F477625

General Info

Members Datasets Scaffolds Average Seq Length
725 387 1450 316

Family's Representative Sequence

Representative Sequence 3300036401|Ga0373937_0034749|Ga0373937_0034749_1268_2227
Length 319
Sequence MRIGVMLGPERGRYATKVERLRSDARWAEEAGLSSVWIPQIPDEFDALTAATVAADVTSRIEIGTAVVPIQTRHPIAMAQQALSVQAVAEGRLALGLGVSHHWVVTEMLGLPYEHLAPLMRDYLEALAPALAGPGPGLVDVKNDTFRIKNPIDITDITPNPVLIAALGPAMLRLAGSHTDGTILWLADERAIGSHVVPRLTAAAESAGRPAPRVVAGVPVCLCADDEIDEATARTNKLLSEAEVSPNYQKLLDLGDARVIGDILAAGSEASIEKRLQSFADAGTTDVSVRVVPIGKDRDERLASSKRTRDYLASLQGSL

Samples

Sample ID Description Type Environment
1 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
54 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
57 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
97 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
98 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
99 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
145 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
146 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
147 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
148 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
149 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
150 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
151 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
152 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
153 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
154 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
155 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
156 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
157 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
158 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
159 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
160 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
161 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
162 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
163 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
164 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
165 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
166 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
167 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
168 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
169 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
170 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
171 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
172 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
173 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
174 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
175 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
177 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
178 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
179 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
180 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
181 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
182 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
183 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
184 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
185 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
186 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
187 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
188 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
189 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
190 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
191 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
192 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
193 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
194 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
195 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
196 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
197 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
198 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
199 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
200 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
201 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
202 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
203 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
204 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
205 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
206 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
207 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
208 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
209 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
210 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
211 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
212 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
213 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
214 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
215 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
216 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
217 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
218 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
219 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
220 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
221 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
222 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
223 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
224 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
225 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
226 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
227 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
228 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
229 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
230 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
231 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
232 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
233 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
234 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
235 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
236 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
237 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
238 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
239 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
240 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
241 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
242 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
243 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
244 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
245 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
246 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
247 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
248 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
249 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
250 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
251 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
252 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
253 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
254 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
255 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
256 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
257 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
258 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
259 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
260 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
261 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
262 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
263 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
264 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
265 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
266 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
267 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
268 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
269 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
270 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
271 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
272 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
273 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
274 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
