F477601

General Info

Members Datasets Scaffolds Average Seq Length
725 313 716 210

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100000670|Ga0070706_1000006703
Length 231
Sequence MGVRRGRFADVNSLLHALQPLFAVAFTVLGAPFTWLELVAFVLAVAMVVFNIRVNPLGWPLAIVSSLLYFALFWSSRLYGDASLQIFFAAVALWGWWQWLRGTQADGGALRVRTLGPRGRTLIVLVLAAAWPATGLFLKRYTDTDVPWWDAFPTAASVIGQWLLGRKYLENWVAWIVVNIVSVGLFAYKGLWLTVVLYTIFVAMSVVGWRAWRRLLGATSAAAAARAPHAA

Samples

Sample ID Description Type Environment
1 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
2 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
3 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
4 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
5 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
6 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
7 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
8 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
9 2643221660 Methylibium sp. Root1272 Isolate Unclassified
10 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
15 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
16 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
17 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
18 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
68 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
69 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
70 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
71 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
103 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
104 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
105 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
109 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
163 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
164 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
169 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
170 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
171 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
172 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
173 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
174 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
175 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
176 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
177 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
178 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
179 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
180 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
181 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
182 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
183 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
184 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
185 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
186 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
187 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
188 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
189 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
190 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
191 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
192 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
193 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
194 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
195 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
196 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
197 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
198 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
199 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
200 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
201 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
202 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
203 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
204 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
205 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
206 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
207 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
208 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
209 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
210 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
211 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
212 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
213 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
214 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
215 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
216 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
217 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
218 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
219 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
220 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
221 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
222 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
223 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
224 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
225 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
226 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
227 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
228 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
229 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
230 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
231 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
232 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
233 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
234 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
235 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
236 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
237 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
238 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
239 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
240 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
241 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
242 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
243 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
244 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
245 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
246 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
247 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
248 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
249 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
250 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
251 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
252 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
253 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
254 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
255 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
256 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
257 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
258 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
259 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
260 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
261 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
262 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
263 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
264 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
265 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
266 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
267 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
268 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
269 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
270 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
271 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
276 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
278 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
279 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
280 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
281 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
282 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
283 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
284 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
285 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
286 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
287 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
288 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
289 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
290 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
291 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
292 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
293 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
294 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
295 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
296 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
297 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
298 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
299 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
300 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
301 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
302 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
