209675_1000685 Ga0209675_10006857 96
316 3300025292 Ga0209676_1000111 Ga0209676_1000111173 96
317 3300025292 Ga0209676_1000737 Ga0209676_10007375 96
318 3300025292 Ga0209676_1010159 Ga0209676_10101592 96
319 3300025292 Ga0209676_1018576 Ga0209676_10185762 96
320 3300025294 Ga0209025_1000038 Ga0209025_1000038141 96
321 3300025294 Ga0209025_1000116 Ga0209025_100011636 96
322 3300025294 Ga0209025_1000839 Ga0209025_100083928 96
323 3300025294 Ga0209025_1047744 Ga0209025_10477443 96
324 3300025295 Ga0209564_1000070 Ga0209564_1000070147 96
325 3300025295 Ga0209564_1000155 Ga0209564_100015536 96
326 3300025297 Ga0209758_1000107 Ga0209758_100010736 96
327 3300025297 Ga0209758_1154515 Ga0209758_11545152 96
328 3300025298 Ga0209050_1000111 Ga0209050_100011118 96
329 3300025298 Ga0209050_1006050 Ga0209050_10060505 96
330 3300025299 Ga0209256_1000047 Ga0209256_1000047159 96
331 3300025299 Ga0209256_1000087 Ga0209256_100008736 96
332 3300025302 Ga0207426_1000123 Ga0207426_100012336 96
333 3300025302 Ga0207426_1000194 Ga0207426_1000194118 96
334 3300025303 Ga0209051_1000160 Ga0209051_10001606 96
335 3300025303 Ga0209051_1000340 Ga0209051_100034052 96
336 3300025303 Ga0209051_1020185 Ga0209051_10201854 96
337 3300025304 Ga0209257_1000116 Ga0209257_1000116117 96
338 3300025304 Ga0209257_1000690 Ga0209257_100069018 96
339 3300025304 Ga0209257_1001961 Ga0209257_100196111 96
340 3300025315 Ga0207697_10091340 Ga0207697_100913403 96
341 3300025321 Ga0207656_10019101 Ga0207656_100191012 96
342 3300025321 Ga0207656_10256222 Ga0207656_102562222 96
343 3300025728 Ga0207655_1005419 Ga0207655_10054198 96
344 3300025893 Ga0207682_10425305 Ga0207682_104253052 96
345 3300025899 Ga0207642_10013191 Ga0207642_100131915 96
346 3300025903 Ga0207680_10063631 Ga0207680_100636315 96
347 3300025903 Ga0207680_10364063 Ga0207680_103640633 96
348 3300025903 Ga0207680_10634058 Ga0207680_106340582 96
349 3300025904 Ga0207647_10038464 Ga0207647_100384642 96
350 3300025906 Ga0207699_10085202 Ga0207699_100852022 96
351 3300025907 Ga0207645_10000063 Ga0207645_1000006372 96
352 3300025908 Ga0207643_10002613 Ga0207643_100026136 96
353 3300025910 Ga0207684_10018108 Ga0207684_100181084 96
354 3300025910 Ga0207684_10067633 Ga0207684_100676334 96
355 3300025911 Ga0207654_10257553 Ga0207654_102575532 96
356 3300025912 Ga0207707_11050342 Ga0207707_110503421 96
357 3300025913 Ga0207695_10259573 Ga0207695_102595732 96
358 3300025913 Ga0207695_10738214 Ga0207695_107382142 96
359 3300025914 Ga0207671_11142795 Ga0207671_111427952 96
360 3300025923 Ga0207681_10084152 Ga0207681_100841523 96
361 3300025923 Ga0207681_10641298 Ga0207681_106412982 96
362 3300025923 Ga0207681_10900110 Ga0207681_109001102 96
363 3300025924 Ga0207694_10391479 Ga0207694_103914792 96
364 3300025924 Ga0207694_11838009 Ga0207694_118380091 96
365 3300025926 Ga0207659_10090098 Ga0207659_100900982 96
366 3300025929 Ga0207664_10136832 Ga0207664_101368323 96
367 3300025929 Ga0207664_10162245 Ga0207664_101622453 96
368 3300025929 Ga0207664_10383384 Ga0207664_103833842 96
369 3300025931 Ga0207644_10117927 Ga0207644_101179274 96
370 3300025932 Ga0207690_10044527 Ga0207690_100445272 96
371 3300025932 Ga0207690_11514418 Ga0207690_115144182 96
372 3300025933 Ga0207706_10006703 Ga0207706_100067035 96
373 3300025933 Ga0207706_10044723 Ga0207706_100447235 96
374 3300025934 Ga0207686_10821858 Ga0207686_108218582 96