275 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
276 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
277 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
278 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
279 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
280 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
281 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
282 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
283 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
284 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
285 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
286 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
287 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
288 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
289 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
290 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
304 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
305 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
306 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
307 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
308 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
309 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
310 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
311 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
312 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
313 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
314 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
315 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
316 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
317 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
320 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
321 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
322 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
323 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
324 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
325 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
326 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
327 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
328 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
329 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
330 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
331 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
332 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
333 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
334 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
335 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
336 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
337 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
338 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
339 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
340 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
341 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
342 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
343 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
344 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
345 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
346 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
347 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
348 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
349 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
350 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
351 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
352 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
353 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
354 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
355 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
356 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
357 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
358 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
359 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
360 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
361 2508501039 Frankia saprophytica CN3 Isolate Nodule
362 2517572101 Frankia sp. DC12 Isolate Nodule
363 2547132424 Nocardia nova SH22a Isolate Unclassified
364 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
365 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
366 2643221692 Nocardia sp. Root136 Isolate Unclassified
367 2671180195 Frankia sp. CcI49 Isolate Nodule
368 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
369 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
370 2687453737 Frankia sp. BMG5.36 Isolate Nodule
371 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
372 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
373 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
374 2773857922 Frankia sp. CcI49 Isolate Nodule
375 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
376 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
377 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
378 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
379 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
380 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
381 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
382 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
383 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
384 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
385 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
386 8002775197 Frankia nepalensis CN7 Isolate Nodule
387 8002784119 Frankia sp. AgB1.9 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.28
Metatranscriptomes 0
Isolates 3.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12
Nodule 1.66
Rhizoplane 4.41
Rhizosphere 74.34
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373937_0034749 3300036401 Bacteria 4584
2 JGI24743J22301_10003191 3300001991 Bacteria 2569
3 JGI24738J21930_10010731 3300002075 Bacteria 2031
4 JGI24744J21845_10000043 3300002077 Bacteria 14405
5 JGI24742J22300_10001363 3300002244 Bacteria 3841
6 JGI25407J50210_10005095 3300003373 Bacteria 3220
7 Ga0070683_100159646 3300005329 Bacteria 2139
8 Ga0068869_100091287 3300005334 Bacteria 2291
9 Ga0070682_100274991 3300005337 Bacteria 1225
10 Ga0068868_100000580 3300005338 Bacteria 24531
11 Ga0068868_100007544 3300005338 Bacteria 7747
12 Ga0070668_100006775 3300005347 Bacteria 8494
13 Ga0070669_100026800 3300005353 Bacteria 4147
14 Ga0070671_100333475 3300005355 Bacteria 1293
15 Ga0070674_100014153 3300005356 Bacteria 4954
16 Ga0070674_100143688 3300005356 Bacteria 1794
17 Ga0070673_100126133 3300005364 Bacteria 2142
18 Ga0070688_100040308 3300005365 Bacteria 2862
19 Ga0070667_100075872 3300005367 Bacteria 2870
20 Ga0070667_100084968 3300005367 Bacteria 2714
21 Ga0070667_100160192 3300005367 Bacteria 1982
22 Ga0070709_10313762 3300005434 Bacteria 1149
23 Ga0070714_100056497 3300005435 Bacteria 3357
24 Ga0070714_100132606 3300005435 Bacteria 2227
25 Ga0070714_100177279 3300005435 Bacteria 1937
26 Ga0070713_100064284 3300005436 Bacteria 3079
27 Ga0070713_100095442 3300005436 Bacteria 2565
28 Ga0070710_10061621 3300005437 Bacteria 2137
29 Ga0070710_10062929 3300005437 Bacteria 2118
30 Ga0070701_10001388 3300005438 Bacteria 8955
31 Ga0070711_100001084 3300005439 Bacteria 14542
32 Ga0070705_100026467 3300005440 Bacteria 3157
33 Ga0070700_100001416 3300005441 Bacteria 11931
34 Ga0070700_100079273 3300005441 Bacteria 2116
35 Ga0070694_100001079 3300005444 Bacteria 15613
36 Ga0070708_100014026 3300005445 Bacteria 6584
37 Ga0070663_100002330 3300005455 Bacteria 10671
38 Ga0070678_100000138 3300005456 Bacteria 29713
39 Ga0070662_100067048 3300005457 Bacteria 2635
40 Ga0070681_10059149 3300005458 Bacteria 3811
41 Ga0068867_100000240 3300005459 Bacteria 36047
42 Ga0070685_10080767 3300005466 Bacteria 1949
43 Ga0070679_100342082 3300005530 Bacteria 1444
44 Ga0070684_100029117 3300005535 Bacteria 4677
45 Ga0070672_100090152 3300005543 Bacteria 2472
46 Ga0070686_100088058 3300005544 Bacteria 2071
47 Ga0070695_100003648 3300005545 Bacteria 8975
48 Ga0070696_100001790 3300005546 Bacteria 14084
49 Ga0070665_100016738 3300005548 Bacteria 7347
50 Ga0070665_100054317 3300005548 Bacteria 4018
51 Ga0070704_100013440 3300005549 Bacteria 5081
52 Ga0068854_100004983 3300005578 Bacteria 8375
53 Ga0068856_100193445 3300005614 Bacteria 2048
54 Ga0068859_100002335 3300005617 Bacteria 19295