303 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
304 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
305 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
306 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
307 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
308 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
309 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
310 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
311 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
312 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
313 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.76
Metatranscriptomes 0
Isolates 1.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.38
Nodule 0.28
Rhizoplane 1.93
Rhizosphere 71.72
Stem 0
Stem Tuber 0
Unclassified 8.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1001709 3300002773 Bacteria 9004
2 JGI25152J39213_1002886 3300002773 Bacteria 6145
3 JGI25153J46596_10029375 3300003215 Bacteria 1889
4 rootL2_10175725 3300003322 Bacteria 1210
5 rootH1_10012451 3300003323 Bacteria 2217
6 rootH1_10029292 3300003323 Bacteria 1640
7 Ga0055526_1004651 3300003771 Bacteria 8162
8 Ga0055530_10011329 3300003791 Bacteria 3210
9 Ga0055530_10013387 3300003791 Bacteria 2803
10 Ga0055540_1000002 3300003792 Bacteria 436954
11 Ga0055531_10004641 3300003794 Bacteria 8250
12 Ga0065165_1003311 3300005262 Bacteria 11548
13 Ga0070658_10839318 3300005327 Bacteria 798
14 Ga0070676_10009865 3300005328 Bacteria 5167
15 Ga0070676_10013248 3300005328 Bacteria 4517
16 Ga0070676_10014725 3300005328 Bacteria 4302
17 Ga0070676_10026643 3300005328 Bacteria 3273
18 Ga0070676_10109878 3300005328 Bacteria 1715
19 Ga0070676_10380063 3300005328 Bacteria 978
20 Ga0070683_100186750 3300005329 Bacteria 1968
21 Ga0070690_100123156 3300005330 Bacteria 1743
22 Ga0070670_100001820 3300005331 Bacteria 17371
23 Ga0070670_100016116 3300005331 Bacteria 6414
24 Ga0070670_100097990 3300005331 Bacteria 2522
25 Ga0070670_100101058 3300005331 Bacteria 2483
26 Ga0070670_100415891 3300005331 Bacteria 1188
27 Ga0070677_10001548 3300005333 Bacteria 7279
28 Ga0070677_10009375 3300005333 Bacteria 3317
29 Ga0070677_10027675 3300005333 Bacteria 2136
30 Ga0070677_10037333 3300005333 Bacteria 1895
31 Ga0068869_100004621 3300005334 Bacteria 8588
32 Ga0068869_100013561 3300005334 Bacteria 5424
33 Ga0068869_100027665 3300005334 Bacteria 3956
34 Ga0068869_100227886 3300005334 Bacteria 1480
35 Ga0070666_10041643 3300005335 Bacteria 3070
36 Ga0068868_100081103 3300005338 Bacteria 2600
37 Ga0068868_100097025 3300005338 Bacteria 2381
38 Ga0068868_100146793 3300005338 Bacteria 1940
39 Ga0068868_100334934 3300005338 Bacteria 1292
40 Ga0070689_100034512 3300005340 Bacteria 3860
41 Ga0070689_100175586 3300005340 Bacteria 1737
42 Ga0070689_100896337 3300005340 Bacteria 784
43 Ga0070687_100014736 3300005343 Bacteria 3519
44 Ga0070661_100290663 3300005344 Bacteria 1270
45 Ga0070661_100621432 3300005344 Bacteria 875
46 Ga0070668_100004953 3300005347 Bacteria 9859
47 Ga0070668_100009291 3300005347 Bacteria 7292
48 Ga0070668_100386909 3300005347 Bacteria 1191
49 Ga0070669_100006105 3300005353 Bacteria 8694
50 Ga0070669_100025041 3300005353 Bacteria 4283
51 Ga0070669_100066477 3300005353 Bacteria 2657
52 Ga0070669_100261286 3300005353 Bacteria 1382
53 Ga0070675_100001535 3300005354 Bacteria 17078
54 Ga0070675_100005184 3300005354 Bacteria 9937
55 Ga0070675_100028715 3300005354 Bacteria 4478
56 Ga0070675_101052871 3300005354 Bacteria 747
57 Ga0070671_100021133 3300005355 Bacteria 5314
58 Ga0070671_100040868 3300005355 Bacteria 3853
59 Ga0070671_100081753 3300005355 Bacteria 2701
60 Ga0070671_100357690 3300005355 Bacteria 1246
61 Ga0070671_100398329 3300005355 Bacteria 1177
62 Ga0070671_100674958 3300005355 Bacteria 895
63 Ga0070674_100008300 3300005356 Bacteria 6178
64 Ga0070674_100030634 3300005356 Bacteria 3558
65 Ga0070674_100069521 3300005356 Bacteria 2484
66 Ga0070674_100236318 3300005356 Bacteria 1428
67 Ga0070674_100263727 3300005356 Bacteria 1358
68 Ga0070673_100005136 3300005364 Bacteria 8348
69 Ga0070673_100008629 3300005364 Bacteria 6789
70 Ga0070673_100072711 3300005364 Bacteria 2766
71 Ga0070673_100234991 3300005364 Bacteria 1591
72 Ga0070673_100261577 3300005364 Bacteria 1512
73 Ga0070673_100305514 3300005364 Bacteria 1402
74 Ga0070673_100413928 3300005364 Bacteria 1207
75 Ga0070673_100762403 3300005364 Bacteria 891
76 Ga0070673_101090464 3300005364 Bacteria 746
77 Ga0070688_100068326 3300005365 Bacteria 2265
78 Ga0070667_100001171 3300005367 Bacteria 23847
79 Ga0070667_100003010 3300005367 Bacteria 14476
80 Ga0070667_100043049 3300005367 Bacteria 3789
81 Ga0070667_100089205 3300005367 Bacteria 2648
82 Ga0070667_100106214 3300005367 Bacteria 2430
83 Ga0070667_100419924 3300005367 Bacteria 1219
84 Ga0070667_100432808 3300005367 Bacteria 1200
85 Ga0070667_100990802 3300005367 Bacteria 784
86 Ga0070663_100029789 3300005455 Bacteria 3734
87 Ga0070663_100275335 3300005455 Bacteria 1339
88 Ga0070663_100415337 3300005455 Bacteria 1103
89 Ga0070678_100001334 3300005456 Bacteria 13117
90 Ga0070678_100009607 3300005456 Bacteria 5871
91 Ga0070678_100096522 3300005456 Bacteria 2280
92 Ga0070678_100477514 3300005456 Bacteria 1096
93 Ga0070678_100621406 3300005456 Bacteria 966
94 Ga0070678_100711885 3300005456 Bacteria 905
95 Ga0070678_100938836 3300005456 Bacteria 792
96 Ga0070662_100010471 3300005457 Bacteria 6087
97 Ga0070662_100032584 3300005457 Bacteria 3662
98 Ga0070662_100034601 3300005457 Bacteria 3563
99 Ga0070662_100813706 3300005457 Bacteria 794
100 Ga0068867_100002841 3300005459 Bacteria 12176
101 Ga0068867_100002971 3300005459 Bacteria 11946
102 Ga0068867_100032757 3300005459 Bacteria 3760
103 Ga0068867_100042848 3300005459 Bacteria 3312
104 Ga0068867_100052489 3300005459 Bacteria 3009
105 Ga0068867_100105376 3300005459 Bacteria 2159
106 Ga0068867_100139769 3300005459 Bacteria 1892
107 Ga0068867_100146767 3300005459 Bacteria 1849
108 Ga0070706_100000670 3300005467 Bacteria 38829
109 Ga0070707_100557157 3300005468 Bacteria 1108
110 Ga0070699_100224034 3300005518 Bacteria 1676
111 Ga0070679_100194436 3300005530 Bacteria 1996
112 Ga0070672_100002062 3300005543 Bacteria 12665
113 Ga0070672_100003281 3300005543 Bacteria 10476
114 Ga0070672_100010713 3300005543 Bacteria 6369
115 Ga0070672_100023394 3300005543 Bacteria 4554
116 Ga0070672_100042983 3300005543 Bacteria 3481
117 Ga0070672_100048996 3300005543 Bacteria 3285
118 Ga0070672_100062465 3300005543 Bacteria 2939
119 Ga0070672_100140374 3300005543 Bacteria 1992
120 Ga0070672_100205866 3300005543 Bacteria 1647
121 Ga0070672_100272832 3300005543 Bacteria 1428
122 Ga0070672_100282596 3300005543 Bacteria 1403
123 Ga0070672_100388970 3300005543 Bacteria 1194
124 Ga0070686_100789242 3300005544 Bacteria 765
125 Ga0070693_100079779 3300005547 Bacteria 1948
126 Ga0070665_100191214 3300005548 Bacteria 2047
127 Ga0070665_100471710 3300005548 Bacteria 1266
128 Ga0070664_100104728 3300005564 Bacteria 2463
129 Ga0070664_100706313 3300005564 Bacteria 940
130 Ga0068857_100012825 3300005577 Bacteria 7303
131 Ga0068857_100025437 3300005577 Bacteria 5212
132 Ga0068854_100018059 3300005578 Bacteria 4728
133 Ga0068854_100030430 3300005578 Bacteria 3744
134 Ga0068854_100143833 3300005578 Bacteria 1833
135 Ga0068856_100059001 3300005614 Bacteria 3790
136 Ga0068852_100070012 3300005616 Bacteria 3076
137 Ga0068852_100164833 3300005616 Bacteria 2073
138 Ga0068852_100601482 3300005616 Bacteria 1104
139 Ga0068852_101136915 3300005616 Bacteria 801
140 Ga0068859_100002636 3300005617 Bacteria 18245
141 Ga0068859_100012962 3300005617 Bacteria 8376
142 Ga0068859_100078982 3300005617 Bacteria 3330
143 Ga0068864_100020879 3300005618 Bacteria 5482
144 Ga0068864_100045556 3300005618 Bacteria 3762
145 Ga0068864_100110843 3300005618 Bacteria 2444
146 Ga0068864_100201786 3300005618 Bacteria 1827
147 Ga0068864_100525333 3300005618 Bacteria 1141
148 Ga0068866_10007367 3300005718 Bacteria 4605
149 Ga0068866_10119073 3300005718 Bacteria 1485
150 Ga0068861_100040775 3300005719 Bacteria 3474
151 Ga0068861_100063998 3300005719 Bacteria 2828
152 Ga0068851_10104658 3300005834 Bacteria 1505
153 Ga0068851_10397291 3300005834 Bacteria 810
154 Ga0068870_10041700 3300005840 Bacteria 2386
155 Ga0068870_10042666 3300005840 Bacteria 2362
156 Ga0068863_100004608 3300005841 Bacteria 13579
157 Ga0068863_100131899 3300005841 Bacteria 2386
158 Ga0068863_100147201 3300005841 Bacteria 2253
159 Ga0068863_100292604 3300005841 Bacteria 1579
160 Ga0068863_100376200 3300005841 Bacteria 1386
161 Ga0068863_100486275 3300005841 Bacteria 1214
162 Ga0068863_100654072 3300005841 Bacteria 1042
163 Ga0068858_100001760 3300005842 Bacteria 22084
164 Ga0068858_100054908 3300005842 Bacteria 3683
165 Ga0068858_100104820 3300005842 Bacteria 2639
166 Ga0068860_100001433 3300005843 Bacteria 25834
167 Ga0068860_100299585 3300005843 Bacteria 1575
168 Ga0068860_100373451 3300005843 Bacteria 1407
169 Ga0068860_100536719 3300005843 Bacteria 1171
170 Ga0068862_100025669 3300005844 Bacteria 4948
171 Ga0068862_100036314 3300005844 Bacteria 4177
172 Ga0070717_10873321 3300006028 Bacteria 819
173 Ga0075365_10106212 3300006038 Bacteria 1926
174 Ga0075368_10024067 3300006042 Bacteria 2330
175 Ga0075368_10064592 3300006042 Bacteria 1470