375 3300025935 Ga0207709_10000908 Ga0207709_100009082 96
376 3300025935 Ga0207709_10000999 Ga0207709_1000099927 96
377 3300025935 Ga0207709_10441961 Ga0207709_104419612 96
378 3300025935 Ga0207709_11111723 Ga0207709_111117232 96
379 3300025935 Ga0207709_11592318 Ga0207709_115923181 96
380 3300025936 Ga0207670_10358409 Ga0207670_103584092 96
381 3300025937 Ga0207669_10642368 Ga0207669_106423683 96
382 3300025937 Ga0207669_11068025 Ga0207669_110680251 96
383 3300025937 Ga0207669_11651870 Ga0207669_116518702 96
384 3300025938 Ga0207704_10904676 Ga0207704_109046762 96
385 3300025938 Ga0207704_11456483 Ga0207704_114564832 96
386 3300025940 Ga0207691_10000050 Ga0207691_10000050111 96
387 3300025940 Ga0207691_10028829 Ga0207691_100288292 96
388 3300025941 Ga0207711_12050503 Ga0207711_120505032 96
389 3300025942 Ga0207689_10006256 Ga0207689_100062569 96
390 3300025942 Ga0207689_10054834 Ga0207689_100548344 96
391 3300025942 Ga0207689_10138695 Ga0207689_101386954 96
392 3300025945 Ga0207679_10382060 Ga0207679_103820603 96
393 3300025945 Ga0207679_11474079 Ga0207679_114740792 96
394 3300025949 Ga0207667_10225711 Ga0207667_102257113 96
395 3300025949 Ga0207667_10407289 Ga0207667_104072893 96
396 3300025949 Ga0207667_11933002 Ga0207667_119330021 96
397 3300025960 Ga0207651_10107999 Ga0207651_101079995 96
398 3300025960 Ga0207651_10552222 Ga0207651_105522222 96
399 3300025960 Ga0207651_10553457 Ga0207651_105534572 96
400 3300025972 Ga0207668_10008210 Ga0207668_1000821012 96
401 3300025972 Ga0207668_10202559 Ga0207668_102025594 96
402 3300025972 Ga0207668_10429781 Ga0207668_104297811 96
403 3300025981 Ga0207640_10095743 Ga0207640_100957432 96
404 3300025981 Ga0207640_10098902 Ga0207640_100989023 96
405 3300025981 Ga0207640_10858070 Ga0207640_108580701 96
406 3300025986 Ga0207658_10179543 Ga0207658_101795432 96
407 3300025986 Ga0207658_10873589 Ga0207658_108735892 96
408 3300026023 Ga0207677_10005833 Ga0207677_100058334 96
409 3300026023 Ga0207677_10516240 Ga0207677_105162401 96
410 3300026035 Ga0207703_10056601 Ga0207703_100566013 96
411 3300026035 Ga0207703_10401682 Ga0207703_104016822 96
412 3300026035 Ga0207703_10655311 Ga0207703_106553112 96
413 3300026041 Ga0207639_11031123 Ga0207639_110311231 96
414 3300026067 Ga0207678_10001056 Ga0207678_1000105617 96
415 3300026075 Ga0207708_10506496 Ga0207708_105064962 96
416 3300026078 Ga0207702_10931580 Ga0207702_109315802 96
417 3300026088 Ga0207641_10000209 Ga0207641_1000020953 96
418 3300026088 Ga0207641_10076996 Ga0207641_100769963 96
419 3300026088 Ga0207641_10132443 Ga0207641_101324433 96
420 3300026088 Ga0207641_10213791 Ga0207641_102137912 96
421 3300026088 Ga0207641_11294334 Ga0207641_112943341 96
422 3300026088 Ga0207641_12019261 Ga0207641_120192612 96
423 3300026089 Ga0207648_10004317 Ga0207648_1000431720 96
424 3300026089 Ga0207648_10179434 Ga0207648_101794342 96
425 3300026095 Ga0207676_10051656 Ga0207676_100516561 96
426 3300026095 Ga0207676_10175419 Ga0207676_101754192 96
427 3300026116 Ga0207674_10036499 Ga0207674_100364992 96
428 3300026116 Ga0207674_10045766 Ga0207674_100457662 96
429 3300026116 Ga0207674_10325364 Ga0207674_103253642 96
430 3300026118 Ga0207675_100186394 Ga0207675_1001863943 96
431 3300026121 Ga0207683_10000521 Ga0207683_1000052151 96
432 3300026121 Ga0207683_10257464 Ga0207683_102574643 96