55 Ga0068859_100175110 3300005617 Bacteria 2227
56 Ga0068864_100099520 3300005618 Bacteria 2576
57 Ga0068866_10002369 3300005718 Bacteria 7817
58 Ga0068861_100000258 3300005719 Bacteria 29459
59 Ga0068863_100020759 3300005841 Bacteria 6274
60 Ga0068863_100541670 3300005841 Bacteria 1149
61 Ga0068858_100005851 3300005842 Bacteria 12013
62 Ga0068858_100039236 3300005842 Bacteria 4392
63 Ga0068860_100001342 3300005843 Bacteria 26770
64 Ga0068862_100002510 3300005844 Bacteria 16244
65 Ga0068862_100211450 3300005844 Bacteria 1753
66 Ga0081455_10002429 3300005937 Bacteria 22223
67 Ga0081538_10000383 3300005981 Bacteria 50305
68 Ga0081538_10011688 3300005981 Bacteria 7095
69 Ga0081540_1093956 3300005983 Bacteria 1311
70 Ga0075365_10008630 3300006038 Bacteria 5803
71 Ga0075365_10009911 3300006038 Bacteria 5516
72 Ga0075365_10032789 3300006038 Bacteria 3343
73 Ga0075365_10058506 3300006038 Bacteria 2566
74 Ga0075365_10287801 3300006038 Bacteria 1156
75 Ga0075368_10025062 3300006042 Bacteria 2288
76 Ga0075363_100000371 3300006048 Bacteria 13560
77 Ga0075363_100004379 3300006048 Bacteria 6167
78 Ga0075363_100005354 3300006048 Bacteria 5701
79 Ga0075363_100061461 3300006048 Bacteria 2024
80 Ga0075363_100090652 3300006048 Bacteria 1682
81 Ga0075363_100108215 3300006048 Bacteria 1543
82 Ga0075363_100120985 3300006048 Bacteria 1462
83 Ga0075363_100127267 3300006048 Bacteria 1427
84 Ga0075364_10003774 3300006051 Bacteria 8661
85 Ga0075364_10019329 3300006051 Bacteria 4275
86 Ga0075364_10032999 3300006051 Bacteria 3330
87 Ga0075364_10054358 3300006051 Bacteria 2618
88 Ga0075364_10080494 3300006051 Bacteria 2153
89 Ga0075364_10094414 3300006051 Bacteria 1987
90 Ga0075364_10152716 3300006051 Bacteria 1556
91 Ga0075364_10206018 3300006051 Bacteria 1334
92 Ga0075364_10224991 3300006051 Bacteria 1274
93 Ga0070716_100039299 3300006173 Bacteria 2626
94 Ga0070716_100093808 3300006173 Bacteria 1823
95 Ga0070716_100200251 3300006173 Bacteria 1327
96 Ga0070712_100000816 3300006175 Bacteria 18495
97 Ga0070712_100171513 3300006175 Bacteria 1684
98 Ga0075362_10025626 3300006177 Bacteria 2513
99 Ga0075362_10062100 3300006177 Bacteria 1692
100 Ga0075367_10000918 3300006178 Bacteria 11908
101 Ga0075367_10012940 3300006178 Bacteria 4469
102 Ga0075367_10036055 3300006178 Bacteria 2866
103 Ga0075367_10043415 3300006178 Bacteria 2633
104 Ga0075367_10196716 3300006178 Bacteria 1259
105 Ga0075369_10002975 3300006186 Bacteria 6125
106 Ga0075369_10010637 3300006186 Bacteria 3603
107 Ga0075366_10231775 3300006195 Bacteria 1125
108 Ga0075370_10000639 3300006353 Bacteria 13581
109 Ga0075370_10044711 3300006353 Bacteria 2504
110 Ga0075370_10120228 3300006353 Bacteria 1529
111 Ga0068871_100054150 3300006358 Bacteria 3254
112 Ga0075428_100000955 3300006844 Bacteria 30623
113 Ga0075428_100004586 3300006844 Bacteria 15280
114 Ga0075428_100017537 3300006844 Bacteria 7909
115 Ga0075428_100197126 3300006844 Bacteria 2178
116 Ga0075428_100266567 3300006844 Bacteria 1843
117 Ga0075428_100468908 3300006844 Bacteria 1348
118 Ga0075428_100542098 3300006844 Bacteria 1244
119 Ga0075430_100007452 3300006846 Bacteria 9237
120 Ga0075430_100010053 3300006846 Bacteria 8006
121 Ga0075431_100000463 3300006847 Bacteria 33500
122 Ga0075431_100053130 3300006847 Bacteria 4177
123 Ga0075431_100070492 3300006847 Bacteria 3607
124 Ga0075431_100132269 3300006847 Bacteria 2573
125 Ga0075431_100228808 3300006847 Bacteria 1895
126 Ga0075429_100003169 3300006880 Bacteria 13981
127 Ga0068865_100000633 3300006881 Bacteria 19836
128 Ga0068865_100159810 3300006881 Bacteria 1718
129 Ga0097620_100002335 3300006931 Bacteria 19295
130 Ga0097620_100175110 3300006931 Bacteria 2227
131 Ga0099826_10136806 3300006948 Bacteria 1421
132 Ga0075435_100352673 3300007076 Bacteria 1261
133 Ga0105240_10367496 3300009093 Bacteria 1628
134 Ga0111539_10071481 3300009094 Bacteria 4094
135 Ga0111539_10103268 3300009094 Bacteria 3346
136 Ga0105245_10001210 3300009098 Bacteria 23346
137 Ga0105247_10000896 3300009101 Bacteria 22411
138 Ga0105247_10043520 3300009101 Bacteria 2751
139 Ga0114129_10000160 3300009147 Bacteria 72462
140 Ga0114129_10013266 3300009147 Bacteria 11737
141 Ga0114129_10078932 3300009147 Bacteria 4578
142 Ga0114129_10109593 3300009147 Bacteria 3811
143 Ga0114129_10186171 3300009147 Bacteria 2821
144 Ga0114129_10188979 3300009147 Bacteria 2798
145 Ga0114129_10646028 3300009147 Bacteria 1366
146 Ga0105243_10001403 3300009148 Bacteria 21306
147 Ga0105241_10011773 3300009174 Bacteria 6424
148 Ga0105242_10000154 3300009176 Bacteria 50757
149 Ga0105248_10007026 3300009177 Bacteria 12332
150 Ga0105248_10561908 3300009177 Bacteria 1287
151 Ga0105237_10037568 3300009545 Bacteria 4893
152 Ga0105249_10003764 3300009553 Bacteria 13090
153 Ga0105249_10643482 3300009553 Bacteria 1117
154 Ga0099796_10094723 3300010159 Bacteria 1115
155 Ga0105239_10019726 3300010375 Bacteria 7441
156 Ga0105239_10646395 3300010375 Bacteria 1208
157 Ga0105246_10393094 3300011119 Bacteria 1149
158 Ga0157378_10004436 3300013297 Bacteria 12344
159 Ga0163162_10009439 3300013306 Bacteria 9487
160 Ga0163162_10011973 3300013306 Bacteria 8459
161 Ga0163162_10600168 3300013306 Bacteria 1227
162 Ga0157372_10002900 3300013307 Bacteria 18542
163 Ga0157375_10000360 3300013308 Bacteria 41433
164 Ga0157375_10174406 3300013308 Bacteria 2299
165 Ga0157375_10257918 3300013308 Bacteria 1905
166 Ga0157380_10000198 3300014326 Bacteria 35239
167 Ga0157376_10100854 3300014969 Bacteria 2522
168 Ga0163161_10000846 3300017792 Bacteria 23880
169 Ga0213874_10054000 3300021377 Bacteria 1241
170 Ga0213876_10000753 3300021384 Bacteria 22381
171 Ga0213875_10041518 3300021388 Bacteria 2164
172 Ga0207692_10000300 3300025898 Bacteria 17124
173 Ga0207692_10014365 3300025898 Bacteria 3459
174 Ga0207692_10098828 3300025898 Bacteria 1598
175 Ga0207642_10000206 3300025899 Bacteria 17368
176 Ga0207710_10000668 3300025900 Bacteria 19337
177 Ga0207688_10000804 3300025901 Bacteria 15706
178 Ga0207688_10005289 3300025901 Bacteria 7014
179 Ga0207680_10257591 3300025903 Bacteria 1207
180 Ga0207685_10006788 3300025905 Bacteria 3145
181 Ga0207699_10023276 3300025906 Bacteria 3369
182 Ga0207654_10020719 3300025911 Bacteria 3490
183 Ga0207693_10000469 3300025915 Bacteria 36811
184 Ga0207693_10119219 3300025915 Bacteria 2072
185 Ga0207663_10000663 3300025916 Bacteria 15195
186 Ga0207663_10219907 3300025916 Bacteria 1381
187 Ga0207681_10012860 3300025923 Bacteria 5176
188 Ga0207650_10115563 3300025925 Bacteria 2083
189 Ga0207687_10000480 3300025927 Bacteria 26933
190 Ga0207700_10107924 3300025928 Bacteria 2234
191 Ga0207664_10041054 3300025929 Bacteria 3602
192 Ga0207664_10057951 3300025929 Bacteria 3080
193 Ga0207664_10167531 3300025929 Bacteria 1878
194 Ga0207644_10122327 3300025931 Bacteria 1982
195 Ga0207644_10210569 3300025931 Bacteria 1537
196 Ga0207706_10012834 3300025933 Bacteria 7627
197 Ga0207686_10002525 3300025934 Bacteria 9944
198 Ga0207709_10004429 3300025935 Bacteria 8124
199 Ga0207670_10034527 3300025936 Bacteria 3269
200 Ga0207669_10000085 3300025937 Bacteria 47505
201 Ga0207704_10000728 3300025938 Bacteria 14454
202 Ga0207704_10051515 3300025938 Bacteria 2490
203 Ga0207665_10006695 3300025939 Bacteria 7646
204 Ga0207665_10008806 3300025939 Bacteria 6635
205 Ga0207665_10037954 3300025939 Bacteria 3206
206 Ga0207691_10051181 3300025940 Bacteria 3777
207 Ga0207711_10249909 3300025941 Bacteria 1628
208 Ga0207689_10390470 3300025942 Bacteria 1159
209 Ga0207712_10001008 3300025961 Bacteria 20072
210 Ga0207712_10013861 3300025961 Bacteria 5169
211 Ga0207668_10029319 3300025972 Bacteria 3606
212 Ga0207640_10004679 3300025981 Bacteria 7425
213 Ga0207658_10002257 3300025986 Bacteria 14254
214 Ga0207658_10031502 3300025986 Bacteria 3766
215 Ga0207658_10214569 3300025986 Bacteria 1615
216 Ga0207677_10000820 3300026023 Bacteria 17783
217 Ga0207677_10037503 3300026023 Bacteria 3169
218 Ga0207703_10010089 3300026035 Bacteria 7403
219 Ga0207703_10025994 3300026035 Bacteria 4607
220 Ga0207703_10156562 3300026035 Bacteria 1992
221 Ga0207678_10011563 3300026067 Bacteria 7752
222 Ga0207708_10000329 3300026075 Bacteria 37329
223 Ga0207708_10084448 3300026075 Bacteria 2441
224 Ga0207702_10155886 3300026078 Bacteria 2082
225 Ga0207641_10029212 3300026088 Bacteria 4558
226 Ga0207641_10103575 3300026088 Bacteria 2511
227 Ga0207648_10000112 3300026089 Bacteria 78746
228 Ga0207676_10162341 3300026095 Bacteria 1937