176 Ga0075363_100044589 3300006048 Bacteria 2350
177 Ga0075363_100072670 3300006048 Bacteria 1871
178 Ga0075363_100084357 3300006048 Bacteria 1742
179 Ga0075363_100197021 3300006048 Bacteria 1150
180 Ga0075364_10050756 3300006051 Bacteria 2708
181 Ga0075362_10058661 3300006177 Bacteria 1736
182 Ga0075362_10127865 3300006177 Bacteria 1207
183 Ga0075362_10305949 3300006177 Bacteria 789
184 Ga0075367_10022479 3300006178 Bacteria 3537
185 Ga0075367_10029363 3300006178 Bacteria 3144
186 Ga0075367_10294385 3300006178 Bacteria 1021
187 Ga0075369_10010341 3300006186 Bacteria 3647
188 Ga0075366_10013799 3300006195 Bacteria 4606
189 Ga0075366_10023472 3300006195 Bacteria 3593
190 Ga0075366_10034429 3300006195 Bacteria 2983
191 Ga0075366_10042422 3300006195 Bacteria 2693
192 Ga0075366_10059108 3300006195 Bacteria 2277
193 Ga0075366_10189916 3300006195 Bacteria 1248
194 Ga0075366_10334354 3300006195 Bacteria 929
195 Ga0097621_100020890 3300006237 Bacteria 5051
196 Ga0097621_100067657 3300006237 Bacteria 2944
197 Ga0097621_100083076 3300006237 Bacteria 2668
198 Ga0097621_100325218 3300006237 Bacteria 1363
199 Ga0097621_100439860 3300006237 Bacteria 1173
200 Ga0097621_100894581 3300006237 Bacteria 827
201 Ga0075370_10001743 3300006353 Bacteria 9690
202 Ga0075370_10007921 3300006353 Bacteria 5439
203 Ga0075370_10011666 3300006353 Bacteria 4624
204 Ga0075370_10032948 3300006353 Bacteria 2899
205 Ga0075370_10038650 3300006353 Bacteria 2686
206 Ga0075370_10125572 3300006353 Bacteria 1495
207 Ga0075370_10152705 3300006353 Bacteria 1353
208 Ga0075370_10204779 3300006353 Bacteria 1164
209 Ga0068871_100005010 3300006358 Bacteria 9253
210 Ga0068871_100040812 3300006358 Bacteria 3718
211 Ga0068871_100137399 3300006358 Bacteria 2076
212 Ga0068871_100141677 3300006358 Bacteria 2045
213 Ga0068871_100195663 3300006358 Bacteria 1743
214 Ga0068865_100010127 3300006881 Bacteria 5862
215 Ga0068865_100036259 3300006881 Bacteria 3323
216 Ga0097620_100002636 3300006931 Bacteria 18245
217 Ga0097620_100012962 3300006931 Bacteria 8376
218 Ga0097620_100078978 3300006931 Bacteria 3330
219 Ga0079104_1000017 3300006946 Bacteria 313784
220 Ga0105245_10048773 3300009098 Bacteria 3789
221 Ga0105245_10122662 3300009098 Bacteria 2429
222 Ga0105245_10256066 3300009098 Bacteria 1702
223 Ga0105243_10049442 3300009148 Bacteria 3317
224 Ga0105243_10082533 3300009148 Bacteria 2627
225 Ga0105243_10187471 3300009148 Bacteria 1804
226 Ga0105243_10232044 3300009148 Bacteria 1638
227 Ga0105241_10953023 3300009174 Bacteria 800
228 Ga0105242_10014443 3300009176 Bacteria 6119
229 Ga0105242_10204457 3300009176 Bacteria 1756
230 Ga0105248_10138031 3300009177 Bacteria 2751
231 Ga0105248_10180017 3300009177 Bacteria 2382
232 Ga0105237_10003466 3300009545 Bacteria 18708
233 Ga0105237_10008395 3300009545 Bacteria 11193
234 Ga0105237_10157249 3300009545 Bacteria 2270
235 Ga0105238_10007665 3300009551 Bacteria 10803
236 Ga0105238_10824318 3300009551 Bacteria 944
237 Ga0105249_10009522 3300009553 Bacteria 8513
238 Ga0105249_10052686 3300009553 Bacteria 3717
239 Ga0105239_10003789 3300010375 Bacteria 18406
240 Ga0105239_10060249 3300010375 Bacteria 4166
241 Ga0157371_10031263 3300013102 Bacteria 3835
242 Ga0157369_10660417 3300013105 Bacteria 1078
243 Ga0157374_10121407 3300013296 Bacteria 2522
244 Ga0157374_10561120 3300013296 Bacteria 1150
245 Ga0157374_10641785 3300013296 Bacteria 1073
246 Ga0157378_10044989 3300013297 Bacteria 3921
247 Ga0157378_10078498 3300013297 Bacteria 2978
248 Ga0157378_10271274 3300013297 Bacteria 1632
249 Ga0163162_10028472 3300013306 Bacteria 5529
250 Ga0163162_10052435 3300013306 Bacteria 4097
251 Ga0163162_10060587 3300013306 Bacteria 3821
252 Ga0163162_10166173 3300013306 Bacteria 2330
253 Ga0163162_10194073 3300013306 Bacteria 2159
254 Ga0157375_10003544 3300013308 Bacteria 13558
255 Ga0157375_10031329 3300013308 Bacteria 5025
256 Ga0157375_10039345 3300013308 Bacteria 4551
257 Ga0157375_10056327 3300013308 Bacteria 3881
258 Ga0157375_10135933 3300013308 Bacteria 2582
259 Ga0157375_10237311 3300013308 Bacteria 1983
260 Ga0157375_11266767 3300013308 Bacteria 866
261 Ga0163163_10083873 3300014325 Bacteria 3192
262 Ga0163163_10179958 3300014325 Bacteria 2161
263 Ga0163163_10510020 3300014325 Bacteria 1265
264 Ga0157380_10102647 3300014326 Bacteria 2385
265 Ga0157380_10318490 3300014326 Bacteria 1441
266 Ga0157380_10556477 3300014326 Bacteria 1126
267 Ga0157377_10068176 3300014745 Bacteria 2050
268 Ga0157379_10013894 3300014968 Bacteria 7057
269 Ga0157379_10031728 3300014968 Bacteria 4707
270 Ga0157376_10051337 3300014969 Bacteria 3425
271 Ga0157376_10327596 3300014969 Bacteria 1458
272 Ga0157376_10361085 3300014969 Bacteria 1393
273 Ga0163161_10031938 3300017792 Bacteria 3755
274 Ga0163161_10049540 3300017792 Bacteria 3036
275 Ga0163161_10051865 3300017792 Bacteria 2973
276 Ga0213872_10042754 3300021361 Bacteria 2066
277 Ga0207425_1000131 3300025245 Bacteria 68511
278 Ga0209129_1000075 3300025258 Bacteria 201273
279 Ga0209673_1002275 3300025273 Bacteria 13761
280 Ga0209673_1051328 3300025273 Bacteria 1089
281 Ga0209675_1006935 3300025291 Bacteria 4444
282 Ga0209564_1000046 3300025295 Bacteria 373787
283 Ga0209758_1000045 3300025297 Bacteria 369174
284 Ga0209758_1000052 3300025297 Bacteria 338962
285 Ga0209050_1000247 3300025298 Bacteria 116514
286 Ga0209050_1000457 3300025298 Bacteria 73281
287 Ga0209050_1022563 3300025298 Bacteria 2251
288 Ga0209256_1000011 3300025299 Bacteria 865309
289 Ga0209256_1013851 3300025299 Bacteria 2959
290 Ga0209256_1064149 3300025299 Bacteria 846
291 Ga0209051_1000024 3300025303 Bacteria 437007
292 Ga0209051_1002674 3300025303 Bacteria 12469
293 Ga0209051_1018049 3300025303 Bacteria 3135
294 Ga0209257_1000079 3300025304 Bacteria 316420
295 Ga0209257_1030582 3300025304 Bacteria 1736
296 Ga0207697_10017238 3300025315 Bacteria 2969
297 Ga0207656_10111072 3300025321 Bacteria 1267
298 Ga0207656_10193028 3300025321 Bacteria 981
299 Ga0207682_10001523 3300025893 Bacteria 10677
300 Ga0207682_10027272 3300025893 Bacteria 2274
301 Ga0207682_10033070 3300025893 Bacteria 2080
302 Ga0207682_10049175 3300025893 Bacteria 1740
303 Ga0207682_10063659 3300025893 Bacteria 1549
304 Ga0207642_10018235 3300025899 Bacteria 2689
305 Ga0207642_10030161 3300025899 Bacteria 2256
306 Ga0207642_10051757 3300025899 Bacteria 1860
307 Ga0207642_10157072 3300025899 Bacteria 1217
308 Ga0207680_10110209 3300025903 Bacteria 1784
309 Ga0207680_10325724 3300025903 Bacteria 1075
310 Ga0207680_10394355 3300025903 Bacteria 977
311 Ga0207645_10003743 3300025907 Bacteria 11440
312 Ga0207645_10008686 3300025907 Bacteria 7073
313 Ga0207645_10012119 3300025907 Bacteria 5857
314 Ga0207643_10049838 3300025908 Bacteria 2374
315 Ga0207643_10057915 3300025908 Bacteria 2207
316 Ga0207643_10068631 3300025908 Bacteria 2037
317 Ga0207705_10262264 3300025909 Bacteria 1319
318 Ga0207705_10534207 3300025909 Bacteria 911
319 Ga0207684_10068094 3300025910 Bacteria 3026
320 Ga0207654_10039557 3300025911 Bacteria 2653
321 Ga0207695_10031173 3300025913 Bacteria 5854
322 Ga0207671_10005697 3300025914 Bacteria 11382
323 Ga0207662_10005052 3300025918 Bacteria 6989
324 Ga0207657_10034678 3300025919 Bacteria 4535
325 Ga0207649_10183643 3300025920 Bacteria 1466
326 Ga0207649_10549080 3300025920 Bacteria 884
327 Ga0207646_10771870 3300025922 Bacteria 857
328 Ga0207681_10018380 3300025923 Bacteria 4403
329 Ga0207681_10037586 3300025923 Bacteria 3200
330 Ga0207681_10049977 3300025923 Bacteria 2828
331 Ga0207681_10409725 3300025923 Bacteria 1096
332 Ga0207694_10024013 3300025924 Bacteria 4630
333 Ga0207650_10002460 3300025925 Bacteria 12887
334 Ga0207650_10009009 3300025925 Bacteria 6823
335 Ga0207650_10075499 3300025925 Bacteria 2544
336 Ga0207650_10285723 3300025925 Bacteria 1344
337 Ga0207650_10332674 3300025925 Bacteria 1246
338 Ga0207650_10469996 3300025925 Bacteria 1048
339 Ga0207659_10006295 3300025926 Bacteria 7260
340 Ga0207659_10041441 3300025926 Bacteria 3224
341 Ga0207659_10064026 3300025926 Bacteria 2660
342 Ga0207659_10160710 3300025926 Bacteria 1763
343 Ga0207659_10253830 3300025926 Bacteria 1428
344 Ga0207687_10053973 3300025927 Bacteria 2810
345 Ga0207687_10075296 3300025927 Bacteria 2422
346 Ga0207644_10016645 3300025931 Bacteria 4949
347 Ga0207644_10020354 3300025931 Bacteria 4511
348 Ga0207644_10042428 3300025931 Bacteria 3224
349 Ga0207644_10049561 3300025931 Bacteria 3007
350 Ga0207644_10219693 3300025931 Bacteria 1506
351 Ga0207644_10308767 3300025931 Bacteria 1276
352 Ga0207706_10031191 3300025933 Bacteria 4750
353 Ga0207706_10113749 3300025933 Bacteria 2380
354 Ga0207706_10242717 3300025933 Bacteria 1575
355 Ga0207686_10025578 3300025934 Bacteria 3435
356 Ga0207709_10021922 3300025935 Bacteria 3619
357 Ga0207709_10394828 3300025935 Bacteria 1056
358 Ga0207670_10035459 3300025936 Bacteria 3234
359 Ga0207670_10188582 3300025936 Bacteria 1559
360 Ga0207669_10014898 3300025937 Bacteria 3909
361 Ga0207669_10066497 3300025937 Bacteria 2241
362 Ga0207669_10074985 3300025937 Bacteria 2142
363 Ga0207669_10115988 3300025937 Bacteria 1806
364 Ga0207669_10132696 3300025937 Bacteria 1714
365 Ga0207669_10158269 3300025937 Bacteria 1596
366 Ga0207704_10008558 3300025938 Bacteria 4899
367 Ga0207704_10027482 3300025938 Bacteria 3141
368 Ga0207691_10001741 3300025940 Bacteria 21453
369 Ga0207691_10006082 3300025940 Bacteria 11664