433 3300026121 Ga0207683_10429045 Ga0207683_104290451 96
434 3300026121 Ga0207683_10606341 Ga0207683_106063411 96
435 3300026121 Ga0207683_11178865 Ga0207683_111788652 96
436 3300026142 Ga0207698_10649119 Ga0207698_106491192 96
437 3300027665 Ga0209983_1166647 Ga0209983_11666471 96
438 3300027717 Ga0209998_10203859 Ga0209998_102038591 96
439 3300027866 Ga0209813_10349111 Ga0209813_103491112 96
440 3300027907 Ga0207428_10176707 Ga0207428_101767073 96
441 3300027907 Ga0207428_10281367 Ga0207428_102813672 96
442 3300027907 Ga0207428_10358649 Ga0207428_103586492 96
443 3300028379 Ga0268266_10735694 Ga0268266_107356942 96
444 3300028379 Ga0268266_12172749 Ga0268266_121727491 96
445 3300028380 Ga0268265_10007450 Ga0268265_100074506 96
446 3300028380 Ga0268265_10144891 Ga0268265_101448913 96
447 3300028381 Ga0268264_10000156 Ga0268264_10000156129 96
448 3300028381 Ga0268264_10034834 Ga0268264_100348342 96
449 3300028381 Ga0268264_10040180 Ga0268264_100401803 96
450 3300028794 Ga0307515_10439307 Ga0307515_104393071 96
451 3300030731 Ga0316177_1084928 Ga0316177_10849282 96
452 3300030732 Ga0316176_1099510 Ga0316176_10995103 96
453 3300030733 Ga0314311_1080241 Ga0314311_108024113 96
454 3300030734 Ga0316179_1006693 Ga0316179_10066932 96
455 3300030742 Ga0316183_1006724 Ga0316183_100672413 96
456 3300030744 Ga0316181_1015734 Ga0316181_10157343 96
457 3300030745 Ga0316182_1257738 Ga0316182_12577381 96
458 3300031235 Ga0265330_10132895 Ga0265330_101328952 96
459 3300031241 Ga0265325_10471501 Ga0265325_104715011 96
460 3300031247 Ga0265340_10033047 Ga0265340_100330472 96
461 3300031251 Ga0265327_10000201 Ga0265327_100002019 96
462 3300031251 Ga0265327_10349086 Ga0265327_103490862 96
463 3300031548 Ga0307408_100071027 Ga0307408_1000710272 96
464 3300031548 Ga0307408_100255483 Ga0307408_1002554833 96
465 3300031548 Ga0307408_100342912 Ga0307408_1003429123 96
466 3300031548 Ga0307408_101492458 Ga0307408_1014924582 96
467 3300031595 Ga0265313_10320421 Ga0265313_103204212 96
468 3300031616 Ga0307508_10262257 Ga0307508_102622572 96
469 3300031731 Ga0307405_10050963 Ga0307405_100509631 96
470 3300031731 Ga0307405_10148692 Ga0307405_101486922 96
471 3300031731 Ga0307405_10338528 Ga0307405_103385282 96
472 3300031731 Ga0307405_10551271 Ga0307405_105512712 96
473 3300031731 Ga0307405_10651298 Ga0307405_106512981 96
474 3300031731 Ga0307405_11904794 Ga0307405_119047942 96
475 3300031824 Ga0307413_10146049 Ga0307413_101460493 96
476 3300031824 Ga0307413_10741604 Ga0307413_107416041 96
477 3300031824 Ga0307413_10898878 Ga0307413_108988781 96
478 3300031852 Ga0307410_10037217 Ga0307410_100372174 96
479 3300031852 Ga0307410_10363308 Ga0307410_103633083 96
480 3300031903 Ga0307407_10126527 Ga0307407_101265272 96
481 3300031911 Ga0307412_10026505 Ga0307412_100265053 96
482 3300031911 Ga0307412_10136737 Ga0307412_101367373 96
483 3300031911 Ga0307412_12172092 Ga0307412_121720922 96
484 3300031995 Ga0307409_101133016 Ga0307409_1011330162 96
485 3300031995 Ga0307409_102004386 Ga0307409_1020043862 96
486 3300032002 Ga0307416_100023276 Ga0307416_1000232762 96
487 3300032002 Ga0307416_100097232 Ga0307416_1000972322 96
488 3300032004 Ga0307414_10083717 Ga0307414_100837174 96
489 3300032004 Ga0307414_10453413 Ga0307414_104534131 96
490 3300032004 Ga0307414_12218495 Ga0307414_122184951 96
491 3300032005 Ga0307411_10070123 Ga0307411_100701232 96