229 Ga0207675_100000117 3300026118 Bacteria 64829
230 Ga0207683_10001010 3300026121 Bacteria 25655
231 Ga0207683_10256111 3300026121 Bacteria 1597
232 Ga0207698_10023753 3300026142 Bacteria 4289
233 Ga0207698_10542476 3300026142 Bacteria 1138
234 Ga0209813_10018959 3300027866 Bacteria 1907
235 Ga0268266_10009370 3300028379 Bacteria 8629
236 Ga0268266_10024527 3300028379 Bacteria 5129
237 Ga0268265_10004318 3300028380 Bacteria 9903
238 Ga0268265_10113862 3300028380 Bacteria 2214
239 Ga0268264_10001796 3300028381 Bacteria 19621
240 Ga0307517_10062531 3300028786 Bacteria 3498
241 Ga0307515_10011018 3300028794 Bacteria 17226
242 Ga0265338_10034363 3300028800 Bacteria 4902
243 Ga0307511_10003102 3300030521 Bacteria 17130
244 Ga0307511_10064628 3300030521 Bacteria 2748
245 Ga0307512_10006767 3300030522 Bacteria 11522
246 Ga0307512_10006967 3300030522 Bacteria 11293
247 Ga0265327_10012600 3300031251 Bacteria 5690
248 Ga0307513_10041904 3300031456 Bacteria 5047
249 Ga0307513_10183985 3300031456 Bacteria 1949
250 Ga0307509_10011802 3300031507 Bacteria 10523
251 Ga0307509_10028010 3300031507 Bacteria 6266
252 Ga0307509_10207338 3300031507 Bacteria 1789
253 Ga0307508_10048213 3300031616 Bacteria 3795
254 Ga0307508_10054320 3300031616 Bacteria 3552
255 Ga0307508_10190435 3300031616 Bacteria 1653
256 Ga0307514_10027261 3300031649 Bacteria 4615
257 Ga0307516_10018641 3300031730 Bacteria 7207
258 Ga0307516_10019325 3300031730 Bacteria 7056
259 Ga0307516_10058066 3300031730 Bacteria 3768
260 Ga0307516_10106330 3300031730 Bacteria 2616
261 Ga0307413_10080946 3300031824 Bacteria 2081
262 Ga0307410_10009295 3300031852 Bacteria 5506
263 Ga0307410_10173312 3300031852 Bacteria 1628
264 Ga0307410_10178734 3300031852 Bacteria 1605
265 Ga0307407_10162848 3300031903 Bacteria 1461
266 Ga0307409_100212131 3300031995 Bacteria 1741
267 Ga0307416_100034920 3300032002 Bacteria 3833
268 Ga0307416_100697848 3300032002 Bacteria 1104
269 Ga0307411_10189779 3300032005 Bacteria 1568
270 Ga0307411_10239801 3300032005 Bacteria 1419
271 Ga0307415_100013668 3300032126 Bacteria 4746
272 Ga0307415_100024830 3300032126 Bacteria 3751
273 Ga0307507_10000003 3300033179 Bacteria 371707
274 Ga0307507_10005929 3300033179 Bacteria 19418
275 Ga0307510_10014262 3300033180 Bacteria 9411
276 Ga0307510_10063507 3300033180 Bacteria 3760
277 Ga0373926_0004072 3300035083 Bacteria 4773
278 Ga0373936_0004137 3300035113 Bacteria 5472
279 Ga0373941_0044072 3300035115 Bacteria 1391
280 Ga0373945_0002459 3300035116 Bacteria 5812
281 Ga0373953_0019681 3300035117 Bacteria 2514
282 Ga0373943_0002954 3300035170 Bacteria 7710
283 Ga0373946_0004678 3300035171 Bacteria 4914
284 Ga0373955_0065213 3300035172 Bacteria 2021
285 Ga0316574_0160057 3300035398 Bacteria 1450
286 Ga0373927_0002196 3300035695 Bacteria 14345
287 Ga0373937_0052232 3300036401 Bacteria 3747
288 Ga0316584_0034896 3300036712 Bacteria 3730
289 Ga0316584_0064686 3300036712 Bacteria 2739
290 Ga0373925_0065040 3300037068 Bacteria 2747
291 Ga0373925_0072927 3300037068 Bacteria 2597
292 Ga0395905_0597176 3300037471 Bacteria 1006
293 Ga0436364_1059460 3300037853 Bacteria 4481
294 Ga0436364_1482437 3300037853 Bacteria 4143
295 Ga0436365_0532916 3300039437 Bacteria 9722
296 Ga0436365_0707403 3300039437 Bacteria 3042
297 Ga0436365_1021004 3300039437 Bacteria 1621
298 Ga0436365_1451723 3300039437 Bacteria 9729
299 Ga0436365_1572675 3300039437 Bacteria 39347
300 Ga0436365_1627569 3300039437 Bacteria 24179
301 Ga0436363_0414863 3300039450 Bacteria 1138
302 Ga0436363_1153181 3300039450 Bacteria 4221
303 Ga0436363_1342054 3300039450 Bacteria 1534
304 Ga0436362_0106244 3300039453 Bacteria 7195
305 Ga0439466_0001192 3300041411 Bacteria 10126
306 Ga0439465_0007669 3300041413 Bacteria 3424
307 Ga0439465_0020895 3300041413 Bacteria 2052
308 Ga0439465_0041863 3300041413 Bacteria 1483
309 Ga0451845_0020449 3300041501 Bacteria 1124
310 Ga0451853_2512319 3300041512 Bacteria 2867
311 Ga0451853_3508463 3300041512 Bacteria 2624
312 Ga0439431_0015107 3300041997 Bacteria 1795
313 Ga0439442_002613 3300042002 Bacteria 3536
314 Ga0439450_002428 3300042008 Bacteria 2931
315 Ga0439455_0040982 3300042012 Bacteria 1186
316 Ga0450903_002535 3300042138 Bacteria 3240
317 Ga0439434_0021562 3300042435 Bacteria 1936
318 Ga0466972_0005873 3300044658 Bacteria 6155
319 Ga0466972_0008049 3300044658 Bacteria 5284
320 Ga0466972_0009641 3300044658 Bacteria 4846
321 Ga0466972_0026171 3300044658 Bacteria 2890
322 Ga0466972_0042231 3300044658 Bacteria 2218
323 Ga0466965_0015530 3300044683 Bacteria 3617
324 Ga0466965_0032505 3300044683 Bacteria 2548
325 Ga0466966_0012148 3300044684 Bacteria 5705
326 Ga0466966_0021640 3300044684 Bacteria 4222
327 Ga0466961_0011244 3300044693 Bacteria 5722
328 Ga0466961_0198628 3300044693 Bacteria 1241
329 Ga0466963_0033970 3300044694 Bacteria 3316
330 Ga0466971_0032496 3300044719 Bacteria 2338
331 Ga0466968_0012679 3300044735 Bacteria 3306
332 Ga0466968_0015685 3300044735 Bacteria 3007
333 Ga0466968_0022906 3300044735 Bacteria 2541
334 Ga0466970_0040781 3300044765 Bacteria 2465
335 Ga0466970_0246457 3300044765 Bacteria 1000
336 Ga0466957_0002976 3300044842 Bacteria 9200
337 Ga0466957_0013484 3300044842 Bacteria 4741
338 Ga0466957_0028454 3300044842 Bacteria 3328
339 Ga0466957_0120472 3300044842 Bacteria 1672
340 Ga0466957_0261468 3300044842 Bacteria 1153
341 Ga0466960_0009811 3300044901 Bacteria 3958
342 Ga0466960_0019392 3300044901 Bacteria 2996
343 Ga0466959_0027932 3300045049 Bacteria 4184
344 Ga0466959_0034662 3300045049 Bacteria 3734
345 Ga0466959_0087549 3300045049 Bacteria 2240
346 Ga0466959_0392960 3300045049 Bacteria 943
347 Ga0466958_0015384 3300045836 Bacteria 4385
348 Ga0466958_0099227 3300045836 Bacteria 1809
349 Ga0466958_0153115 3300045836 Bacteria 1455
350 Ga0466958_0179845 3300045836 Bacteria 1342
351 Ga0466967_0010009 3300045976 Bacteria 7082
352 Ga0466967_0097303 3300045976 Bacteria 2686
353 Ga0466967_0136502 3300045976 Bacteria 2281
354 Ga0466967_0254990 3300045976 Bacteria 1677
355 Ga0466967_0300857 3300045976 Bacteria 1543
356 Ga0466967_0418355 3300045976 Bacteria 1306
357 Ga0495592_0085634 3300046454 Bacteria 2271
358 Ga0495603_0012877 3300046455 Bacteria 5057
359 Ga0495603_0035080 3300046455 Bacteria 3014
360 Ga0495603_0050844 3300046455 Bacteria 2464
361 Ga0495629_0008706 3300046459 Bacteria 7468
362 Ga0495629_0014814 3300046459 Bacteria 5607
363 Ga0495629_0025225 3300046459 Bacteria 4228
364 Ga0495629_0351558 3300046459 Bacteria 1005
365 Ga0495638_0000427 3300046460 Bacteria 50873
366 Ga0495638_0007953 3300046460 Bacteria 7563
367 Ga0495638_0063352 3300046460 Bacteria 2280
368 Ga0495651_0002263 3300046462 Bacteria 14859
369 Ga0495651_0006616 3300046462 Bacteria 8848
370 Ga0495651_0045656 3300046462 Bacteria 3394
371 Ga0495653_0009998 3300046463 Bacteria 7761
372 Ga0495653_0035635 3300046463 Bacteria 3924
373 Ga0495653_0035658 3300046463 Bacteria 3923
374 Ga0495580_0138221 3300046472 Bacteria 1689
375 Ga0495582_0009515 3300046473 Bacteria 5353
376 Ga0495582_0031665 3300046473 Bacteria 2908
377 Ga0495605_0004242 3300046474 Bacteria 8445
378 Ga0495662_0001407 3300046476 Bacteria 11933
379 Ga0495662_0001472 3300046476 Bacteria 11653
380 Ga0495662_0046555 3300046476 Bacteria 2095
381 Ga0495664_0004018 3300046477 Bacteria 8030
382 Ga0495664_0005032 3300046477 Bacteria 7237
383 Ga0495664_0010177 3300046477 Bacteria 5278
384 Ga0495594_0025213 3300046499 Bacteria 3196
385 Ga0495607_0040309 3300046501 Bacteria 2782
386 Ga0495583_0009375 3300046506 Bacteria 5857
387 Ga0495606_0003145 3300046507 Bacteria 17893
388 Ga0495606_0007916 3300046507 Bacteria 9371
389 Ga0495608_0006456 3300046511 Bacteria 8327
390 Ga0495608_0010068 3300046511 Bacteria 6596
391 Ga0495616_0028784 3300046513 Bacteria 2938
392 Ga0495618_0013102 3300046514 Bacteria 5042
393 Ga0495618_0208266 3300046514 Bacteria 1236
394 Ga0495620_0013887 3300046515 Bacteria 4110
395 Ga0495628_0030510 3300046516 Bacteria 4364
396 Ga0495628_0043489 3300046516 Bacteria 3578
397 Ga0495628_0136381 3300046516 Bacteria 1875
398 Ga0495630_0011073 3300046517 Bacteria 6524
399 Ga0495630_0015422 3300046517 Bacteria 5581
400 Ga0495630_0020585 3300046517 Bacteria 4865
401 Ga0495630_0135693 3300046517 Bacteria 1869
402 Ga0495631_0003312 3300046518 Bacteria 8859
403 Ga0495637_0076340 3300046520 Bacteria 1343
404 Ga0495643_0003020 3300046522 Bacteria 12653
405 Ga0495666_0000700 3300046526 Bacteria 15218
406 Ga0495666_0081913 3300046526 Bacteria 1526