370 Ga0207691_10007915 3300025940 Bacteria 10231
371 Ga0207691_10021169 3300025940 Bacteria 6144
372 Ga0207691_10038362 3300025940 Bacteria 4434
373 Ga0207691_10045325 3300025940 Bacteria 4043
374 Ga0207691_10082658 3300025940 Bacteria 2884
375 Ga0207691_10085262 3300025940 Bacteria 2835
376 Ga0207691_10106713 3300025940 Bacteria 2494
377 Ga0207691_10157816 3300025940 Bacteria 1991
378 Ga0207691_10172455 3300025940 Bacteria 1894
379 Ga0207691_10531419 3300025940 Bacteria 998
380 Ga0207691_10821458 3300025940 Bacteria 780
381 Ga0207711_10077302 3300025941 Bacteria 2901
382 Ga0207711_10297657 3300025941 Bacteria 1488
383 Ga0207689_10011178 3300025942 Bacteria 7701
384 Ga0207689_10014824 3300025942 Bacteria 6617
385 Ga0207689_10055774 3300025942 Bacteria 3252
386 Ga0207689_10315909 3300025942 Bacteria 1296
387 Ga0207661_10130483 3300025944 Bacteria 2152
388 Ga0207679_10084416 3300025945 Bacteria 2437
389 Ga0207679_10171165 3300025945 Bacteria 1788
390 Ga0207679_10274408 3300025945 Bacteria 1443
391 Ga0207651_10006687 3300025960 Bacteria 6069
392 Ga0207651_10037495 3300025960 Bacteria 3176
393 Ga0207651_10155760 3300025960 Bacteria 1784
394 Ga0207651_10275512 3300025960 Bacteria 1388
395 Ga0207651_10770105 3300025960 Bacteria 852
396 Ga0207712_10005181 3300025961 Bacteria 8251
397 Ga0207712_10076222 3300025961 Bacteria 2427
398 Ga0207668_10033305 3300025972 Bacteria 3412
399 Ga0207668_10092840 3300025972 Bacteria 2222
400 Ga0207640_10451546 3300025981 Bacteria 1059
401 Ga0207640_10714845 3300025981 Bacteria 860
402 Ga0207658_10000959 3300025986 Bacteria 23778
403 Ga0207658_10009082 3300025986 Bacteria 6742
404 Ga0207658_10034313 3300025986 Bacteria 3626
405 Ga0207658_10059730 3300025986 Bacteria 2842
406 Ga0207658_10087064 3300025986 Bacteria 2411
407 Ga0207658_10314803 3300025986 Bacteria 1353
408 Ga0207677_10072104 3300026023 Bacteria 2440
409 Ga0207677_10092228 3300026023 Bacteria 2205
410 Ga0207677_10133104 3300026023 Bacteria 1891
411 Ga0207677_10219121 3300026023 Bacteria 1525
412 Ga0207703_10001350 3300026035 Bacteria 22464
413 Ga0207703_10206014 3300026035 Bacteria 1750
414 Ga0207678_10010696 3300026067 Bacteria 8061
415 Ga0207678_10041360 3300026067 Bacteria 3996
416 Ga0207702_10241988 3300026078 Bacteria 1691
417 Ga0207641_10009363 3300026088 Bacteria 8078
418 Ga0207641_10049902 3300026088 Bacteria 3538
419 Ga0207641_10069885 3300026088 Bacteria 3016
420 Ga0207641_10112479 3300026088 Bacteria 2416
421 Ga0207641_10323964 3300026088 Bacteria 1462
422 Ga0207641_10918976 3300026088 Bacteria 869
423 Ga0207648_10002848 3300026089 Bacteria 18311
424 Ga0207648_10010781 3300026089 Bacteria 8636
425 Ga0207648_10033465 3300026089 Bacteria 4533
426 Ga0207648_10038606 3300026089 Bacteria 4201
427 Ga0207648_10052175 3300026089 Bacteria 3576
428 Ga0207648_10054667 3300026089 Bacteria 3487
429 Ga0207648_10097960 3300026089 Bacteria 2567
430 Ga0207648_10105316 3300026089 Bacteria 2474
431 Ga0207676_10015099 3300026095 Bacteria 5569
432 Ga0207676_10026111 3300026095 Bacteria 4341
433 Ga0207676_10026609 3300026095 Bacteria 4302
434 Ga0207676_10508889 3300026095 Bacteria 1144
435 Ga0207674_10008218 3300026116 Bacteria 12093
436 Ga0207674_10022905 3300026116 Bacteria 6701
437 Ga0207675_100025434 3300026118 Bacteria 5511
438 Ga0207675_100075512 3300026118 Bacteria 3155
439 Ga0207675_101167756 3300026118 Bacteria 790
440 Ga0207683_10006663 3300026121 Bacteria 9879
441 Ga0207683_10011765 3300026121 Bacteria 7468
442 Ga0207683_10013159 3300026121 Bacteria 7059
443 Ga0207683_10048071 3300026121 Bacteria 3736
444 Ga0207683_10052477 3300026121 Bacteria 3573
445 Ga0207683_10084334 3300026121 Bacteria 2824
446 Ga0207683_10118931 3300026121 Bacteria 2371
447 Ga0207683_10176541 3300026121 Bacteria 1936
448 Ga0207683_10188520 3300026121 Bacteria 1872
449 Ga0207698_10036460 3300026142 Bacteria 3610
450 Ga0207698_10280502 3300026142 Bacteria 1541
451 Ga0207698_10461291 3300026142 Bacteria 1229
452 Ga0207698_11003022 3300026142 Bacteria 846
453 Ga0209281_1000042 3300027111 Bacteria 344748
454 Ga0209813_10064684 3300027866 Bacteria 1176
455 Ga0209974_10132095 3300027876 Bacteria 891
456 Ga0268266_10490045 3300028379 Bacteria 1172
457 Ga0268266_10722222 3300028379 Bacteria 961
458 Ga0268265_10058350 3300028380 Bacteria 2946
459 Ga0268265_10756346 3300028380 Bacteria 944
460 Ga0268264_10004852 3300028381 Bacteria 11396
461 Ga0268264_10092858 3300028381 Bacteria 2606
462 Ga0268264_10238395 3300028381 Bacteria 1684
463 Ga0268264_10258278 3300028381 Bacteria 1622
464 Ga0307517_10001871 3300028786 Bacteria 34464
465 Ga0307517_10080650 3300028786 Bacteria 2784
466 Ga0307517_10091945 3300028786 Bacteria 2473
467 Ga0307517_10229954 3300028786 Bacteria 1115
468 Ga0307515_10000991 3300028794 Bacteria 64898
469 Ga0307515_10001283 3300028794 Bacteria 57022
470 Ga0307515_10038740 3300028794 Bacteria 7610
471 Ga0307515_10064124 3300028794 Bacteria 5141
472 Ga0307515_10252323 3300028794 Bacteria 1514
473 Ga0307515_10336081 3300028794 Bacteria 1166
474 Ga0307515_10477683 3300028794 Bacteria 859
475 Ga0307512_10113458 3300030522 Bacteria 1773
476 Ga0307513_10034868 3300031456 Bacteria 5639
477 Ga0307513_10116867 3300031456 Bacteria 2645
478 Ga0307513_10119691 3300031456 Bacteria 2604
479 Ga0307513_10168930 3300031456 Bacteria 2067
480 Ga0307513_10236591 3300031456 Bacteria 1635
481 Ga0307513_10471060 3300031456 Bacteria 977
482 Ga0307513_10617064 3300031456 Bacteria 793
483 Ga0307509_10000041 3300031507 Bacteria 182302
484 Ga0307509_10025279 3300031507 Bacteria 6635
485 Ga0307509_10030443 3300031507 Bacteria 5970
486 Ga0307509_10064009 3300031507 Bacteria 3870
487 Ga0307509_10139159 3300031507 Bacteria 2367
488 Ga0307509_10214130 3300031507 Bacteria 1748
489 Ga0307508_10000227 3300031616 Bacteria 68533
490 Ga0307508_10038562 3300031616 Bacteria 4293
491 Ga0307514_10001840 3300031649 Bacteria 23499
492 Ga0307514_10077945 3300031649 Bacteria 2463
493 Ga0307514_10100606 3300031649 Bacteria 2077
494 Ga0307516_10000312 3300031730 Bacteria 62905
495 Ga0307516_10000497 3300031730 Bacteria 52295
496 Ga0307516_10004946 3300031730 Bacteria 16201
497 Ga0307516_10005605 3300031730 Bacteria 14948
498 Ga0307516_10350336 3300031730 Bacteria 1142
499 Ga0307405_10006547 3300031731 Bacteria 5739
500 Ga0307413_10094755 3300031824 Bacteria 1955
501 Ga0307410_10009817 3300031852 Bacteria 5391
502 Ga0307406_10034996 3300031901 Bacteria 3085
503 Ga0307407_10101551 3300031903 Bacteria 1786
504 Ga0307412_10018914 3300031911 Bacteria 4158
505 Ga0307409_100094217 3300031995 Bacteria 2463
506 Ga0307409_100255757 3300031995 Bacteria 1604
507 Ga0307416_100088088 3300032002 Bacteria 2653
508 Ga0307416_100158615 3300032002 Bacteria 2087
509 Ga0307411_10048663 3300032005 Bacteria 2749
510 Ga0307507_10040065 3300033179 Bacteria 4714
511 Ga0307510_10020701 3300033180 Bacteria 7681
512 Ga0307510_10026627 3300033180 Bacteria 6642
513 Ga0307510_10100095 3300033180 Bacteria 2694
514 Ga0307510_10105002 3300033180 Bacteria 2595
515 Ga0373953_0051288 3300035117 Bacteria 1668
516 Ga0373943_0031464 3300035170 Bacteria 2518
517 Ga0373924_0062125 3300035410 Bacteria 1564
518 Ga0373931_0033207 3300035691 Bacteria 2673
519 Ga0373935_0224379 3300035692 Bacteria 1306
520 Ga0373927_0266747 3300035695 Bacteria 1126
521 Ga0373933_0332096 3300035724 Bacteria 986
522 Ga0373947_0028227 3300035725 Bacteria 3288
523 Ga0373937_0028691 3300036401 Bacteria 5037
524 Ga0373937_0075115 3300036401 Bacteria 3120
525 Ga0373937_0134894 3300036401 Bacteria 2307
526 Ga0395900_0572842 3300037418 Bacteria 1072
527 Ga0395900_0966104 3300037418 Bacteria 773
528 Ga0395898_0060715 3300037466 Bacteria 3673
529 Ga0395905_0000431 3300037471 Bacteria 58717
530 Ga0395905_0013446 3300037471 Bacteria 7843
531 Ga0395905_0016819 3300037471 Bacteria 6948
532 Ga0395905_0017199 3300037471 Bacteria 6868
533 Ga0395905_0022443 3300037471 Bacteria 5968
534 Ga0395905_0188665 3300037471 Bacteria 1934
535 Ga0395905_0235876 3300037471 Bacteria 1710
536 Ga0395905_0398234 3300037471 Bacteria 1271
537 Ga0436361_0537689 3300039447 Bacteria 1286
538 Ga0436361_0552361 3300039447 Bacteria 2748
539 Ga0439439_0055533 3300041406 Bacteria 1045
540 Ga0451789_0966433 3300041443 Bacteria 813
541 Ga0451791_0680598 3300041451 Bacteria 771
542 Ga0451793_0607649 3300041452 Bacteria 1389
543 Ga0451793_1038358 3300041452 Bacteria 761
544 Ga0451793_1656761 3300041452 Bacteria 854
545 Ga0451797_0679364 3300041453 Bacteria 1105
546 Ga0451807_1925146 3300041486 Bacteria 1082
547 Ga0451835_1076998 3300041492 Bacteria 791
548 Ga0451839_0531012 3300041496 Unclassified 772
549 Ga0451851_0230368 3300041507 Bacteria 734
550 Ga0451853_1613797 3300041512 Bacteria 1792
551 Ga0450911_003584 3300042115 Bacteria 2704
552 Ga0450919_000514 3300042121 Bacteria 4843
553 Ga0439459_0015933 3300042438 Bacteria 1383
554 Ga0450918_000377 3300042531 Bacteria 9735
555 Ga0450893_0009216 3300042532 Bacteria 1611
556 Ga0451577_0356691 3300042876 Bacteria 1326
557 Ga0451577_0403684 3300042876 Bacteria 1240
558 Ga0466969_0109207 3300044656 Bacteria 1296
559 Ga0466965_0243806 3300044683 Bacteria 962
560 Ga0466961_0112239 3300044693 Bacteria 1714
561 Ga0466964_0002777 3300044706 Bacteria 6290
562 Ga0453684_0703456 3300044712 Bacteria 1098
563 Ga0466971_0015449 3300044719 Bacteria 3360
564 Ga0466968_0314042 3300044735 Bacteria 756