492 3300032005 Ga0307411_10238595 Ga0307411_102385952 96
493 3300032126 Ga0307415_100031282 Ga0307415_1000312822 96
494 3300032126 Ga0307415_100303972 Ga0307415_1003039723 96
495 3300033180 Ga0307510_10121976 Ga0307510_101219763 96
496 3300035112 Ga0373932_0076826 Ga0373932_0076826_509_799 96
497 3300035117 Ga0373953_0186054 Ga0373953_0186054_300_590 96
498 3300035118 Ga0373954_0137075 Ga0373954_0137075_498_788 96
499 3300035119 Ga0373956_0066624 Ga0373956_0066624_654_944 96
500 3300035691 Ga0373931_0142836 Ga0373931_0142836_646_936 96
501 3300035724 Ga0373933_0826479 Ga0373933_0826479_204_497 96
502 3300035725 Ga0373947_0876770 Ga0373947_0876770_250_540 96
503 3300036401 Ga0373937_0090487 Ga0373937_0090487_1315_1605 96
504 3300036401 Ga0373937_2135776 Ga0373937_2135776_130_420 96
505 3300039438 Ga0436360_0282104 Ga0436360_0282104_51_341 96
506 3300039438 Ga0436360_1221163 Ga0436360_1221163_98_391 96
507 3300041406 Ga0439439_0025543 Ga0439439_0025543_649_939 96
508 3300041407 Ga0439447_007672 Ga0439447_007672_205_525 96
509 3300041410 Ga0439461_0060469 Ga0439461_0060469_13_333 96
510 3300041411 Ga0439466_0007112 Ga0439466_0007112_3581_3901 96
511 3300041411 Ga0439466_0226591 Ga0439466_0226591_119_409 96
512 3300041413 Ga0439465_0000026 Ga0439465_0000026_8114_8434 96
513 3300041451 Ga0451791_0356159 Ga0451791_0356159_36_326 96
514 3300041453 Ga0451797_0720147 Ga0451797_0720147_210_500 96
515 3300041458 Ga0451798_0431473 Ga0451798_0431473_385_675 96
516 3300041460 Ga0451802_0534293 Ga0451802_0534293_137_427 96
517 3300041463 Ga0451804_0836606 Ga0451804_0836606_130_420 96
518 3300041509 Ga0451843_0811403 Ga0451843_0811403_394_687 96
519 3300041997 Ga0439431_0000034 Ga0439431_0000034_10330_10650 96
520 3300041999 Ga0439433_0000067 Ga0439433_0000067_10831_11151 96
521 3300042002 Ga0439442_040654 Ga0439442_040654_380_670 96
522 3300042002 Ga0439442_143893 Ga0439442_143893_185_505 96
523 3300042004 Ga0439445_0000146 Ga0439445_0000146_6532_6852 96
524 3300042005 Ga0439448_0345253 Ga0439448_0345253_180_473 96
525 3300042006 Ga0439432_000206 Ga0439432_000206_12128_12448 96
526 3300042006 Ga0439432_023763 Ga0439432_023763_607_897 96
527 3300042007 Ga0439449_0000276 Ga0439449_0000276_6294_6614 96
528 3300042010 Ga0439452_000641 Ga0439452_000641_6394_6714 96
529 3300042014 Ga0439457_007265 Ga0439457_007265_1273_1593 96
530 3300042015 Ga0439462_0001588 Ga0439462_0001588_1361_1681 96
531 3300042127 Ga0450890_029398 Ga0450890_029398_270_590 96
532 3300042156 Ga0439446_0016088 Ga0439446_0016088_1077_1397 96
533 3300042184 Ga0450908_068025 Ga0450908_068025_35_325 96
534 3300042184 Ga0450908_105298 Ga0450908_105298_132_422 96
535 3300042435 Ga0439434_0000300 Ga0439434_0000300_8100_8420 96
536 3300042461 Ga0439460_0113670 Ga0439460_0113670_192_485 96
537 3300042876 Ga0451577_0246794 Ga0451577_0246794_263_553 96
538 3300042876 Ga0451577_0802576 Ga0451577_0802576_532_825 96
539 3300044673 Ga0453683_0237426 Ga0453683_0237426_758_1051 96
540 3300044684 Ga0466966_0038431 Ga0466966_0038431_219_512 96
541 3300044712 Ga0453684_0809694 Ga0453684_0809694_270_563 96
542 3300045049 Ga0466959_0361590 Ga0466959_0361590_16_309 96
543 3300045051 Ga0451576_0070615 Ga0451576_0070615_1126_1416 96
544 3300045836 Ga0466958_0220832 Ga0466958_0220832_700_993 96
545 3300046453 Ga0495627_053601 Ga0495627_053601_332_694 96
546 3300046460 Ga0495638_0024101 Ga0495638_0024101_3546_3836 96