407 Ga0495666_0092594 3300046526 Bacteria 1426
408 Ga0495666_0168565 3300046526 Bacteria 1013
409 Ga0495652_0024733 3300046529 Bacteria 5314
410 Ga0495652_0071245 3300046529 Bacteria 2902
411 Ga0495652_0119196 3300046529 Bacteria 2108
412 Ga0495665_0001713 3300046531 Bacteria 11764
413 Ga0495665_0106871 3300046531 Bacteria 1468
414 Ga0495640_0023248 3300046533 Bacteria 4522
415 Ga0495640_0025727 3300046533 Bacteria 4264
416 Ga0495586_0007627 3300046535 Bacteria 5774
417 Ga0495586_0082940 3300046535 Bacteria 1763
418 Ga0495587_0003071 3300046536 Bacteria 11155
419 Ga0495587_0005829 3300046536 Bacteria 8019
420 Ga0495597_0056693 3300046542 Bacteria 1715
421 Ga0495645_0003254 3300046543 Bacteria 11027
422 Ga0495645_0015612 3300046543 Bacteria 5402
423 Ga0495645_0184045 3300046543 Bacteria 1429
424 Ga0495622_0042599 3300046557 Bacteria 2111
425 Ga0495667_0012679 3300046559 Bacteria 5713
426 Ga0495667_0038309 3300046559 Bacteria 3193
427 Ga0495634_0003210 3300046642 Bacteria 13223
428 Ga0495634_0012936 3300046642 Bacteria 6037
429 Ga0495634_0092285 3300046642 Bacteria 1965
430 Ga0495611_0005901 3300046648 Bacteria 5223
431 Ga0495625_0030703 3300046660 Bacteria 4005
432 Ga0495635_0018217 3300046663 Bacteria 4901
433 Ga0495588_0018277 3300046674 Bacteria 3416
434 Ga0495657_0000085 3300046675 Bacteria 82569
435 Ga0495657_0009110 3300046675 Bacteria 7541
436 Ga0495657_0072517 3300046675 Bacteria 2245
437 Ga0495657_0082936 3300046675 Bacteria 2070
438 Ga0495657_0086188 3300046675 Bacteria 2023
439 Ga0495599_0017527 3300046678 Bacteria 4451
440 Ga0495599_0046469 3300046678 Bacteria 2722
441 Ga0495623_0013410 3300046679 Bacteria 5313
442 Ga0495623_0057312 3300046679 Bacteria 2451
443 Ga0495646_0001147 3300046680 Bacteria 15459
444 Ga0495658_0056632 3300046683 Bacteria 2236
445 Ga0495658_0293238 3300046683 Bacteria 1028
446 Ga0495613_0000396 3300046689 Bacteria 37260
447 Ga0495613_0036656 3300046689 Bacteria 3636
448 Ga0495613_0054600 3300046689 Bacteria 2936
449 Ga0495613_0173837 3300046689 Bacteria 1527
450 Ga0495624_0003954 3300046690 Bacteria 10909
451 Ga0495624_0097773 3300046690 Bacteria 1808
452 Ga0495624_0135618 3300046690 Bacteria 1509
453 Ga0495649_0053775 3300046694 Bacteria 2179
454 Ga0495600_0069454 3300046809 Bacteria 2302
455 Ga0495600_0130134 3300046809 Bacteria 1636
456 Ga0495660_0024277 3300046810 Bacteria 3454
457 Ga0495581_0003051 3300047315 Bacteria 9595
458 Ga0495581_0019802 3300047315 Bacteria 3907
459 Ga0495581_0068181 3300047315 Bacteria 2057
460 Ga0495581_0181402 3300047315 Bacteria 1231
461 Ga0495604_0000250 3300047317 Bacteria 47753
462 Ga0495604_0001171 3300047317 Bacteria 21672
463 Ga0495604_0237743 3300047317 Bacteria 1247
464 Ga0495674_0163251 3300047319 Bacteria 1863
465 Ga0495672_0138767 3300047320 Bacteria 1272
466 Ga0495676_0010266 3300047321 Bacteria 8498
467 Ga0495676_0013790 3300047321 Bacteria 7247
468 Ga0495676_0018656 3300047321 Bacteria 6119
469 Ga0495676_0067551 3300047321 Bacteria 2765
470 Ga0495680_0005669 3300047322 Bacteria 11687
471 Ga0495680_0122189 3300047322 Bacteria 1921
472 Ga0495680_0155882 3300047322 Bacteria 1661
473 Ga0495683_0020667 3300047323 Bacteria 3394
474 Ga0495687_001486 3300047443 Bacteria 21411
475 Ga0495687_021483 3300047443 Bacteria 3120
476 Ga0495687_034246 3300047443 Bacteria 2296
477 Ga0495687_085355 3300047443 Bacteria 1224
478 Ga0495675_0027216 3300047444 Bacteria 3644
479 Ga0495675_0030064 3300047444 Bacteria 3466
480 Ga0495675_0033622 3300047444 Bacteria 3273
481 Ga0495685_004080 3300047447 Bacteria 4697
482 Ga0495681_0005847 3300047470 Bacteria 8170
483 Ga0495684_0175569 3300047471 Bacteria 1590
484 Ga0495686_0176498 3300047472 Bacteria 1240
485 Ga0495593_0000421 3300047673 Bacteria 23629
486 Ga0495593_0013725 3300047673 Bacteria 4614
487 Ga0495593_0022036 3300047673 Bacteria 3555
488 Ga0495593_0095303 3300047673 Bacteria 1530
489 Ga0495602_0034492 3300048088 Bacteria 4733
490 Ga0495602_0101387 3300048088 Bacteria 2361
491 Ga0495602_0136892 3300048088 Bacteria 1944
492 Ga0495614_0001131 3300048089 Bacteria 11472
493 Ga0495614_0019121 3300048089 Bacteria 2965
494 Ga0495614_0072106 3300048089 Bacteria 1489
495 Ga0495614_0142817 3300048089 Bacteria 1064
496 Ga0495626_0013183 3300048091 Bacteria 4306
497 Ga0496100_0000202 3300048903 Bacteria 32795
498 Ga0496101_0000285 3300048904 Bacteria 35438
499 Ga0496102_0033325 3300048905 Bacteria 4628
500 Ga0496102_0033616 3300048905 Bacteria 4609
501 Ga0496102_0055519 3300048905 Bacteria 3611
502 Ga0496102_0080945 3300048905 Bacteria 2993
503 Ga0496102_0226497 3300048905 Bacteria 1763
504 Ga0496103_0001095 3300048906 Bacteria 18847
505 Ga0496103_0238759 3300048906 Bacteria 1169
506 Ga0496104_0002749 3300048907 Bacteria 15145
507 Ga0496104_0228878 3300048907 Bacteria 1771
508 Ga0496105_0012300 3300048908 Bacteria 6777
509 Ga0496106_0000556 3300048909 Bacteria 26561
510 Ga0496106_0001563 3300048909 Bacteria 17234
511 Ga0496107_0008445 3300048910 Bacteria 7128
512 Ga0496107_0316281 3300048910 Bacteria 1162
513 Ga0496108_0000759 3300048911 Bacteria 25117
514 Ga0496108_0144356 3300048911 Bacteria 2051
515 Ga0496108_0144404 3300048911 Bacteria 2051
516 Ga0496109_0002063 3300048912 Bacteria 16675
517 Ga0496109_0253175 3300048912 Bacteria 1658
518 Ga0496109_0459772 3300048912 Bacteria 1202
519 Ga0496109_0637581 3300048912 Bacteria 1002
520 Ga0496111_0048204 3300048914 Bacteria 3069
521 Ga0496112_0082046 3300048915 Bacteria 3189
522 Ga0496113_0081756 3300048916 Bacteria 2477
523 Ga0496114_0001695 3300048917 Bacteria 16749
524 Ga0496114_0001795 3300048917 Bacteria 16292
525 Ga0496115_0002918 3300048918 Bacteria 12343
526 Ga0496115_0005038 3300048918 Bacteria 9600
527 Ga0496115_0367789 3300048918 Bacteria 1171
528 Ga0496115_0392533 3300048918 Bacteria 1127
529 Ga0496116_0000227 3300048919 Bacteria 104783
530 Ga0496117_0007103 3300048920 Bacteria 11068
531 Ga0496118_0003523 3300048921 Bacteria 19608
532 Ga0496118_0040897 3300048921 Bacteria 3678
533 Ga0496119_0001766 3300048922 Bacteria 25173
534 Ga0496119_0094203 3300048922 Bacteria 1695
535 Ga0496126_0019379 3300048929 Bacteria 6701
536 Ga0501032_0003441 3300049569 Bacteria 12120
537 Ga0501032_0004434 3300049569 Bacteria 10581
538 Ga0501032_0011565 3300049569 Bacteria 6333
539 Ga0501033_0000559 3300049570 Bacteria 34638
540 Ga0501033_0014667 3300049570 Bacteria 5949
541 Ga0501033_0138652 3300049570 Bacteria 1759
542 Ga0501034_0001109 3300049571 Bacteria 37776
543 Ga0501034_0003163 3300049571 Bacteria 18924
544 Ga0501034_0004347 3300049571 Bacteria 15792
545 Ga0501034_0015265 3300049571 Bacteria 7894
546 Ga0501034_0061592 3300049571 Bacteria 3768
547 Ga0501036_0027704 3300049572 Bacteria 4788
548 Ga0501036_0075648 3300049572 Bacteria 2847
549 Ga0501036_0123706 3300049572 Bacteria 2184
550 Ga0501036_0138183 3300049572 Bacteria 2056
551 Ga0501037_0006470 3300049573 Bacteria 8564
552 Ga0501037_0011211 3300049573 Bacteria 6598
553 Ga0501037_0016834 3300049573 Bacteria 5379
554 Ga0501038_0009880 3300049574 Bacteria 8734
555 Ga0501038_0017035 3300049574 Bacteria 6575
556 Ga0501038_0053977 3300049574 Bacteria 3457
557 Ga0501039_0001475 3300049575 Bacteria 17280
558 Ga0501039_0004829 3300049575 Bacteria 10207
559 Ga0501040_0197756 3300049576 Bacteria 1427
560 Ga0501040_0237680 3300049576 Bacteria 1298
561 Ga0501042_0005497 3300049578 Bacteria 8167
562 Ga0501043_0009079 3300049579 Bacteria 7822
563 Ga0501043_0015843 3300049579 Bacteria 5908
564 Ga0501043_0050091 3300049579 Bacteria 3283
565 Ga0501043_0053874 3300049579 Bacteria 3159
566 Ga0501043_0348613 3300049579 Bacteria 1125
567 Ga0501046_0001136 3300049580 Bacteria 25942
568 Ga0501046_0067031 3300049580 Bacteria 2796
569 Ga0501047_0008199 3300049581 Bacteria 9869
570 Ga0501047_0075214 3300049581 Bacteria 3250
571 Ga0501048_0001774 3300049582 Bacteria 16425
572 Ga0501068_0040780 3300049584 Bacteria 2788
573 Ga0501069_0000043 3300049585 Bacteria 77795
574 Ga0501069_0000817 3300049585 Bacteria 14685
575 Ga0501069_0055072 3300049585 Bacteria 2215
576 Ga0501070_0000298 3300049586 Bacteria 46144
577 Ga0501070_0000448 3300049586 Bacteria 37506
578 Ga0501070_0000622 3300049586 Bacteria 32559
579 Ga0501070_0000942 3300049586 Bacteria 26254
580 Ga0501070_0011193 3300049586 Bacteria 7573
581 Ga0501070_0023503 3300049586 Bacteria 5163
582 Ga0501070_0068563 3300049586 Bacteria 2936
583 Ga0501071_0005983 3300049587 Bacteria 7883
584 Ga0501071_0013196 3300049587 Bacteria 5626
585 Ga0501071_0034990 3300049587 Bacteria 3577