565 Ga0466970_0087113 3300044765 Bacteria 1693
566 Ga0466959_0015984 3300045049 Bacteria 5477
567 Ga0451576_0114403 3300045051 Bacteria 2808
568 Ga0495592_0000028 3300046454 Bacteria 132590
569 Ga0495590_0007405 3300046457 Bacteria 4236
570 Ga0495629_0069203 3300046459 Bacteria 2463
571 Ga0495638_0054568 3300046460 Bacteria 2484
572 Ga0495638_0235906 3300046460 Bacteria 1015
573 Ga0495610_0053593 3300046512 Bacteria 1952
574 Ga0495610_0095059 3300046512 Bacteria 1344
575 Ga0495616_0090863 3300046513 Bacteria 1446
576 Ga0495618_0192528 3300046514 Bacteria 1293
577 Ga0495620_0059119 3300046515 Bacteria 1603
578 Ga0495628_0380886 3300046516 Bacteria 1033
579 Ga0495628_0528178 3300046516 Bacteria 849
580 Ga0495630_0047998 3300046517 Bacteria 3195
581 Ga0495632_0007745 3300046519 Bacteria 6701
582 Ga0495632_0055676 3300046519 Bacteria 1935
583 Ga0495632_0179215 3300046519 Bacteria 971
584 Ga0495666_0036781 3300046526 Bacteria 2384
585 Ga0495654_0022190 3300046530 Bacteria 3299
586 Ga0495621_0005578 3300046539 Bacteria 3627
587 Ga0495621_0054314 3300046539 Bacteria 1440
588 Ga0495621_0066745 3300046539 Bacteria 1317
589 Ga0495621_0157671 3300046539 Bacteria 896
590 Ga0495621_0198156 3300046539 Bacteria 807
591 Ga0495597_0108459 3300046542 Bacteria 1166
592 Ga0495645_0067784 3300046543 Bacteria 2577
593 Ga0495645_0156318 3300046543 Bacteria 1580
594 Ga0495645_0425101 3300046543 Bacteria 842
595 Ga0495622_0242412 3300046557 Bacteria 794
596 Ga0495625_0019171 3300046660 Bacteria 5316
597 Ga0495625_0022014 3300046660 Bacteria 4894
598 Ga0495625_0156033 3300046660 Bacteria 1532
599 Ga0495625_0453014 3300046660 Bacteria 792
600 Ga0495635_0563347 3300046663 Bacteria 746
601 Ga0495646_0084859 3300046680 Bacteria 1838
602 Ga0495647_0216216 3300046681 Bacteria 845
603 Ga0495658_0129338 3300046683 Bacteria 1535
604 Ga0495658_0145588 3300046683 Bacteria 1452
605 Ga0495613_0219569 3300046689 Bacteria 1335
606 Ga0495624_0053869 3300046690 Bacteria 2538
607 Ga0495671_0133351 3300046692 Bacteria 1211
608 Ga0495649_0004724 3300046694 Bacteria 8839
609 Ga0495660_0105785 3300046810 Bacteria 1442
610 Ga0495674_0278914 3300047319 Bacteria 1370
611 Ga0495687_000594 3300047443 Bacteria 42250
612 Ga0495687_005079 3300047443 Bacteria 8539
613 Ga0495687_006945 3300047443 Bacteria 6806
614 Ga0495684_0138480 3300047471 Bacteria 1826
615 Ga0495684_0339469 3300047471 Bacteria 1069
616 Ga0495686_0001297 3300047472 Bacteria 28173
617 Ga0495593_0029380 3300047673 Bacteria 3014
618 Ga0495626_0026314 3300048091 Bacteria 2837
619 Ga0496104_0272846 3300048907 Bacteria 1604
620 Ga0496105_0272040 3300048908 Bacteria 1368
621 Ga0496106_0351541 3300048909 Bacteria 1184
622 Ga0496108_0273204 3300048911 Bacteria 1471
623 Ga0496109_0128519 3300048912 Bacteria 2364
624 Ga0496110_0235992 3300048913 Bacteria 1664
625 Ga0496114_0013197 3300048917 Bacteria 6622
626 Ga0496121_0018535 3300048924 Bacteria 7012
627 Ga0496121_0026536 3300048924 Bacteria 5454
628 Ga0496124_0000317 3300048927 Bacteria 89188
629 Ga0496124_0136939 3300048927 Bacteria 1937
630 Ga0496124_0639209 3300048927 Bacteria 685
631 Ga0496125_0022403 3300048928 Bacteria 5867
632 Ga0496125_0060586 3300048928 Bacteria 3040
633 Ga0496125_0080252 3300048928 Bacteria 2497
634 Ga0496125_0145801 3300048928 Bacteria 1636
635 Ga0496125_0199471 3300048928 Bacteria 1312
636 Ga0495682_0079819 3300049460 Bacteria 1177
637 Ga0501292_010355 3300049515 Bacteria 1395
638 Ga0501043_0000004 3300049579 Bacteria 291085
639 Ga0501046_0000016 3300049580 Bacteria 234374
640 Ga0501047_0000012 3300049581 Bacteria 368824
641 Ga0501048_0035397 3300049582 Bacteria 3594
642 Ga0501252_007397 3300049682 Bacteria 1243
643 Ga0501035_0207821 3300049822 Bacteria 1676
644 Ga0501045_0192075 3300049824 Bacteria 1522
645 nmdc:mga03683_149396_c1 3300050489 Bacteria 1054
646 nmdc:mga03683_358208_c1 3300050489 Bacteria 691
647 nmdc:mga03683_9019_c1 3300050489 Bacteria 3529
648 nmdc:mga03n38_307349_c1 3300050490 Bacteria 853
649 nmdc:mga03n38_326475_c1 3300050490 Bacteria 830
650 nmdc:mga03n38_72335_c1 3300050490 Bacteria 1598
651 nmdc:mga00v17_256147_c1 3300050491 Bacteria 1135
652 nmdc:mga0yw44_47259_c1 3300050492 Bacteria 2589
653 nmdc:mga0k408_106001_c1 3300050493 Bacteria 1660
654 nmdc:mga0k408_14932_c1 3300050493 Bacteria 4289
655 nmdc:mga0k408_161057_c1 3300050493 Bacteria 1337
656 nmdc:mga0k408_24186_c1 3300050493 Bacteria 2706
657 nmdc:mga0k408_25980_c1 3300050493 Bacteria 3319
658 nmdc:mga0k408_34475_c1 3300050493 Bacteria 2898
659 nmdc:mga0k408_41741_c1 3300050493 Bacteria 2642
660 nmdc:mga0k408_570007_c1 3300050493 Bacteria 669
661 nmdc:mga0k408_66956_c1 3300050493 Bacteria 2093
662 nmdc:mga0k408_83039_c1 3300050493 Bacteria 1878
663 nmdc:mga0k408_8818_c1 3300050493 Bacteria 5428
664 nmdc:mga0k408_9344_c1 3300050493 Bacteria 5283
665 nmdc:mga06z11_110420_c1 3300050494 Bacteria 1522
666 nmdc:mga06z11_123658_c1 3300050494 Bacteria 1446
667 nmdc:mga06z11_248091_c1 3300050494 Bacteria 1048
668 nmdc:mga04h51_40466_c1 3300050495 Bacteria 1519
669 nmdc:mga04h51_70965_c1 3300050495 Bacteria 1216
670 nmdc:mga07m45_167580_c1 3300050496 Bacteria 1276
671 nmdc:mga07m45_192112_c1 3300050496 Bacteria 1187
672 nmdc:mga07m45_219578_c1 3300050496 Bacteria 1106
673 nmdc:mga07m45_2993_c2 3300050496 Bacteria 5533
674 nmdc:mga07m45_35470_c1 3300050496 Bacteria 2774
675 nmdc:mga07m45_408656_c1 3300050496 Bacteria 788
676 nmdc:mga07m45_436225_c1 3300050496 Bacteria 760
677 nmdc:mga07m45_68110_c1 3300050496 Bacteria 2024
678 nmdc:mga07m45_9585_c1 3300050496 Bacteria 5031
679 nmdc:mga0sz30_3098_c1 3300050516 Bacteria 5961
680 Ga0495601_0299709 3300053077 Bacteria 1047
681 Ga0495612_0257763 3300053078 Bacteria 777
682 Ga0495595_0089668 3300053084 Bacteria 1474
683 Ga0495619_0476371 3300053085 Bacteria 860
684 Ga0500578_0000282 3300053086 Bacteria 62821
685 Ga0500578_0035984 3300053086 Bacteria 3181
686 Ga0500644_0055142 3300053088 Bacteria 1379
687 Ga0500646_0001831 3300053090 Bacteria 5587
688 Ga0500647_0056143 3300053091 Bacteria 1894
689 Ga0500651_0013178 3300053093 Bacteria 5028
690 Ga0500651_0079698 3300053093 Bacteria 2029
691 Ga0500651_0389613 3300053093 Bacteria 784
692 Ga0500650_0065740 3300053098 Bacteria 1694
693 Ga0500650_0139505 3300053098 Bacteria 1124
694 Ga0500569_023259 3300053109 Bacteria 1663
695 Ga0500607_115033 3300053121 Bacteria 1312
696 Ga0500623_120745 3300053127 Bacteria 1149
697 Ga0500642_0000652 3300053130 Bacteria 10322
698 Ga0500652_000492 3300053131 Bacteria 13875
699 Ga0500658_0008541 3300053134 Bacteria 3783
700 Ga0500559_0017642 3300053136 Bacteria 3015
701 Ga0500559_0133526 3300053136 Bacteria 1160
702 Ga0500568_0028846 3300053139 Bacteria 2310
703 Ga0500568_0053545 3300053139 Bacteria 1581
704 Ga0500568_0072439 3300053139 Bacteria 1317
705 Ga0500590_020753 3300053148 Bacteria 3410
706 Ga0500604_0003349 3300053151 Bacteria 4309
707 Ga0500604_0116829 3300053151 Bacteria 889
708 Ga0500619_000180 3300053154 Bacteria 15135
709 Ga0500622_0000202 3300053156 Bacteria 63233
710 Ga0500622_0043686 3300053156 Bacteria 2324
711 Ga0500622_0081863 3300053156 Bacteria 1615
712 Ga0500634_0088639 3300053161 Bacteria 1576
713 Ga0500636_0077845 3300053177 Bacteria 1915
714 Ga0500645_002406 3300053730 Bacteria 8396
715 Ga0500587_000298 3300053739 Bacteria 5554
716 Ga0466962_0002769 3300061719 Bacteria 8328

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053085 Ga0495619_0476371 Ga0495619_0476371_284_844 182
2 3300037418 Ga0395900_0572842 Ga0395900_0572842_131_691 185
3 3300037418 Ga0395900_0966104 Ga0395900_0966104_35_595 185
4 3300037466 Ga0395898_0060715 Ga0395898_0060715_2163_2723 185
5 3300037471 Ga0395905_0000431 Ga0395905_0000431_52229_52789 185
6 3300037471 Ga0395905_0017199 Ga0395905_0017199_1852_2412 185
7 3300037471 Ga0395905_0022443 Ga0395905_0022443_2275_2835 185
8 3300037471 Ga0395905_0188665 Ga0395905_0188665_1307_1867 185
9 3300037471 Ga0395905_0235876 Ga0395905_0235876_838_1398 185
10 3300037471 Ga0395905_0398234 Ga0395905_0398234_265_825 185
11 3300044656 Ga0466969_0109207 Ga0466969_0109207_211_771 185
12 3300044693 Ga0466961_0112239 Ga0466961_0112239_83_643 185
13 3300044765 Ga0466970_0087113 Ga0466970_0087113_897_1457 185
14 3300045049 Ga0466959_0015984 Ga0466959_0015984_2435_2995 185
15 3300044683 Ga0466965_0243806 Ga0466965_0243806_380_946 186
16 3300044735 Ga0466968_0314042 Ga0466968_0314042_60_626 186
17 3300031730 Ga0307516_10005605 Ga0307516_100056058 188
18 3300028786 Ga0307517_10001871 Ga0307517_100018717 189
19 3300047472 Ga0495686_0001297 Ga0495686_0001297_24191_24814 189
20 3300028794 Ga0307515_10038740 Ga0307515_100387407 190
21 3300031456 Ga0307513_10119691 Ga0307513_101196914 190
22 3300036401 Ga0373937_0075115 Ga0373937_0075115_1135_1776 190
23 3300049822 Ga0501035_0207821 Ga0501035_0207821_548_1177 190
24 3300005327 Ga0070658_10839318 Ga0070658_108393181 193
25 3300005354 Ga0070675_101052871 Ga0070675_1010528711 193
26 3300005355 Ga0070671_100398329 Ga0070671_1003983292 193
27 3300005364 Ga0070673_101090464 Ga0070673_1010904641 193
28 3300013296 Ga0157374_10561120 Ga0157374_105611203 193
29 3300025899 Ga0207642_10157072 Ga0207642_101570722 193
30 3300025909 Ga0207705_10262264 Ga0207705_102622642 193
31 3300037471 Ga0395905_0013446 Ga0395905_0013446_1334_1975 193
32 3300050489 nmdc:mga03683_358208_c1 nmdc:mga03683_358208_c1_19_660 193