547 3300046462 Ga0495651_0023107 Ga0495651_0023107_3863_4153 96
548 3300046462 Ga0495651_0150536 Ga0495651_0150536_1030_1320 96
549 3300046462 Ga0495651_0333253 Ga0495651_0333253_20_310 96
550 3300046463 Ga0495653_0535951 Ga0495653_0535951_391_681 96
551 3300046472 Ga0495580_0000672 Ga0495580_0000672_27594_27884 96
552 3300046475 Ga0495639_0011620 Ga0495639_0011620_3461_3751 96
553 3300046512 Ga0495610_0181380 Ga0495610_0181380_399_689 96
554 3300046513 Ga0495616_0002482 Ga0495616_0002482_5096_5386 96
555 3300046516 Ga0495628_0589734 Ga0495628_0589734_195_485 96
556 3300046517 Ga0495630_0262677 Ga0495630_0262677_572_862 96
557 3300046518 Ga0495631_0000067 Ga0495631_0000067_24633_24923 96
558 3300046520 Ga0495637_0035666 Ga0495637_0035666_1578_1868 96
559 3300046520 Ga0495637_0189766 Ga0495637_0189766_106_396 96
560 3300046525 Ga0495663_0034282 Ga0495663_0034282_930_1220 96
561 3300046525 Ga0495663_0315357 Ga0495663_0315357_21_311 96
562 3300046530 Ga0495654_0269455 Ga0495654_0269455_70_360 96
563 3300046533 Ga0495640_0332975 Ga0495640_0332975_339_629 96
564 3300046536 Ga0495587_0399485 Ga0495587_0399485_354_644 96
565 3300046537 Ga0495598_0051908 Ga0495598_0051908_145_435 96
566 3300046539 Ga0495621_0001559 Ga0495621_0001559_5531_5821 96
567 3300046539 Ga0495621_0049535 Ga0495621_0049535_912_1202 96
568 3300046543 Ga0495645_0864662 Ga0495645_0864662_58_348 96
569 3300046557 Ga0495622_0081789 Ga0495622_0081789_252_542 96
570 3300046557 Ga0495622_0179473 Ga0495622_0179473_610_900 96
571 3300046615 Ga0495656_0013202 Ga0495656_0013202_2283_2573 96
572 3300046615 Ga0495656_0168454 Ga0495656_0168454_302_592 96
573 3300046616 Ga0495668_0026483 Ga0495668_0026483_2431_2721 96
574 3300046660 Ga0495625_0028048 Ga0495625_0028048_1704_1994 96
575 3300046663 Ga0495635_0213555 Ga0495635_0213555_766_1056 96
576 3300046663 Ga0495635_0571414 Ga0495635_0571414_138_428 96
577 3300046674 Ga0495588_0021323 Ga0495588_0021323_1193_1483 96
578 3300046678 Ga0495599_0218190 Ga0495599_0218190_31_321 96
579 3300046678 Ga0495599_0357989 Ga0495599_0357989_151_441 96
580 3300046689 Ga0495613_0811042 Ga0495613_0811042_82_372 96
581 3300046690 Ga0495624_0283854 Ga0495624_0283854_434_724 96
582 3300046691 Ga0495670_0207703 Ga0495670_0207703_478_768 96
583 3300046809 Ga0495600_0105196 Ga0495600_0105196_207_497 96
584 3300046809 Ga0495600_0488630 Ga0495600_0488630_119_409 96
585 3300047320 Ga0495672_0159662 Ga0495672_0159662_424_786 96
586 3300047321 Ga0495676_0066940 Ga0495676_0066940_2404_2694 96
587 3300047321 Ga0495676_0774580 Ga0495676_0774580_88_378 96
588 3300047447 Ga0495685_225916 Ga0495685_225916_226_516 96
589 3300047673 Ga0495593_0064869 Ga0495593_0064869_173_463 96
590 3300048088 Ga0495602_0087988 Ga0495602_0087988_233_523 96
591 3300048088 Ga0495602_0379564 Ga0495602_0379564_496_786 96
592 3300048089 Ga0495614_0021458 Ga0495614_0021458_942_1232 96
593 3300048089 Ga0495614_0532699 Ga0495614_0532699_227_517 96
594 3300048090 Ga0495615_0027097 Ga0495615_0027097_233_523 96
595 3300048903 Ga0496100_1555572 Ga0496100_1555572_161_451 96
596 3300048904 Ga0496101_0001086 Ga0496101_0001086_6306_6596 96
597 3300048905 Ga0496102_0042589 Ga0496102_0042589_3656_3946 96
598 3300048905 Ga0496102_0265668 Ga0496102_0265668_141_431 96
599 3300048907 Ga0496104_0005610 Ga0496104_0005610_3035_3325 96