586 Ga0501072_0018470 3300049588 Bacteria 5370
587 Ga0501072_0103697 3300049588 Bacteria 2260
588 Ga0501072_0115790 3300049588 Bacteria 2134
589 Ga0501073_0000574 3300049589 Bacteria 25952
590 Ga0501073_0003297 3300049589 Bacteria 12127
591 Ga0501073_0050920 3300049589 Bacteria 2901
592 Ga0501074_0001020 3300049590 Bacteria 18229
593 Ga0501074_0019397 3300049590 Bacteria 4939
594 Ga0501074_0029856 3300049590 Bacteria 3951
595 Ga0501074_0085783 3300049590 Bacteria 2256
596 Ga0501074_0102077 3300049590 Bacteria 2053
597 Ga0501075_0002668 3300049591 Bacteria 11926
598 Ga0501076_0101986 3300049592 Bacteria 2313
599 Ga0501077_0013340 3300049593 Bacteria 5154
600 Ga0501079_0005057 3300049741 Bacteria 9789
601 Ga0501080_0000863 3300049742 Bacteria 24831
602 Ga0501080_0001976 3300049742 Bacteria 17683
603 Ga0501080_0091616 3300049742 Bacteria 2823
604 Ga0501080_0119573 3300049742 Bacteria 2442
605 Ga0501080_0247867 3300049742 Bacteria 1624
606 Ga0501080_0305609 3300049742 Bacteria 1442
607 Ga0501081_0307567 3300049743 Bacteria 1163
608 Ga0501083_0000608 3300049744 Bacteria 23082
609 Ga0501083_0210623 3300049744 Bacteria 1267
610 Ga0501035_0000753 3300049822 Bacteria 34892
611 Ga0501035_0017267 3300049822 Bacteria 6653
612 Ga0501044_0001366 3300049823 Bacteria 28620
613 Ga0501044_0001677 3300049823 Bacteria 26037
614 Ga0501044_0002308 3300049823 Bacteria 21735
615 Ga0501044_0020625 3300049823 Bacteria 7037
616 Ga0501044_0092672 3300049823 Bacteria 3047
617 Ga0501045_0042936 3300049824 Bacteria 3291
618 Ga0501045_0247884 3300049824 Bacteria 1326
619 nmdc:mga03683_18185_c1 3300050489 Bacteria 2668
620 nmdc:mga03683_41638_c1 3300050489 Bacteria 1887
621 nmdc:mga03n38_194026_c1 3300050490 Bacteria 1048
622 nmdc:mga03n38_23345_c1 3300050490 Bacteria 2515
623 nmdc:mga03n38_26814_c1 3300050490 Bacteria 2383
624 nmdc:mga03n38_98271_c1 3300050490 Bacteria 1408
625 nmdc:mga00v17_175793_c1 3300050491 Bacteria 1381
626 nmdc:mga00v17_3787_c1 3300050491 Bacteria 7807
627 nmdc:mga00v17_61915_c1 3300050491 Bacteria 2301
628 nmdc:mga0yw44_125269_c1 3300050492 Bacteria 1658
629 nmdc:mga0yw44_12999_c1 3300050492 Bacteria 2844
630 nmdc:mga0yw44_173363_c1 3300050492 Bacteria 1417
631 nmdc:mga0yw44_30802_c1 3300050492 Bacteria 3114
632 nmdc:mga0yw44_55616_c1 3300050492 Bacteria 2408
633 nmdc:mga06z11_30366_c1 3300050494 Bacteria 2614
634 nmdc:mga06z11_56837_c1 3300050494 Bacteria 2025
635 nmdc:mga04h51_7238_c1 3300050495 Bacteria 2919
636 nmdc:mga07m45_116984_c1 3300050496 Bacteria 1538
637 nmdc:mga07m45_22174_c1 3300050496 Bacteria 3466
638 nmdc:mga07m45_44238_c1 3300050496 Bacteria 2498
639 nmdc:mga07m45_68875_c1 3300050496 Bacteria 2011
640 nmdc:mga07m45_88689_c1 3300050496 Bacteria 1770
641 nmdc:mga05p37_112467_c1 3300050507 Bacteria 3348
642 nmdc:mga05p37_24750_c1 3300050507 Bacteria 7297
643 nmdc:mga05p37_560389_c1 3300050507 Bacteria 1298
644 nmdc:mga05p37_6556_c1 3300050507 Bacteria 13719
645 nmdc:mga09592_277501_c1 3300050508 Bacteria 1453
646 nmdc:mga0qj67_1514_c1 3300050509 Bacteria 16300
647 nmdc:mga0qj67_178562_c1 3300050509 Bacteria 1724
648 nmdc:mga0qj67_5721_c1 3300050509 Bacteria 9097
649 nmdc:mga0qj67_95851_c1 3300050509 Bacteria 2389
650 nmdc:mga06r32_15673_c1 3300050510 Bacteria 6886
651 nmdc:mga06r32_202245_c1 3300050510 Bacteria 1974
652 nmdc:mga06r32_256694_c1 3300050510 Bacteria 1736
653 nmdc:mga06r32_394798_c1 3300050510 Bacteria 1366
654 nmdc:mga06r32_576038_c1 3300050510 Bacteria 1098
655 nmdc:mga06r32_6927_c1 3300050510 Bacteria 10194
656 nmdc:mga06r32_9149_c1 3300050510 Bacteria 8929
657 nmdc:mga08y16_73203_c1 3300050511 Bacteria 3570
658 nmdc:mga0sz30_19120_c1 3300050516 Bacteria 2749
659 nmdc:mga0sz30_2196_c1 3300050516 Bacteria 6976
660 nmdc:mga0sz30_46711_c1 3300050516 Bacteria 1828
661 nmdc:mga0sz30_5503_c1 3300050516 Bacteria 4651
662 Ga0495601_0138394 3300053077 Bacteria 1587
663 Ga0495601_0219737 3300053077 Bacteria 1241
664 Ga0495612_0076024 3300053078 Bacteria 1406
665 Ga0495612_0114049 3300053078 Bacteria 1159
666 Ga0500610_0011964 3300053079 Bacteria 3978
667 Ga0495595_0002019 3300053084 Bacteria 7880
668 Ga0495595_0141430 3300053084 Bacteria 1181
669 Ga0495619_0020517 3300053085 Bacteria 4210
670 Ga0495619_0060887 3300053085 Bacteria 2510
671 Ga0500578_0070092 3300053086 Bacteria 2235
672 Ga0500578_0133012 3300053086 Bacteria 1558
673 Ga0500643_002800 3300053087 Bacteria 8719
674 Ga0500644_0079228 3300053088 Bacteria 1204
675 Ga0500566_0001370 3300053094 Bacteria 14260
676 Ga0500566_0108387 3300053094 Bacteria 1513
677 Ga0500556_0033720 3300053104 Bacteria 1757
678 Ga0500562_049539 3300053108 Bacteria 1123
679 Ga0500569_002635 3300053109 Bacteria 3566
680 Ga0500608_094005 3300053122 Bacteria 1397
681 Ga0500628_010413 3300053129 Bacteria 1665
682 Ga0500652_064113 3300053131 Bacteria 1516
683 Ga0500559_0134580 3300053136 Bacteria 1155
684 Ga0500573_0033901 3300053140 Bacteria 2945
685 Ga0500573_0067595 3300053140 Bacteria 2042
686 Ga0500579_111322 3300053143 Bacteria 1376
687 Ga0500600_0073260 3300053149 Bacteria 1872
688 Ga0500604_0065390 3300053151 Bacteria 1150
689 Ga0500616_0083002 3300053153 Bacteria 1606
690 Ga0500616_0083510 3300053153 Bacteria 1599
691 Ga0500630_049169 3300053159 Bacteria 2041
692 Ga0500645_000181 3300053730 Bacteria 49626
693 Ga0500656_002340 3300053732 Bacteria 1710
694 Ga0501084_0001510 3300054114 Bacteria 18464
695 Ga0501082_0176418 3300060353 Bacteria 1858
696 Ga0466962_0001728 3300061719 Bacteria 10266
697 Ga0466962_0002480 3300061719 Bacteria 8746
698 Ga0530510_0002286 3300061734 Bacteria 13141
699 2508676553 2508501039 Bacteria 9978592
700 2517763236 2517572101 Bacteria 6884336
701 2548696611 2547132424 Bacteria 8348532
702 2585313812 2582581314 Bacteria 11452267
703 2616697775 2616644814 Bacteria 11555299
704 2644511744 2643221692 Bacteria 7282860
705 2671836170 2671180195 Bacteria 9757215
706 2676200543 2675902999 Bacteria 9438463
707 2686539990 2684623035 Bacteria 8032739
708 2689956972 2687453737 Bacteria 11203906
709 2689994280 2687453743 Bacteria 8361025
710 2738890844 2738541308 Bacteria 7020677
711 2774845121 2773857921 Bacteria 9435764
712 2774854326 2773857922 Bacteria 9757215
713 2785374594 2784746768 Bacteria 10036182
714 2812361066 2811994879 Bacteria 9313447
715 2842140189 2842134933 Bacteria 5847019
716 2895888807 2895880812 Bacteria 11255272
717 2919713500 2919713450 Bacteria 7431245
718 2929216849 2929212328 Bacteria 7708288
719 2939588880 2939582691 Bacteria 7088898
720 2946073308 2946072368 Bacteria 8999607
721 2954691560 2954691527 Bacteria 10720516
722 2954706654 2954701450 Bacteria 10834262
723 3003006618 3002998708 Bacteria 11715108
724 8002776606 8002775197 Bacteria 10728764
725 8002788458 8002784119 Bacteria 9788632
726 Ga0373937_0034749
727 JGI24743J22301_10003191
728 JGI24738J21930_10010731
729 JGI24744J21845_10000043
730 JGI24742J22300_10001363
731 JGI25407J50210_10005095
732 Ga0070683_100159646
733 Ga0068869_100091287
734 Ga0070682_100274991
735 Ga0068868_100000580
736 Ga0068868_100007544
737 Ga0070668_100006775
738 Ga0070669_100026800
739 Ga0070671_100333475
740 Ga0070674_100014153
741 Ga0070674_100143688
742 Ga0070673_100126133
743 Ga0070688_100040308
744 Ga0070667_100075872
745 Ga0070667_100084968
746 Ga0070667_100160192
747 Ga0070709_10313762
748 Ga0070714_100056497
749 Ga0070714_100132606
750 Ga0070714_100177279
751 Ga0070713_100064284
752 Ga0070713_100095442
753 Ga0070710_10061621
754 Ga0070710_10062929
755 Ga0070701_10001388
756 Ga0070711_100001084
757 Ga0070705_100026467
758 Ga0070700_100001416
759 Ga0070700_100079273
760 Ga0070694_100001079
761 Ga0070708_100014026
762 Ga0070663_100002330
763 Ga0070678_100000138
764 Ga0070662_100067048
765 Ga0070681_10059149
766 Ga0068867_100000240
767 Ga0070685_10080767
768 Ga0070679_100342082
769 Ga0070684_100029117
770 Ga0070672_100090152
771 Ga0070686_100088058
772 Ga0070695_100003648
773 Ga0070696_100001790
774 Ga0070665_100016738
775 Ga0070665_100054317
776 Ga0070704_100013440
777 Ga0068854_100004983
778 Ga0068856_100193445
779 Ga0068859_100002335
780 Ga0068859_100175110
781 Ga0068864_100099520
782 Ga0068866_10002369
783 Ga0068861_100000258
784 Ga0068863_100020759
785 Ga0068863_100541670
786 Ga0068858_100005851
787 Ga0068858_100039236
788 Ga0068860_100001342
789 Ga0068862_100002510
790 Ga0068862_100211450
791 Ga0081455_10002429
792 Ga0081538_10000383
793 Ga0081538_10011688
794 Ga0081540_1093956
795 Ga0075365_10008630
796 Ga0075365_10009911