33 3300042876 Ga0451577_0403684 Ga0451577_0403684_122_736 194
34 3300045051 Ga0451576_0114403 Ga0451576_0114403_725_1339 194
35 3300005262 Ga0065165_1003311 Ga0065165_10033117 195
36 3300005455 Ga0070663_100275335 Ga0070663_1002753352 195
37 3300005543 Ga0070672_100048996 Ga0070672_1000489964 195
38 3300005578 Ga0068854_100030430 Ga0068854_1000304305 195
39 3300005843 Ga0068860_100373451 Ga0068860_1003734513 195
40 3300025273 Ga0209673_1002275 Ga0209673_100227515 195
41 3300025321 Ga0207656_10193028 Ga0207656_101930282 195
42 3300025926 Ga0207659_10160710 Ga0207659_101607102 195
43 3300025933 Ga0207706_10242717 Ga0207706_102427173 195
44 3300025940 Ga0207691_10021169 Ga0207691_100211692 195
45 3300026067 Ga0207678_10010696 Ga0207678_100106968 195
46 3300026095 Ga0207676_10508889 Ga0207676_105088891 195
47 3300026121 Ga0207683_10118931 Ga0207683_101189314 195
48 3300031456 Ga0307513_10617064 Ga0307513_106170641 195
49 3300003323 rootH1_10029292 rootH1_100292922 196
50 3300031649 Ga0307514_10077945 Ga0307514_100779451 197
51 3300005331 Ga0070670_100101058 Ga0070670_1001010582 199
52 3300009148 Ga0105243_10232044 Ga0105243_102320441 199
53 3300025925 Ga0207650_10075499 Ga0207650_100754993 199
54 3300027876 Ga0209974_10132095 Ga0209974_101320952 199
55 3300031731 Ga0307405_10006547 Ga0307405_100065473 199
56 3300031824 Ga0307413_10094755 Ga0307413_100947552 199
57 3300031852 Ga0307410_10009817 Ga0307410_100098175 199
58 3300031901 Ga0307406_10034996 Ga0307406_100349962 199
59 3300031903 Ga0307407_10101551 Ga0307407_101015513 199
60 3300031911 Ga0307412_10018914 Ga0307412_100189144 199
61 3300031995 Ga0307409_100094217 Ga0307409_1000942173 199
62 3300032002 Ga0307416_100088088 Ga0307416_1000880883 199
63 3300041406 Ga0439439_0055533 Ga0439439_0055533_65_667 199
64 3300050490 nmdc:mga03n38_307349_c1 nmdc:mga03n38_307349_c1_120_722 199
65 3300053098 Ga0500650_0065740 Ga0500650_0065740_140_766 199
66 3300006038 Ga0075365_10106212 Ga0075365_101062122 200
67 3300006048 Ga0075363_100197021 Ga0075363_1001970212 200
68 3300006177 Ga0075362_10058661 Ga0075362_100586613 200
69 3300006177 Ga0075362_10127865 Ga0075362_101278652 200
70 3300042532 Ga0450893_0009216 Ga0450893_0009216_494_1102 200
71 3300050490 nmdc:mga03n38_326475_c1 nmdc:mga03n38_326475_c1_193_798 200
72 3300050496 nmdc:mga07m45_192112_c1 nmdc:mga07m45_192112_c1_130_735 200
73 3300031507 Ga0307509_10214130 Ga0307509_102141303 201
74 3300041452 Ga0451793_1038358 Ga0451793_1038358_84_722 201
75 3300025297 Ga0209758_1000045 Ga0209758_1000045233 202
76 3300053161 Ga0500634_0088639 Ga0500634_0088639_906_1523 202
77 3300003322 rootL2_10175725 rootL2_101757252 203
78 3300005356 Ga0070674_100236318 Ga0070674_1002363183 203
79 3300005456 Ga0070678_100938836 Ga0070678_1009388361 203
80 3300005543 Ga0070672_100140374 Ga0070672_1001403742 203
81 3300005564 Ga0070664_100706313 Ga0070664_1007063132 203
82 3300009176 Ga0105242_10014443 Ga0105242_100144432 203
83 3300025934 Ga0207686_10025578 Ga0207686_100255785 203
84 3300025937 Ga0207669_10074985 Ga0207669_100749853 203
85 3300025940 Ga0207691_10085262 Ga0207691_100852624 203
86 3300025945 Ga0207679_10084416 Ga0207679_100844163 203
87 3300026121 Ga0207683_10048071 Ga0207683_100480715 203
88 iso_pu_bacteria 2643221654 2644304273 203
89 3300006178 Ga0075367_10022479 Ga0075367_100224794 204
90 3300006353 Ga0075370_10032948 Ga0075370_100329482 204
91 3300050495 nmdc:mga04h51_40466_c1 nmdc:mga04h51_40466_c1_463_1131 204
92 iso_pu_bacteria 2643221644 2644245713 204
93 iso_pu_bacteria 2643221660 2644338342 204
94 3300006048 Ga0075363_100072670 Ga0075363_1000726703 205
95 3300006178 Ga0075367_10294385 Ga0075367_102943852 205
96 3300028794 Ga0307515_10000991 Ga0307515_1000099154 205
97 3300031456 Ga0307513_10471060 Ga0307513_104710602 205
98 3300031730 Ga0307516_10004946 Ga0307516_100049469 205
99 3300041451 Ga0451791_0680598 Ga0451791_0680598_79_699 205
100 3300041452 Ga0451793_1656761 Ga0451793_1656761_76_696 205
101 3300041453 Ga0451797_0679364 Ga0451797_0679364_114_734 205
102 3300041486 Ga0451807_1925146 Ga0451807_1925146_283_903 205
103 3300041496 Ga0451839_0531012 Ga0451839_0531012_100_720 205
104 3300041512 Ga0451853_1613797 Ga0451853_1613797_803_1423 205
105 3300046512 Ga0495610_0095059 Ga0495610_0095059_709_1329 205
106 3300046513 Ga0495616_0090863 Ga0495616_0090863_637_1254 205
107 3300046519 Ga0495632_0055676 Ga0495632_0055676_640_1260 205
108 3300046539 Ga0495621_0005578 Ga0495621_0005578_1049_1681 205
109 3300046660 Ga0495625_0022014 Ga0495625_0022014_3278_3898 205
110 3300048927 Ga0496124_0000317 Ga0496124_0000317_22069_22686 205
111 3300048928 Ga0496125_0022403 Ga0496125_0022403_657_1274 205
112 3300050493 nmdc:mga0k408_34475_c1 nmdc:mga0k408_34475_c1_1934_2554 205
113 3300050493 nmdc:mga0k408_570007_c1 nmdc:mga0k408_570007_c1_20_640 205
114 3300053739 Ga0500587_000298 Ga0500587_000298_585_1205 205
115 iso_pu_bacteria 2585428057 2587730558 205
116 iso_pu_bacteria 2585428058 2587734918 205
117 iso_pu_bacteria 2588253510 2588293137 205
118 iso_pu_bacteria 2643221592 2643968359 205
119 iso_pu_bacteria 2643221625 2644141849 205
120 iso_pu_bacteria 2643221648 2644272482 205
121 3300005328 Ga0070676_10026643 Ga0070676_100266434 206
122 3300005353 Ga0070669_100261286 Ga0070669_1002612862 206
123 3300005364 Ga0070673_100305514 Ga0070673_1003055141 206
124 3300005367 Ga0070667_100106214 Ga0070667_1001062142 206
125 3300005455 Ga0070663_100029789 Ga0070663_1000297893 206
126 3300005543 Ga0070672_100388970 Ga0070672_1003889701 206
127 3300005577 Ga0068857_100012825 Ga0068857_1000128258 206
128 3300005578 Ga0068854_100018059 Ga0068854_1000180597 206
129 3300005616 Ga0068852_100164833 Ga0068852_1001648332 206
130 3300006048 Ga0075363_100044589 Ga0075363_1000445894 206
131 3300006051 Ga0075364_10050756 Ga0075364_100507562 206
132 3300006178 Ga0075367_10029363 Ga0075367_100293634 206
133 3300006353 Ga0075370_10007921 Ga0075370_100079217 206
134 3300006353 Ga0075370_10204779 Ga0075370_102047791 206
135 3300009545 Ga0105237_10008395 Ga0105237_100083953 206
136 3300010375 Ga0105239_10060249 Ga0105239_100602494 206
137 3300025903 Ga0207680_10394355 Ga0207680_103943552 206
138 3300025940 Ga0207691_10172455 Ga0207691_101724552 206
139 3300025942 Ga0207689_10055774 Ga0207689_100557744 206
140 3300025986 Ga0207658_10059730 Ga0207658_100597304 206
141 3300026067 Ga0207678_10041360 Ga0207678_100413603 206
142 3300026116 Ga0207674_10022905 Ga0207674_100229054 206
143 3300031730 Ga0307516_10000312 Ga0307516_100003123 206
144 3300046530 Ga0495654_0022190 Ga0495654_0022190_2148_2780 206
145 3300047443 Ga0495687_000594 Ga0495687_000594_1989_2609 206
146 3300048091 Ga0495626_0026314 Ga0495626_0026314_1394_2014 206
147 3300050489 nmdc:mga03683_149396_c1 nmdc:mga03683_149396_c1_29_649 206
148 3300050491 nmdc:mga00v17_256147_c1 nmdc:mga00v17_256147_c1_22_642 206
149 3300050493 nmdc:mga0k408_41741_c1 nmdc:mga0k408_41741_c1_808_1428 206
150 3300050496 nmdc:mga07m45_68110_c1 nmdc:mga07m45_68110_c1_406_1026 206
151 3300009174 Ga0105241_10953023 Ga0105241_109530231 207
152 3300009545 Ga0105237_10003466 Ga0105237_1000346619 207
153 3300009551 Ga0105238_10007665 Ga0105238_100076655 207
154 3300010375 Ga0105239_10003789 Ga0105239_100037899 207
155 3300025911 Ga0207654_10039557 Ga0207654_100395574 207
156 3300025913 Ga0207695_10031173 Ga0207695_100311735 207
157 3300025914 Ga0207671_10005697 Ga0207671_1000569712 207
158 3300025924 Ga0207694_10024013 Ga0207694_100240134 207
159 3300028381 Ga0268264_10092858 Ga0268264_100928583 207
160 3300028794 Ga0307515_10001283 Ga0307515_1000128321 207
161 3300031456 Ga0307513_10034868 Ga0307513_100348686 207
162 3300031649 Ga0307514_10001840 Ga0307514_100018406 207
163 3300048924 Ga0496121_0026536 Ga0496121_0026536_2226_2849 207
164 3300048927 Ga0496124_0639209 Ga0496124_0639209_21_644 207
165 3300048928 Ga0496125_0199471 Ga0496125_0199471_539_1192 207
166 3300053086 Ga0500578_0035984 Ga0500578_0035984_445_1077 207
167 3300053730 Ga0500645_002406 Ga0500645_002406_6717_7349 207
168 3300003791 Ga0055530_10013387 Ga0055530_100133873 208
169 3300003792 Ga0055540_1000002 Ga0055540_1000002249 208
170 3300003794 Ga0055531_10004641 Ga0055531_100046415 208
171 3300005328 Ga0070676_10014725 Ga0070676_100147255 208
172 3300005334 Ga0068869_100013561 Ga0068869_1000135616 208
173 3300005338 Ga0068868_100097025 Ga0068868_1000970253 208
174 3300005344 Ga0070661_100290663 Ga0070661_1002906631 208
175 3300005354 Ga0070675_100005184 Ga0070675_1000051848 208
176 3300005355 Ga0070671_100081753 Ga0070671_1000817533 208
177 3300005364 Ga0070673_100261577 Ga0070673_1002615773 208
178 3300005367 Ga0070667_100089205 Ga0070667_1000892053 208
179 3300005367 Ga0070667_100990802 Ga0070667_1009908021 208
180 3300005457 Ga0070662_100032584 Ga0070662_1000325842 208
181 3300005459 Ga0068867_100002841 Ga0068867_10000284115 208
182 3300005459 Ga0068867_100146767 Ga0068867_1001467673 208
183 3300005543 Ga0070672_100010713 Ga0070672_1000107134 208
184 3300005577 Ga0068857_100025437 Ga0068857_1000254373 208
185 3300005614 Ga0068856_100059001 Ga0068856_1000590015 208
186 3300005834 Ga0068851_10397291 Ga0068851_103972912 208
187 3300005840 Ga0068870_10042666 Ga0068870_100426663 208
188 3300005841 Ga0068863_100292604 Ga0068863_1002926043 208
189 3300006042 Ga0075368_10064592 Ga0075368_100645922 208