600 3300048908 Ga0496105_0001424 Ga0496105_0001424_8991_9281 96
601 3300048908 Ga0496105_0702357 Ga0496105_0702357_467_757 96
602 3300048908 Ga0496105_1044442 Ga0496105_1044442_157_447 96
603 3300048909 Ga0496106_1142782 Ga0496106_1142782_62_352 96
604 3300048911 Ga0496108_0095496 Ga0496108_0095496_59_349 96
605 3300048912 Ga0496109_0107726 Ga0496109_0107726_97_387 96
606 3300048912 Ga0496109_0115216 Ga0496109_0115216_2138_2428 96
607 3300048913 Ga0496110_0002674 Ga0496110_0002674_9926_10216 96
608 3300048913 Ga0496110_0007149 Ga0496110_0007149_4586_4876 96
609 3300048914 Ga0496111_0064162 Ga0496111_0064162_1606_1896 96
610 3300048914 Ga0496111_0965973 Ga0496111_0965973_163_453 96
611 3300048916 Ga0496113_0434686 Ga0496113_0434686_421_711 96
612 3300048917 Ga0496114_0220098 Ga0496114_0220098_727_1017 96
613 3300048917 Ga0496114_0747687 Ga0496114_0747687_540_830 96
614 3300048918 Ga0496115_0496142 Ga0496115_0496142_453_743 96
615 3300048919 Ga0496116_0068756 Ga0496116_0068756_445_735 96
616 3300048920 Ga0496117_0036021 Ga0496117_0036021_1340_1630 96
617 3300048921 Ga0496118_0007548 Ga0496118_0007548_4610_4900 96
618 3300048921 Ga0496118_0361559 Ga0496118_0361559_128_418 96
619 3300048921 Ga0496118_0437111 Ga0496118_0437111_61_351 96
620 3300048922 Ga0496119_0007290 Ga0496119_0007290_5508_5798 96
621 3300048922 Ga0496119_0163193 Ga0496119_0163193_618_908 96
622 3300048923 Ga0496120_0113633 Ga0496120_0113633_593_883 96
623 3300048924 Ga0496121_0056893 Ga0496121_0056893_615_905 96
624 3300048924 Ga0496121_0078212 Ga0496121_0078212_605_1054 96
625 3300048924 Ga0496121_0271151 Ga0496121_0271151_616_906 96
626 3300048924 Ga0496121_0687756 Ga0496121_0687756_92_382 96
627 3300048925 Ga0496122_0001985 Ga0496122_0001985_27680_27970 96
628 3300048925 Ga0496122_0007594 Ga0496122_0007594_3071_3433 96
629 3300048925 Ga0496122_0050320 Ga0496122_0050320_2322_2612 96
630 3300048925 Ga0496122_0188718 Ga0496122_0188718_671_961 96
631 3300048926 Ga0496123_0011920 Ga0496123_0011920_2464_2754 96
632 3300048926 Ga0496123_0013891 Ga0496123_0013891_894_1184 96
633 3300048926 Ga0496123_0127542 Ga0496123_0127542_309_599 96
634 3300048927 Ga0496124_0004029 Ga0496124_0004029_1362_1652 96
635 3300048927 Ga0496124_0020609 Ga0496124_0020609_2911_3216 96
636 3300048928 Ga0496125_0020118 Ga0496125_0020118_3608_3898 96
637 3300048928 Ga0496125_0525422 Ga0496125_0525422_261_551 96
638 3300049571 Ga0501034_0290922 Ga0501034_0290922_1216_1506 96
639 3300049575 Ga0501039_0426431 Ga0501039_0426431_373_666 96
640 3300049575 Ga0501039_0627896 Ga0501039_0627896_467_760 96
641 3300049580 Ga0501046_1236081 Ga0501046_1236081_116_409 96
642 3300049587 Ga0501071_1310056 Ga0501071_1310056_175_468 96
643 3300049588 Ga0501072_0114790 Ga0501072_0114790_1272_1565 96
644 3300049591 Ga0501075_1018021 Ga0501075_1018021_166_459 96
645 3300049592 Ga0501076_0107024 Ga0501076_0107024_1882_2175 96
646 3300049592 Ga0501076_0442989 Ga0501076_0442989_74_367 96
647 3300049592 Ga0501076_0555452 Ga0501076_0555452_318_611 96
648 3300049665 Ga0501227_157031 Ga0501227_157031_160_450 96
649 3300049671 Ga0501238_012789 Ga0501238_012789_376_666 96
650 3300049743 Ga0501081_0333953 Ga0501081_0333953_145_441 96
651 3300049744 Ga0501083_0561696 Ga0501083_0561696_266_556 96
652 3300049758 Ga0501241_098697 Ga0501241_098697_212_502 96
653 3300050489 nmdc:mga03683_307380_c1 nmdc:mga03683_307380_c1_105_395 96