797 Ga0075365_10032789
798 Ga0075365_10058506
799 Ga0075365_10287801
800 Ga0075368_10025062
801 Ga0075363_100000371
802 Ga0075363_100004379
803 Ga0075363_100005354
804 Ga0075363_100061461
805 Ga0075363_100090652
806 Ga0075363_100108215
807 Ga0075363_100120985
808 Ga0075363_100127267
809 Ga0075364_10003774
810 Ga0075364_10019329
811 Ga0075364_10032999
812 Ga0075364_10054358
813 Ga0075364_10080494
814 Ga0075364_10094414
815 Ga0075364_10152716
816 Ga0075364_10206018
817 Ga0075364_10224991
818 Ga0070716_100039299
819 Ga0070716_100093808
820 Ga0070716_100200251
821 Ga0070712_100000816
822 Ga0070712_100171513
823 Ga0075362_10025626
824 Ga0075362_10062100
825 Ga0075367_10000918
826 Ga0075367_10012940
827 Ga0075367_10036055
828 Ga0075367_10043415
829 Ga0075367_10196716
830 Ga0075369_10002975
831 Ga0075369_10010637
832 Ga0075366_10231775
833 Ga0075370_10000639
834 Ga0075370_10044711
835 Ga0075370_10120228
836 Ga0068871_100054150
837 Ga0075428_100000955
838 Ga0075428_100004586
839 Ga0075428_100017537
840 Ga0075428_100197126
841 Ga0075428_100266567
842 Ga0075428_100468908
843 Ga0075428_100542098
844 Ga0075430_100007452
845 Ga0075430_100010053
846 Ga0075431_100000463
847 Ga0075431_100053130
848 Ga0075431_100070492
849 Ga0075431_100132269
850 Ga0075431_100228808
851 Ga0075429_100003169
852 Ga0068865_100000633
853 Ga0068865_100159810
854 Ga0097620_100002335
855 Ga0097620_100175110
856 Ga0099826_10136806
857 Ga0075435_100352673
858 Ga0105240_10367496
859 Ga0111539_10071481
860 Ga0111539_10103268
861 Ga0105245_10001210
862 Ga0105247_10000896
863 Ga0105247_10043520
864 Ga0114129_10000160
865 Ga0114129_10013266
866 Ga0114129_10078932
867 Ga0114129_10109593
868 Ga0114129_10186171
869 Ga0114129_10188979
870 Ga0114129_10646028
871 Ga0105243_10001403
872 Ga0105241_10011773
873 Ga0105242_10000154
874 Ga0105248_10007026
875 Ga0105248_10561908
876 Ga0105237_10037568
877 Ga0105249_10003764
878 Ga0105249_10643482
879 Ga0099796_10094723
880 Ga0105239_10019726
881 Ga0105239_10646395
882 Ga0105246_10393094
883 Ga0157378_10004436
884 Ga0163162_10009439
885 Ga0163162_10011973
886 Ga0163162_10600168
887 Ga0157372_10002900
888 Ga0157375_10000360
889 Ga0157375_10174406
890 Ga0157375_10257918
891 Ga0157380_10000198
892 Ga0157376_10100854
893 Ga0163161_10000846
894 Ga0213874_10054000
895 Ga0213876_10000753
896 Ga0213875_10041518
897 Ga0207692_10000300
898 Ga0207692_10014365
899 Ga0207692_10098828
900 Ga0207642_10000206
901 Ga0207710_10000668
902 Ga0207688_10000804
903 Ga0207688_10005289
904 Ga0207680_10257591
905 Ga0207685_10006788
906 Ga0207699_10023276
907 Ga0207654_10020719
908 Ga0207693_10000469
909 Ga0207693_10119219
910 Ga0207663_10000663
911 Ga0207663_10219907
912 Ga0207681_10012860
913 Ga0207650_10115563
914 Ga0207687_10000480
915 Ga0207700_10107924
916 Ga0207664_10041054
917 Ga0207664_10057951
918 Ga0207664_10167531
919 Ga0207644_10122327
920 Ga0207644_10210569
921 Ga0207706_10012834
922 Ga0207686_10002525
923 Ga0207709_10004429
924 Ga0207670_10034527
925 Ga0207669_10000085
926 Ga0207704_10000728
927 Ga0207704_10051515
928 Ga0207665_10006695
929 Ga0207665_10008806
930 Ga0207665_10037954
931 Ga0207691_10051181
932 Ga0207711_10249909
933 Ga0207689_10390470
934 Ga0207712_10001008
935 Ga0207712_10013861
936 Ga0207668_10029319
937 Ga0207640_10004679
938 Ga0207658_10002257
939 Ga0207658_10031502
940 Ga0207658_10214569
941 Ga0207677_10000820
942 Ga0207677_10037503
943 Ga0207703_10010089
944 Ga0207703_10025994
945 Ga0207703_10156562
946 Ga0207678_10011563
947 Ga0207708_10000329
948 Ga0207708_10084448
949 Ga0207702_10155886
950 Ga0207641_10029212
951 Ga0207641_10103575
952 Ga0207648_10000112
953 Ga0207676_10162341
954 Ga0207675_100000117
955 Ga0207683_10001010
956 Ga0207683_10256111
957 Ga0207698_10023753
958 Ga0207698_10542476
959 Ga0209813_10018959
960 Ga0268266_10009370
961 Ga0268266_10024527
962 Ga0268265_10004318
963 Ga0268265_10113862
964 Ga0268264_10001796
965 Ga0307517_10062531
966 Ga0307515_10011018
967 Ga0265338_10034363
968 Ga0307511_10003102
969 Ga0307511_10064628
970 Ga0307512_10006767
971 Ga0307512_10006967
972 Ga0265327_10012600
973 Ga0307513_10041904
974 Ga0307513_10183985
975 Ga0307509_10011802
976 Ga0307509_10028010
977 Ga0307509_10207338
978 Ga0307508_10048213
979 Ga0307508_10054320
980 Ga0307508_10190435
981 Ga0307514_10027261
982 Ga0307516_10018641
983 Ga0307516_10019325
984 Ga0307516_10058066
985 Ga0307516_10106330
986 Ga0307413_10080946
987 Ga0307410_10009295
988 Ga0307410_10173312
989 Ga0307410_10178734
990 Ga0307407_10162848
991 Ga0307409_100212131
992 Ga0307416_100034920
993 Ga0307416_100697848
994 Ga0307411_10189779
995 Ga0307411_10239801
996 Ga0307415_100013668
997 Ga0307415_100024830
998 Ga0307507_10000003
999 Ga0307507_10005929
1000 Ga0307510_10014262
1001 Ga0307510_10063507
1002 Ga0373926_0004072
1003 Ga0373936_0004137
1004 Ga0373941_0044072
1005 Ga0373945_0002459
1006 Ga0373953_0019681
1007 Ga0373943_0002954
1008 Ga0373946_0004678
1009 Ga0373955_0065213
1010 Ga0316574_0160057
1011 Ga0373927_0002196
1012 Ga0373937_0052232
1013 Ga0316584_0034896
1014 Ga0316584_0064686
1015 Ga0373925_0065040
1016 Ga0373925_0072927
1017 Ga0395905_0597176
1018 Ga0436364_1059460
1019 Ga0436364_1482437
1020 Ga0436365_0532916
1021 Ga0436365_0707403
1022 Ga0436365_1021004
1023 Ga0436365_1451723
1024 Ga0436365_1572675
1025 Ga0436365_1627569
1026 Ga0436363_0414863
1027 Ga0436363_1153181
1028 Ga0436363_1342054
1029 Ga0436362_0106244
1030 Ga0439466_0001192
1031 Ga0439465_0007669
1032 Ga0439465_0020895
1033 Ga0439465_0041863
1034 Ga0451845_0020449
1035 Ga0451853_2512319
1036 Ga0451853_3508463
1037 Ga0439431_0015107
1038 Ga0439442_002613
1039 Ga0439450_002428
1040 Ga0439455_0040982
1041 Ga0450903_002535
1042 Ga0439434_0021562
1043 Ga0466972_0005873
1044 Ga0466972_0008049
1045 Ga0466972_0009641
1046 Ga0466972_0026171
1047 Ga0466972_0042231
1048 Ga0466965_0015530
1049 Ga0466965_0032505
1050 Ga0466966_0012148
1051 Ga0466966_0021640
1052 Ga0466961_0011244
1053 Ga0466961_0198628
1054 Ga0466963_0033970
1055 Ga0466971_0032496
1056 Ga0466968_0012679
1057 Ga0466968_0015685
1058 Ga0466968_0022906
1059 Ga0466970_0040781
1060 Ga0466970_0246457
1061 Ga0466957_0002976
1062 Ga0466957_0013484
1063 Ga0466957_0028454
1064 Ga0466957_0120472
1065 Ga0466957_0261468
1066 Ga0466960_0009811
1067 Ga0466960_0019392
1068 Ga0466959_0027932
1069 Ga0466959_0034662
1070 Ga0466959_0087549
1071 Ga0466959_0392960
1072 Ga0466958_0015384
1073 Ga0466958_0099227
1074 Ga0466958_0153115
1075 Ga0466958_0179845
1076 Ga0466967_0010009
1077 Ga0466967_0097303
1078 Ga0466967_0136502
1079 Ga0466967_0254990
1080 Ga0466967_0300857
1081 Ga0466967_0418355
1082 Ga0495592_0085634
1083 Ga0495603_0012877
1084 Ga0495603_0035080
1085 Ga0495603_0050844
1086 Ga0495629_0008706
1087 Ga0495629_0014814
1088 Ga0495629_0025225
1089 Ga0495629_0351558
1090 Ga0495638_0000427
1091 Ga0495638_0007953
1092 Ga0495638_0063352
1093 Ga0495651_0002263
1094 Ga0495651_0006616
1095 Ga0495651_0045656
1096 Ga0495653_0009998
1097 Ga0495653_0035635
1098 Ga0495653_0035658
1099 Ga0495580_0138221
1100 Ga0495582_0009515
1101 Ga0495582_0031665
1102 Ga0495605_0004242
1103 Ga0495662_0001407
1104 Ga0495662_0001472
1105 Ga0495662_0046555
1106 Ga0495664_0004018
1107 Ga0495664_0005032
1108 Ga0495664_0010177
1109 Ga0495594_0025213
1110 Ga0495607_0040309
1111 Ga0495583_0009375
1112 Ga0495606_0003145
1113 Ga0495606_0007916
1114 Ga0495608_0006456
1115 Ga0495608_0010068
1116 Ga0495616_0028784
1117 Ga0495618_0013102
1118 Ga0495618_0208266
1119 Ga0495620_0013887
1120 Ga0495628_0030510
1121 Ga0495628_0043489
1122 Ga0495628_0136381
1123 Ga0495630_0011073
1124 Ga0495630_0015422
1125 Ga0495630_0020585
1126 Ga0495630_0135693
1127 Ga0495631_0003312
1128 Ga0495637_0076340
1129 Ga0495643_0003020
1130 Ga0495666_0000700
1131 Ga0495666_0081913
1132 Ga0495666_0092594
1133 Ga0495666_0168565
1134 Ga0495652_0024733
1135 Ga0495652_0071245
1136 Ga0495652_0119196
1137 Ga0495665_0001713
1138 Ga0495665_0106871
1139 Ga0495640_0023248
1140 Ga0495640_0025727
1141 Ga0495586_0007627
1142 Ga0495586_0082940
1143 Ga0495587_0003071
1144 Ga0495587_0005829
1145 Ga0495597_0056693
1146 Ga0495645_0003254
1147 Ga0495645_0015612
1148 Ga0495645_0184045
1149 Ga0495622_0042599
1150 Ga0495667_0012679
1151 Ga0495667_0038309
1152 Ga0495634_0003210
1153 Ga0495634_0012936
1154 Ga0495634_0092285
1155 Ga0495611_0005901
1156 Ga0495625_0030703
1157 Ga0495635_0018217
1158 Ga0495588_0018277
1159 Ga0495657_0000085
1160 Ga0495657_0009110