190 3300006177 Ga0075362_10305949 Ga0075362_103059492 208
191 3300006195 Ga0075366_10042422 Ga0075366_100424223 208
192 3300006237 Ga0097621_100439860 Ga0097621_1004398602 208
193 3300006353 Ga0075370_10038650 Ga0075370_100386503 208
194 3300006353 Ga0075370_10125572 Ga0075370_101255722 208
195 3300006946 Ga0079104_1000017 Ga0079104_1000017204 208
196 3300009098 Ga0105245_10256066 Ga0105245_102560662 208
197 3300009148 Ga0105243_10187471 Ga0105243_101874713 208
198 3300009545 Ga0105237_10157249 Ga0105237_101572492 208
199 3300013105 Ga0157369_10660417 Ga0157369_106604172 208
200 3300013297 Ga0157378_10078498 Ga0157378_100784982 208
201 3300014325 Ga0163163_10510020 Ga0163163_105100202 208
202 3300014745 Ga0157377_10068176 Ga0157377_100681762 208
203 3300014969 Ga0157376_10361085 Ga0157376_103610853 208
204 3300025273 Ga0209673_1051328 Ga0209673_10513282 208
205 3300025291 Ga0209675_1006935 Ga0209675_10069353 208
206 3300025298 Ga0209050_1000457 Ga0209050_100045779 208
207 3300025298 Ga0209050_1022563 Ga0209050_10225633 208
208 3300025299 Ga0209256_1000011 Ga0209256_1000011639 208
209 3300025303 Ga0209051_1000024 Ga0209051_1000024250 208
210 3300025304 Ga0209257_1000079 Ga0209257_1000079250 208
211 3300025907 Ga0207645_10012119 Ga0207645_100121195 208
212 3300025908 Ga0207643_10057915 Ga0207643_100579153 208
213 3300025919 Ga0207657_10034678 Ga0207657_100346783 208
214 3300025926 Ga0207659_10006295 Ga0207659_100062958 208
215 3300025927 Ga0207687_10053973 Ga0207687_100539733 208
216 3300025931 Ga0207644_10042428 Ga0207644_100424284 208
217 3300025933 Ga0207706_10113749 Ga0207706_101137492 208
218 3300025940 Ga0207691_10007915 Ga0207691_100079157 208
219 3300025960 Ga0207651_10006687 Ga0207651_100066873 208
220 3300025981 Ga0207640_10714845 Ga0207640_107148452 208
221 3300026023 Ga0207677_10219121 Ga0207677_102191213 208
222 3300026078 Ga0207702_10241988 Ga0207702_102419883 208
223 3300026089 Ga0207648_10010781 Ga0207648_100107818 208
224 3300026089 Ga0207648_10052175 Ga0207648_100521754 208
225 3300026116 Ga0207674_10008218 Ga0207674_100082186 208
226 3300026142 Ga0207698_10280502 Ga0207698_102805021 208
227 3300027111 Ga0209281_1000042 Ga0209281_1000042145 208
228 3300027866 Ga0209813_10064684 Ga0209813_100646842 208
229 3300028786 Ga0307517_10080650 Ga0307517_100806502 208
230 3300028794 Ga0307515_10064124 Ga0307515_100641243 208
231 3300028794 Ga0307515_10252323 Ga0307515_102523232 208
232 3300030522 Ga0307512_10113458 Ga0307512_101134583 208
233 3300031456 Ga0307513_10116867 Ga0307513_101168673 208
234 3300031507 Ga0307509_10000041 Ga0307509_10000041157 208
235 3300031507 Ga0307509_10025279 Ga0307509_100252795 208
236 3300031507 Ga0307509_10030443 Ga0307509_100304436 208
237 3300031507 Ga0307509_10064009 Ga0307509_100640094 208
238 3300031507 Ga0307509_10139159 Ga0307509_101391592 208
239 3300031616 Ga0307508_10000227 Ga0307508_1000022724 208
240 3300031616 Ga0307508_10038562 Ga0307508_100385623 208
241 3300031649 Ga0307514_10100606 Ga0307514_101006063 208
242 3300031730 Ga0307516_10350336 Ga0307516_103503362 208
243 3300033179 Ga0307507_10040065 Ga0307507_100400653 208
244 3300033180 Ga0307510_10020701 Ga0307510_100207018 208
245 3300033180 Ga0307510_10026627 Ga0307510_100266275 208
246 3300033180 Ga0307510_10100095 Ga0307510_101000953 208
247 3300033180 Ga0307510_10105002 Ga0307510_101050023 208
248 3300035691 Ga0373931_0033207 Ga0373931_0033207_480_1106 208
249 3300042121 Ga0450919_000514 Ga0450919_000514_3738_4367 208
250 3300042531 Ga0450918_000377 Ga0450918_000377_8411_9040 208
251 3300046454 Ga0495592_0000028 Ga0495592_0000028_56282_56908 208
252 3300046460 Ga0495638_0235906 Ga0495638_0235906_141_767 208
253 3300046512 Ga0495610_0053593 Ga0495610_0053593_439_1065 208
254 3300046514 Ga0495618_0192528 Ga0495618_0192528_131_757 208
255 3300046515 Ga0495620_0059119 Ga0495620_0059119_190_816 208
256 3300046516 Ga0495628_0380886 Ga0495628_0380886_272_898 208
257 3300046517 Ga0495630_0047998 Ga0495630_0047998_2101_2727 208
258 3300046519 Ga0495632_0179215 Ga0495632_0179215_276_902 208
259 3300046526 Ga0495666_0036781 Ga0495666_0036781_1029_1655 208
260 3300046557 Ga0495622_0242412 Ga0495622_0242412_71_697 208
261 3300046660 Ga0495625_0156033 Ga0495625_0156033_538_1164 208
262 3300046680 Ga0495646_0084859 Ga0495646_0084859_838_1464 208
263 3300046690 Ga0495624_0053869 Ga0495624_0053869_636_1262 208
264 3300046692 Ga0495671_0133351 Ga0495671_0133351_228_878 208
265 3300047673 Ga0495593_0029380 Ga0495593_0029380_843_1469 208
266 3300048917 Ga0496114_0013197 Ga0496114_0013197_5058_5687 208
267 3300049682 Ga0501252_007397 Ga0501252_007397_323_952 208
268 3300050493 nmdc:mga0k408_106001_c1 nmdc:mga0k408_106001_c1_761_1387 208
269 3300050493 nmdc:mga0k408_161057_c1 nmdc:mga0k408_161057_c1_375_1001 208
270 3300050493 nmdc:mga0k408_25980_c1 nmdc:mga0k408_25980_c1_2562_3188 208
271 3300050496 nmdc:mga07m45_219578_c1 nmdc:mga07m45_219578_c1_383_1009 208
272 3300050496 nmdc:mga07m45_408656_c1 nmdc:mga07m45_408656_c1_50_676 208
273 3300050496 nmdc:mga07m45_436225_c1 nmdc:mga07m45_436225_c1_116_742 208
274 3300053088 Ga0500644_0055142 Ga0500644_0055142_400_1026 208
275 3300053091 Ga0500647_0056143 Ga0500647_0056143_485_1111 208
276 3300053093 Ga0500651_0079698 Ga0500651_0079698_899_1525 208
277 3300053093 Ga0500651_0389613 Ga0500651_0389613_16_642 208
278 3300053121 Ga0500607_115033 Ga0500607_115033_167_793 208
279 3300053136 Ga0500559_0017642 Ga0500559_0017642_1255_1881 208
280 3300053139 Ga0500568_0072439 Ga0500568_0072439_266_892 208
281 3300053148 Ga0500590_020753 Ga0500590_020753_1340_1966 208
282 3300053156 Ga0500622_0043686 Ga0500622_0043686_441_1067 208
283 3300053177 Ga0500636_0077845 Ga0500636_0077845_72_698 208
284 3300003323 rootH1_10012451 rootH1_100124513 209
285 3300003791 Ga0055530_10011329 Ga0055530_100113294 209
286 3300005328 Ga0070676_10009865 Ga0070676_100098654 209
287 3300005329 Ga0070683_100186750 Ga0070683_1001867502 209
288 3300005330 Ga0070690_100123156 Ga0070690_1001231563 209
289 3300005331 Ga0070670_100001820 Ga0070670_1000018205 209
290 3300005331 Ga0070670_100415891 Ga0070670_1004158912 209
291 3300005333 Ga0070677_10009375 Ga0070677_100093754 209
292 3300005333 Ga0070677_10027675 Ga0070677_100276753 209
293 3300005334 Ga0068869_100004621 Ga0068869_1000046218 209
294 3300005335 Ga0070666_10041643 Ga0070666_100416433 209
295 3300005338 Ga0068868_100146793 Ga0068868_1001467933 209
296 3300005338 Ga0068868_100334934 Ga0068868_1003349343 209
297 3300005340 Ga0070689_100175586 Ga0070689_1001755863 209
298 3300005340 Ga0070689_100896337 Ga0070689_1008963371 209
299 3300005343 Ga0070687_100014736 Ga0070687_1000147364 209
300 3300005347 Ga0070668_100009291 Ga0070668_1000092915 209
301 3300005353 Ga0070669_100066477 Ga0070669_1000664773 209
302 3300005354 Ga0070675_100028715 Ga0070675_1000287155 209
303 3300005355 Ga0070671_100357690 Ga0070671_1003576903 209
304 3300005355 Ga0070671_100674958 Ga0070671_1006749581 209
305 3300005356 Ga0070674_100069521 Ga0070674_1000695213 209
306 3300005356 Ga0070674_100263727 Ga0070674_1002637272 209
307 3300005364 Ga0070673_100413928 Ga0070673_1004139281 209
308 3300005364 Ga0070673_100762403 Ga0070673_1007624032 209
309 3300005367 Ga0070667_100003010 Ga0070667_1000030105 209
310 3300005367 Ga0070667_100432808 Ga0070667_1004328081 209
311 3300005456 Ga0070678_100477514 Ga0070678_1004775141 209
312 3300005456 Ga0070678_100621406 Ga0070678_1006214062 209
313 3300005456 Ga0070678_100711885 Ga0070678_1007118851 209
314 3300005457 Ga0070662_100010471 Ga0070662_1000104715 209
315 3300005457 Ga0070662_100813706 Ga0070662_1008137061 209
316 3300005459 Ga0068867_100052489 Ga0068867_1000524894 209
317 3300005459 Ga0068867_100105376 Ga0068867_1001053764 209
318 3300005530 Ga0070679_100194436 Ga0070679_1001944363 209
319 3300005543 Ga0070672_100003281 Ga0070672_1000032812 209
320 3300005543 Ga0070672_100282596 Ga0070672_1002825962 209
321 3300005547 Ga0070693_100079779 Ga0070693_1000797793 209
322 3300005548 Ga0070665_100191214 Ga0070665_1001912143 209
323 3300005564 Ga0070664_100104728 Ga0070664_1001047282 209
324 3300005616 Ga0068852_100070012 Ga0068852_1000700122 209
325 3300005616 Ga0068852_101136915 Ga0068852_1011369152 209
326 3300005617 Ga0068859_100012962 Ga0068859_1000129628 209
327 3300005617 Ga0068859_100078982 Ga0068859_1000789824 209
328 3300005618 Ga0068864_100110843 Ga0068864_1001108433 209
329 3300005618 Ga0068864_100201786 Ga0068864_1002017862 209
330 3300005718 Ga0068866_10007367 Ga0068866_100073674 209
331 3300005719 Ga0068861_100040775 Ga0068861_1000407754 209
332 3300005840 Ga0068870_10041700 Ga0068870_100417003 209
333 3300005841 Ga0068863_100004608 Ga0068863_10000460812 209
334 3300005841 Ga0068863_100131899 Ga0068863_1001318993 209
335 3300005841 Ga0068863_100486275 Ga0068863_1004862752 209
336 3300005842 Ga0068858_100001760 Ga0068858_1000017603 209
337 3300005842 Ga0068858_100104820 Ga0068858_1001048202 209
338 3300005843 Ga0068860_100001433 Ga0068860_1000014335 209
339 3300005844 Ga0068862_100036314 Ga0068862_1000363143 209
340 3300006028 Ga0070717_10873321 Ga0070717_108733212 209
341 3300006048 Ga0075363_100084357 Ga0075363_1000843572 209
342 3300006195 Ga0075366_10023472 Ga0075366_100234722 209
343 3300006237 Ga0097621_100894581 Ga0097621_1008945812 209