654 3300050490 nmdc:mga03n38_15066_c1 nmdc:mga03n38_15066_c1_525_815 96
655 3300050490 nmdc:mga03n38_88249_c1 nmdc:mga03n38_88249_c1_1053_1343 96
656 3300050491 nmdc:mga00v17_13311_c1 nmdc:mga00v17_13311_c1_232_522 96
657 3300050491 nmdc:mga00v17_462008_c1 nmdc:mga00v17_462008_c1_45_335 96
658 3300050492 nmdc:mga0yw44_1462_c1 nmdc:mga0yw44_1462_c1_8019_8309 96
659 3300050493 nmdc:mga0k408_117191_c1 nmdc:mga0k408_117191_c1_61_351 96
660 3300050493 nmdc:mga0k408_256707_c1 nmdc:mga0k408_256707_c1_417_707 96
661 3300050493 nmdc:mga0k408_3020_c1 nmdc:mga0k408_3020_c1_4915_5205 96
662 3300050493 nmdc:mga0k408_373780_c1 nmdc:mga0k408_373780_c1_522_812 96
663 3300050494 nmdc:mga06z11_222786_c1 nmdc:mga06z11_222786_c1_355_645 96
664 3300050494 nmdc:mga06z11_299145_c1 nmdc:mga06z11_299145_c1_263_553 96
665 3300050494 nmdc:mga06z11_43894_c1 nmdc:mga06z11_43894_c1_474_764 96
666 3300050494 nmdc:mga06z11_732382_c1 nmdc:mga06z11_732382_c1_216_506 96
667 3300050496 nmdc:mga07m45_107421_c1 nmdc:mga07m45_107421_c1_819_1109 96
668 3300050496 nmdc:mga07m45_10975_c1 nmdc:mga07m45_10975_c1_73_363 96
669 3300050496 nmdc:mga07m45_3692_c2 nmdc:mga07m45_3692_c2_1429_1719 96
670 3300050496 nmdc:mga07m45_61979_c1 nmdc:mga07m45_61979_c1_873_1163 96
671 3300050496 nmdc:mga07m45_7175_c1 nmdc:mga07m45_7175_c1_4940_5230 96
672 3300050496 nmdc:mga07m45_809909_c1 nmdc:mga07m45_809909_c1_150_440 96
673 3300050507 nmdc:mga05p37_1075729_c1 nmdc:mga05p37_1075729_c1_324_617 96
674 3300050507 nmdc:mga05p37_515_c1 nmdc:mga05p37_515_c1_12366_12659 96
675 3300050508 nmdc:mga09592_100270_c1 nmdc:mga09592_100270_c1_449_742 96
676 3300050509 nmdc:mga0qj67_274983_c1 nmdc:mga0qj67_274983_c1_340_639 96
677 3300050509 nmdc:mga0qj67_32999_c1 nmdc:mga0qj67_32999_c1_1551_1844 96
678 3300050510 nmdc:mga06r32_1360753_c1 nmdc:mga06r32_1360753_c1_44_337 96
679 3300050510 nmdc:mga06r32_27384_c1 nmdc:mga06r32_27384_c1_3854_4150 96
680 3300050510 nmdc:mga06r32_28_c1 nmdc:mga06r32_28_c1_19716_20009 96
681 3300050510 nmdc:mga06r32_460826_c1 nmdc:mga06r32_460826_c1_236_544 96
682 3300050511 nmdc:mga08y16_124_c2 nmdc:mga08y16_124_c2_29667_29960 96
683 3300050511 nmdc:mga08y16_31708_c1 nmdc:mga08y16_31708_c1_2024_2323 96
684 3300050512 nmdc:mga0n895_12706_c1 nmdc:mga0n895_12706_c1_1328_1618 96
685 3300050512 nmdc:mga0n895_32298_c1 nmdc:mga0n895_32298_c1_1146_1436 96
686 3300050512 nmdc:mga0n895_84346_c1 nmdc:mga0n895_84346_c1_2637_2927 96
687 3300050513 nmdc:mga0rr50_184085_c1 nmdc:mga0rr50_184085_c1_1384_1674 96
688 3300050513 nmdc:mga0rr50_64150_c1 nmdc:mga0rr50_64150_c1_1597_1887 96
689 3300050513 nmdc:mga0rr50_803324_c1 nmdc:mga0rr50_803324_c1_337_627 96
690 3300050514 nmdc:mga08x19_349404_c1 nmdc:mga08x19_349404_c1_233_526 96
691 3300050515 nmdc:mga0a205_152492_c1 nmdc:mga0a205_152492_c1_147_437 96
692 3300050516 nmdc:mga0sz30_478830_c1 nmdc:mga0sz30_478830_c1_216_506 96
693 3300050516 nmdc:mga0sz30_61358_c1 nmdc:mga0sz30_61358_c1_1033_1326 96
694 3300053079 Ga0500610_0005809 Ga0500610_0005809_926_1216 96
695 3300053087 Ga0500643_002697 Ga0500643_002697_2425_2715 96
696 3300053093 Ga0500651_0000040 Ga0500651_0000040_22820_23110 96
697 3300053094 Ga0500566_0030418 Ga0500566_0030418_1153_1443 96
698 3300053096 Ga0500641_0020396 Ga0500641_0020396_602_892 96
699 3300053107 Ga0500560_202416 Ga0500560_202416_297_587 96