1161 Ga0495657_0072517
1162 Ga0495657_0082936
1163 Ga0495657_0086188
1164 Ga0495599_0017527
1165 Ga0495599_0046469
1166 Ga0495623_0013410
1167 Ga0495623_0057312
1168 Ga0495646_0001147
1169 Ga0495658_0056632
1170 Ga0495658_0293238
1171 Ga0495613_0000396
1172 Ga0495613_0036656
1173 Ga0495613_0054600
1174 Ga0495613_0173837
1175 Ga0495624_0003954
1176 Ga0495624_0097773
1177 Ga0495624_0135618
1178 Ga0495649_0053775
1179 Ga0495600_0069454
1180 Ga0495600_0130134
1181 Ga0495660_0024277
1182 Ga0495581_0003051
1183 Ga0495581_0019802
1184 Ga0495581_0068181
1185 Ga0495581_0181402
1186 Ga0495604_0000250
1187 Ga0495604_0001171
1188 Ga0495604_0237743
1189 Ga0495674_0163251
1190 Ga0495672_0138767
1191 Ga0495676_0010266
1192 Ga0495676_0013790
1193 Ga0495676_0018656
1194 Ga0495676_0067551
1195 Ga0495680_0005669
1196 Ga0495680_0122189
1197 Ga0495680_0155882
1198 Ga0495683_0020667
1199 Ga0495687_001486
1200 Ga0495687_021483
1201 Ga0495687_034246
1202 Ga0495687_085355
1203 Ga0495675_0027216
1204 Ga0495675_0030064
1205 Ga0495675_0033622
1206 Ga0495685_004080
1207 Ga0495681_0005847
1208 Ga0495684_0175569
1209 Ga0495686_0176498
1210 Ga0495593_0000421
1211 Ga0495593_0013725
1212 Ga0495593_0022036
1213 Ga0495593_0095303
1214 Ga0495602_0034492
1215 Ga0495602_0101387
1216 Ga0495602_0136892
1217 Ga0495614_0001131
1218 Ga0495614_0019121
1219 Ga0495614_0072106
1220 Ga0495614_0142817
1221 Ga0495626_0013183
1222 Ga0496100_0000202
1223 Ga0496101_0000285
1224 Ga0496102_0033325
1225 Ga0496102_0033616
1226 Ga0496102_0055519
1227 Ga0496102_0080945
1228 Ga0496102_0226497
1229 Ga0496103_0001095
1230 Ga0496103_0238759
1231 Ga0496104_0002749
1232 Ga0496104_0228878
1233 Ga0496105_0012300
1234 Ga0496106_0000556
1235 Ga0496106_0001563
1236 Ga0496107_0008445
1237 Ga0496107_0316281
1238 Ga0496108_0000759
1239 Ga0496108_0144356
1240 Ga0496108_0144404
1241 Ga0496109_0002063
1242 Ga0496109_0253175
1243 Ga0496109_0459772
1244 Ga0496109_0637581
1245 Ga0496111_0048204
1246 Ga0496112_0082046
1247 Ga0496113_0081756
1248 Ga0496114_0001695
1249 Ga0496114_0001795
1250 Ga0496115_0002918
1251 Ga0496115_0005038
1252 Ga0496115_0367789
1253 Ga0496115_0392533
1254 Ga0496116_0000227
1255 Ga0496117_0007103
1256 Ga0496118_0003523
1257 Ga0496118_0040897
1258 Ga0496119_0001766
1259 Ga0496119_0094203
1260 Ga0496126_0019379
1261 Ga0501032_0003441
1262 Ga0501032_0004434
1263 Ga0501032_0011565
1264 Ga0501033_0000559
1265 Ga0501033_0014667
1266 Ga0501033_0138652
1267 Ga0501034_0001109
1268 Ga0501034_0003163
1269 Ga0501034_0004347
1270 Ga0501034_0015265
1271 Ga0501034_0061592
1272 Ga0501036_0027704
1273 Ga0501036_0075648
1274 Ga0501036_0123706
1275 Ga0501036_0138183
1276 Ga0501037_0006470
1277 Ga0501037_0011211
1278 Ga0501037_0016834
1279 Ga0501038_0009880
1280 Ga0501038_0017035
1281 Ga0501038_0053977
1282 Ga0501039_0001475
1283 Ga0501039_0004829
1284 Ga0501040_0197756
1285 Ga0501040_0237680
1286 Ga0501042_0005497
1287 Ga0501043_0009079
1288 Ga0501043_0015843
1289 Ga0501043_0050091
1290 Ga0501043_0053874
1291 Ga0501043_0348613
1292 Ga0501046_0001136
1293 Ga0501046_0067031
1294 Ga0501047_0008199
1295 Ga0501047_0075214
1296 Ga0501048_0001774
1297 Ga0501068_0040780
1298 Ga0501069_0000043
1299 Ga0501069_0000817
1300 Ga0501069_0055072
1301 Ga0501070_0000298
1302 Ga0501070_0000448
1303 Ga0501070_0000622
1304 Ga0501070_0000942
1305 Ga0501070_0011193
1306 Ga0501070_0023503
1307 Ga0501070_0068563
1308 Ga0501071_0005983
1309 Ga0501071_0013196
1310 Ga0501071_0034990
1311 Ga0501072_0018470
1312 Ga0501072_0103697
1313 Ga0501072_0115790
1314 Ga0501073_0000574
1315 Ga0501073_0003297
1316 Ga0501073_0050920
1317 Ga0501074_0001020
1318 Ga0501074_0019397
1319 Ga0501074_0029856
1320 Ga0501074_0085783
1321 Ga0501074_0102077
1322 Ga0501075_0002668
1323 Ga0501076_0101986
1324 Ga0501077_0013340
1325 Ga0501079_0005057
1326 Ga0501080_0000863
1327 Ga0501080_0001976
1328 Ga0501080_0091616
1329 Ga0501080_0119573
1330 Ga0501080_0247867
1331 Ga0501080_0305609
1332 Ga0501081_0307567
1333 Ga0501083_0000608
1334 Ga0501083_0210623
1335 Ga0501035_0000753
1336 Ga0501035_0017267
1337 Ga0501044_0001366
1338 Ga0501044_0001677
1339 Ga0501044_0002308
1340 Ga0501044_0020625
1341 Ga0501044_0092672
1342 Ga0501045_0042936
1343 Ga0501045_0247884
1344 nmdc:mga03683_18185_c1
1345 nmdc:mga03683_41638_c1
1346 nmdc:mga03n38_194026_c1
1347 nmdc:mga03n38_23345_c1
1348 nmdc:mga03n38_26814_c1
1349 nmdc:mga03n38_98271_c1
1350 nmdc:mga00v17_175793_c1
1351 nmdc:mga00v17_3787_c1
1352 nmdc:mga00v17_61915_c1
1353 nmdc:mga0yw44_125269_c1
1354 nmdc:mga0yw44_12999_c1
1355 nmdc:mga0yw44_173363_c1
1356 nmdc:mga0yw44_30802_c1
1357 nmdc:mga0yw44_55616_c1
1358 nmdc:mga06z11_30366_c1
1359 nmdc:mga06z11_56837_c1
1360 nmdc:mga04h51_7238_c1
1361 nmdc:mga07m45_116984_c1
1362 nmdc:mga07m45_22174_c1
1363 nmdc:mga07m45_44238_c1
1364 nmdc:mga07m45_68875_c1
1365 nmdc:mga07m45_88689_c1
1366 nmdc:mga05p37_112467_c1
1367 nmdc:mga05p37_24750_c1
1368 nmdc:mga05p37_560389_c1
1369 nmdc:mga05p37_6556_c1
1370 nmdc:mga09592_277501_c1
1371 nmdc:mga0qj67_1514_c1
1372 nmdc:mga0qj67_178562_c1
1373 nmdc:mga0qj67_5721_c1
1374 nmdc:mga0qj67_95851_c1
1375 nmdc:mga06r32_15673_c1
1376 nmdc:mga06r32_202245_c1
1377 nmdc:mga06r32_256694_c1
1378 nmdc:mga06r32_394798_c1
1379 nmdc:mga06r32_576038_c1
1380 nmdc:mga06r32_6927_c1
1381 nmdc:mga06r32_9149_c1
1382 nmdc:mga08y16_73203_c1
1383 nmdc:mga0sz30_19120_c1
1384 nmdc:mga0sz30_2196_c1
1385 nmdc:mga0sz30_46711_c1
1386 nmdc:mga0sz30_5503_c1
1387 Ga0495601_0138394
1388 Ga0495601_0219737
1389 Ga0495612_0076024
1390 Ga0495612_0114049
1391 Ga0500610_0011964
1392 Ga0495595_0002019
1393 Ga0495595_0141430
1394 Ga0495619_0020517
1395 Ga0495619_0060887
1396 Ga0500578_0070092
1397 Ga0500578_0133012
1398 Ga0500643_002800
1399 Ga0500644_0079228
1400 Ga0500566_0001370
1401 Ga0500566_0108387
1402 Ga0500556_0033720
1403 Ga0500562_049539
1404 Ga0500569_002635
1405 Ga0500608_094005
1406 Ga0500628_010413
1407 Ga0500652_064113
1408 Ga0500559_0134580
1409 Ga0500573_0033901
1410 Ga0500573_0067595
1411 Ga0500579_111322
1412 Ga0500600_0073260
1413 Ga0500604_0065390
1414 Ga0500616_0083002
1415 Ga0500616_0083510
1416 Ga0500630_049169
1417 Ga0500645_000181
1418 Ga0500656_002340
1419 Ga0501084_0001510
1420 Ga0501082_0176418
1421 Ga0466962_0001728
1422 Ga0466962_0002480
1423 Ga0530510_0002286
1424 2508676553
1425 2517763236
1426 2548696611
1427 2585313812
1428 2616697775
1429 2644511744
1430 2671836170
1431 2676200543
1432 2686539990
1433 2689956972
1434 2689994280
1435 2738890844
1436 2774845121
1437 2774854326
1438 2785374594
1439 2812361066
1440 2842140189
1441 2895888807
1442 2919713500
1443 2929216849
1444 2939588880
1445 2946073308
1446 2954691560
1447 2954706654
1448 3003006618
1449 8002776606
1450 8002788458

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00296

Bac_luciferase

Luciferase-like monooxygenase

1

287

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
5w4z-assembly1.cif.gz_A crystal structure of riboflavin lyase (rcae) with modified fmn and substrate riboflavin 0.7953 2 316
3fgc-assembly1.cif.gz_A crystal structure of the bacterial luciferase:flavin complex reveals the basis of intersubunit communication 0.793 1 307
1luc-assembly1.cif.gz_A bacterial luciferase 0.7864 1 312
5w4z-assembly1.cif.gz_A crystal structure of riboflavin lyase (rcae) with modified fmn and substrate riboflavin 0.7861 2 316
3fgc-assembly2.cif.gz_C crystal structure of the bacterial luciferase:flavin complex reveals the basis of intersubunit communication 0.7858 1 307
ID Description Score Start End Superfamily
af_P9WM03_11_339_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8418 17 305 3.20.20.30
af_P9WIB7_23_373_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.7991 23 306 3.20.20.30
5w4zA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.7953 2 316 3.20.20.30
af_O05772_7_317_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.7928 9 307 3.20.20.30
5w4zA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.7861 2 316 3.20.20.30
ID Description Score Start End GO Terms
AF-A0A7G1I382-F1-model_v4 Luciferase-like domain-containing protein 0.9752 156 318 GO:0016705
AF-A0A2S9FBB6-F1-model_v4 LLM class F420-dependent oxidoreductase 0.975 1 282 GO:0016705
AF-A0A2S9FBB6-F1-model_v4 LLM class F420-dependent oxidoreductase 0.9682 1 282 GO:0016705
AF-A0A7I7LKU1-F1-model_v4 Luciferase-like domain-containing protein 0.9674 108 318 GO:0016705
AF-A0A535L8Y4-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.9639 1 185 GO:0016705

Map