700 3300053108 Ga0500562_003280 Ga0500562_003280_3556_3846 96
701 3300053110 Ga0500571_000361 Ga0500571_000361_6391_6681 96
702 3300053111 Ga0500572_040610 Ga0500572_040610_923_1213 96
703 3300053118 Ga0500594_0005565 Ga0500594_0005565_2238_2528 96
704 3300053120 Ga0500597_131211 Ga0500597_131211_654_944 96
705 3300053122 Ga0500608_013301 Ga0500608_013301_2281_2571 96
706 3300053125 Ga0500618_096093 Ga0500618_096093_356_646 96
707 3300053128 Ga0500626_026523 Ga0500626_026523_654_944 96
708 3300053133 Ga0500655_000193 Ga0500655_000193_3281_3571 96
709 3300053134 Ga0500658_0000095 Ga0500658_0000095_22116_22406 96
710 3300053134 Ga0500658_0000122 Ga0500658_0000122_21064_21354 96
711 3300053136 Ga0500559_0004405 Ga0500559_0004405_4738_5028 96
712 3300053138 Ga0500564_023889 Ga0500564_023889_1392_1682 96
713 3300053139 Ga0500568_0000569 Ga0500568_0000569_9959_10249 96
714 3300053140 Ga0500573_0212992 Ga0500573_0212992_136_426 96
715 3300053141 Ga0500574_002739 Ga0500574_002739_2610_2900 96
716 3300053141 Ga0500574_003374 Ga0500574_003374_1975_2265 96
717 3300053151 Ga0500604_0154337 Ga0500604_0154337_319_609 96
718 3300053153 Ga0500616_0308902 Ga0500616_0308902_345_635 96
719 3300053154 Ga0500619_241441 Ga0500619_241441_189_479 96
720 3300053157 Ga0500624_018686 Ga0500624_018686_210_500 96
721 3300053161 Ga0500634_0000914 Ga0500634_0000914_2320_2610 96
722 3300053162 Ga0500638_056159 Ga0500638_056159_1328_1618 96
723 3300053177 Ga0500636_0023537 Ga0500636_0023537_1377_1667 96
724 3300053734 Ga0500565_040940 Ga0500565_040940_329_619 96
725 iso_pu_bacteria 2885192300 2885195675 96

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07045

DUF1330

Domain of unknown function (DUF1330)

27

120

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fiu-assembly1.cif.gz_B crystal structure of the conserved protein of unknown function atu0297 from agrobacterium tumefaciens 0.9382 1 96
3lo3-assembly2.cif.gz_C the crystal structure of a conserved functionally unknown protein from colwellia psychrerythraea 34h. 0.9012 3 93
3lo3-assembly2.cif.gz_C the crystal structure of a conserved functionally unknown protein from colwellia psychrerythraea 34h. 0.8571 3 93
3hhl-assembly2.cif.gz_C crystal structure of methylated rpa0582 protein 0.7663 2 96
3dca-assembly2.cif.gz_D crystal structure of the rpa0582- protein of unknown function from rhodopseudomonas palustris- a structural genomics target 0.7543 2 96
ID Description Score Start End Superfamily
2fiuB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9034 3 96 3.30.70.100
3lo3U00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8832 3 93 3.30.70.100
2fiuB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8763 3 96 3.30.70.100
3lo3U00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8402 3 93 3.30.70.100
af_Q54CJ9_3_103_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7379 1 94 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A6J4NLL1-F1-model_v4 DUF1330 domain-containing protein 1.001 3 96
AF-A0A537FW42-F1-model_v4 DUF1330 domain-containing protein 0.9992 1 96
AF-A0A7Y9J7Z7-F1-model_v4 Uncharacterized protein (DUF1330 family) 0.9936 3 96
AF-A0A6J4H4X6-F1-model_v4 DUF1330 domain-containing protein 0.9929 1 96
AF-A0A6M4FJN2-F1-model_v4 DUF1330 domain-containing protein 0.9905 1 96

Feature Viewer

pLDDT pTM Quality
96.29 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map