344 3300006353 Ga0075370_10011666 Ga0075370_100116664 209
345 3300006358 Ga0068871_100195663 Ga0068871_1001956633 209
346 3300006881 Ga0068865_100010127 Ga0068865_1000101277 209
347 3300006931 Ga0097620_100012962 Ga0097620_1000129628 209
348 3300006931 Ga0097620_100078978 Ga0097620_1000789784 209
349 3300009098 Ga0105245_10048773 Ga0105245_100487735 209
350 3300009148 Ga0105243_10049442 Ga0105243_100494422 209
351 3300009176 Ga0105242_10204457 Ga0105242_102044571 209
352 3300009177 Ga0105248_10180017 Ga0105248_101800172 209
353 3300009553 Ga0105249_10009522 Ga0105249_100095228 209
354 3300013102 Ga0157371_10031263 Ga0157371_100312633 209
355 3300013297 Ga0157378_10044989 Ga0157378_100449895 209
356 3300013297 Ga0157378_10271274 Ga0157378_102712742 209
357 3300013306 Ga0163162_10060587 Ga0163162_100605875 209
358 3300013306 Ga0163162_10166173 Ga0163162_101661733 209
359 3300013306 Ga0163162_10194073 Ga0163162_101940733 209
360 3300013308 Ga0157375_10003544 Ga0157375_1000354412 209
361 3300013308 Ga0157375_10031329 Ga0157375_100313295 209
362 3300014325 Ga0163163_10179958 Ga0163163_101799583 209
363 3300014326 Ga0157380_10318490 Ga0157380_103184902 209
364 3300014968 Ga0157379_10031728 Ga0157379_100317285 209
365 3300017792 Ga0163161_10031938 Ga0163161_100319382 209
366 3300021361 Ga0213872_10042754 Ga0213872_100427542 209
367 3300025298 Ga0209050_1000247 Ga0209050_100024786 209
368 3300025303 Ga0209051_1002674 Ga0209051_10026747 209
369 3300025303 Ga0209051_1018049 Ga0209051_10180492 209
370 3300025315 Ga0207697_10017238 Ga0207697_100172384 209
371 3300025893 Ga0207682_10033070 Ga0207682_100330703 209
372 3300025893 Ga0207682_10049175 Ga0207682_100491752 209
373 3300025899 Ga0207642_10030161 Ga0207642_100301614 209
374 3300025903 Ga0207680_10110209 Ga0207680_101102093 209
375 3300025907 Ga0207645_10003743 Ga0207645_1000374310 209
376 3300025908 Ga0207643_10068631 Ga0207643_100686313 209
377 3300025918 Ga0207662_10005052 Ga0207662_100050523 209
378 3300025920 Ga0207649_10183643 Ga0207649_101836432 209
379 3300025923 Ga0207681_10037586 Ga0207681_100375864 209
380 3300025925 Ga0207650_10009009 Ga0207650_100090095 209
381 3300025925 Ga0207650_10332674 Ga0207650_103326742 209
382 3300025926 Ga0207659_10041441 Ga0207659_100414414 209
383 3300025926 Ga0207659_10253830 Ga0207659_102538302 209
384 3300025933 Ga0207706_10031191 Ga0207706_100311915 209
385 3300025935 Ga0207709_10021922 Ga0207709_100219223 209
386 3300025935 Ga0207709_10394828 Ga0207709_103948283 209
387 3300025936 Ga0207670_10188582 Ga0207670_101885822 209
388 3300025937 Ga0207669_10066497 Ga0207669_100664973 209
389 3300025937 Ga0207669_10115988 Ga0207669_101159883 209
390 3300025937 Ga0207669_10132696 Ga0207669_101326961 209
391 3300025938 Ga0207704_10008558 Ga0207704_100085583 209
392 3300025940 Ga0207691_10038362 Ga0207691_100383622 209
393 3300025940 Ga0207691_10082658 Ga0207691_100826582 209
394 3300025940 Ga0207691_10531419 Ga0207691_105314192 209
395 3300025940 Ga0207691_10821458 Ga0207691_108214581 209
396 3300025941 Ga0207711_10077302 Ga0207711_100773023 209
397 3300025941 Ga0207711_10297657 Ga0207711_102976572 209
398 3300025942 Ga0207689_10011178 Ga0207689_100111785 209
399 3300025944 Ga0207661_10130483 Ga0207661_101304833 209
400 3300025945 Ga0207679_10171165 Ga0207679_101711652 209
401 3300025961 Ga0207712_10005181 Ga0207712_100051813 209
402 3300025972 Ga0207668_10092840 Ga0207668_100928403 209
403 3300025986 Ga0207658_10009082 Ga0207658_100090825 209
404 3300026023 Ga0207677_10133104 Ga0207677_101331043 209
405 3300026035 Ga0207703_10001350 Ga0207703_100013505 209
406 3300026088 Ga0207641_10009363 Ga0207641_100093635 209
407 3300026088 Ga0207641_10069885 Ga0207641_100698852 209
408 3300026088 Ga0207641_10323964 Ga0207641_103239642 209
409 3300026089 Ga0207648_10033465 Ga0207648_100334655 209
410 3300026089 Ga0207648_10054667 Ga0207648_100546671 209
411 3300026118 Ga0207675_100075512 Ga0207675_1000755123 209
412 3300026121 Ga0207683_10011765 Ga0207683_100117659 209
413 3300026142 Ga0207698_10036460 Ga0207698_100364604 209
414 3300026142 Ga0207698_11003022 Ga0207698_110030222 209
415 3300028379 Ga0268266_10490045 Ga0268266_104900453 209
416 3300028380 Ga0268265_10058350 Ga0268265_100583503 209
417 3300028381 Ga0268264_10004852 Ga0268264_100048528 209
418 3300028381 Ga0268264_10258278 Ga0268264_102582783 209
419 3300028786 Ga0307517_10091945 Ga0307517_100919453 209
420 3300028786 Ga0307517_10229954 Ga0307517_102299542 209
421 3300031730 Ga0307516_10000497 Ga0307516_1000049732 209
422 3300032002 Ga0307416_100158615 Ga0307416_1001586153 209
423 3300035117 Ga0373953_0051288 Ga0373953_0051288_802_1443 209
424 3300035410 Ga0373924_0062125 Ga0373924_0062125_381_1022 209
425 3300035692 Ga0373935_0224379 Ga0373935_0224379_54_695 209
426 3300035695 Ga0373927_0266747 Ga0373927_0266747_414_1055 209
427 3300035724 Ga0373933_0332096 Ga0373933_0332096_204_845 209
428 3300036401 Ga0373937_0134894 Ga0373937_0134894_1548_2189 209
429 3300037471 Ga0395905_0016819 Ga0395905_0016819_3176_3805 209
430 3300039447 Ga0436361_0537689 Ga0436361_0537689_117_773 209
431 3300039447 Ga0436361_0552361 Ga0436361_0552361_1578_2234 209
432 3300041443 Ga0451789_0966433 Ga0451789_0966433_100_729 209
433 3300041452 Ga0451793_0607649 Ga0451793_0607649_311_940 209
434 3300044706 Ga0466964_0002777 Ga0466964_0002777_878_1546 209
435 3300044719 Ga0466971_0015449 Ga0466971_0015449_2127_2795 209
436 3300046460 Ga0495638_0054568 Ga0495638_0054568_477_1106 209
437 3300046539 Ga0495621_0157671 Ga0495621_0157671_112_753 209
438 3300046539 Ga0495621_0198156 Ga0495621_0198156_114_746 209
439 3300046542 Ga0495597_0108459 Ga0495597_0108459_483_1112 209
440 3300046543 Ga0495645_0067784 Ga0495645_0067784_158_799 209
441 3300046660 Ga0495625_0453014 Ga0495625_0453014_84_713 209
442 3300046663 Ga0495635_0563347 Ga0495635_0563347_62_703 209
443 3300046683 Ga0495658_0129338 Ga0495658_0129338_633_1274 209
444 3300047319 Ga0495674_0278914 Ga0495674_0278914_111_752 209
445 3300047471 Ga0495684_0339469 Ga0495684_0339469_292_933 209
446 3300049515 Ga0501292_010355 Ga0501292_010355_89_718 209
447 3300050490 nmdc:mga03n38_72335_c1 nmdc:mga03n38_72335_c1_625_1254 209
448 3300050493 nmdc:mga0k408_66956_c1 nmdc:mga0k408_66956_c1_81_710 209
449 3300050496 nmdc:mga07m45_9585_c1 nmdc:mga07m45_9585_c1_3013_3642 209
450 3300053078 Ga0495612_0257763 Ga0495612_0257763_29_667 209
451 3300053086 Ga0500578_0000282 Ga0500578_0000282_55905_56534 209
452 3300053090 Ga0500646_0001831 Ga0500646_0001831_504_1133 209
453 3300053093 Ga0500651_0013178 Ga0500651_0013178_1044_1673 209
454 3300053098 Ga0500650_0139505 Ga0500650_0139505_479_1108 209
455 3300053109 Ga0500569_023259 Ga0500569_023259_804_1433 209
456 3300053127 Ga0500623_120745 Ga0500623_120745_53_682 209
457 3300053130 Ga0500642_0000652 Ga0500642_0000652_256_885 209
458 3300053131 Ga0500652_000492 Ga0500652_000492_9448_10077 209
459 3300053136 Ga0500559_0133526 Ga0500559_0133526_268_897 209
460 3300053139 Ga0500568_0053545 Ga0500568_0053545_73_702 209
461 3300053151 Ga0500604_0003349 Ga0500604_0003349_1042_1671 209
462 3300053151 Ga0500604_0116829 Ga0500604_0116829_145_774 209
463 3300053154 Ga0500619_000180 Ga0500619_000180_1170_1799 209
464 3300053156 Ga0500622_0000202 Ga0500622_0000202_32935_33564 209
465 3300053156 Ga0500622_0081863 Ga0500622_0081863_83_712 209
466 3300061719 Ga0466962_0002769 Ga0466962_0002769_3071_3739 209
467 3300002773 JGI25152J39213_1001709 JGI25152J39213_10017098 210
468 3300002773 JGI25152J39213_1002886 JGI25152J39213_10028864 210
469 3300003215 JGI25153J46596_10029375 JGI25153J46596_100293753 210
470 3300003771 Ga0055526_1004651 Ga0055526_10046516 210
471 3300005328 Ga0070676_10013248 Ga0070676_100132483 210
472 3300005328 Ga0070676_10109878 Ga0070676_101098782 210
473 3300005328 Ga0070676_10380063 Ga0070676_103800632 210
474 3300005331 Ga0070670_100016116 Ga0070670_1000161163 210
475 3300005331 Ga0070670_100097990 Ga0070670_1000979903 210
476 3300005333 Ga0070677_10001548 Ga0070677_100015485 210
477 3300005333 Ga0070677_10037333 Ga0070677_100373333 210
478 3300005334 Ga0068869_100027665 Ga0068869_1000276653 210
479 3300005334 Ga0068869_100227886 Ga0068869_1002278863 210
480 3300005338 Ga0068868_100081103 Ga0068868_1000811033 210
481 3300005340 Ga0070689_100034512 Ga0070689_1000345121 210
482 3300005344 Ga0070661_100621432 Ga0070661_1006214321 210
483 3300005347 Ga0070668_100004953 Ga0070668_1000049539 210
484 3300005347 Ga0070668_100386909 Ga0070668_1003869092 210
485 3300005353 Ga0070669_100006105 Ga0070669_1000061053 210
486 3300005353 Ga0070669_100025041 Ga0070669_1000250415 210
487 3300005354 Ga0070675_100001535 Ga0070675_10000153516 210
488 3300005355 Ga0070671_100021133 Ga0070671_1000211334 210
489 3300005355 Ga0070671_100040868 Ga0070671_1000408683 210
490 3300005356 Ga0070674_100008300 Ga0070674_1000083004 210
491 3300005356 Ga0070674_100030634 Ga0070674_1000306343 210
492 3300005364 Ga0070673_100005136 Ga0070673_1000051363 210
493 3300005364 Ga0070673_100008629 Ga0070673_1000086299 210
494 3300005364 Ga0070673_100072711 Ga0070673_1000727112 210
495 3300005364 Ga0070673_100234991 Ga0070673_1002349912 210
496 3300005365 Ga0070688_100068326 Ga0070688_1000683263 210
497 3300005367 Ga0070667_100001171 Ga0070667_1000011716 210
498 3300005367 Ga0070667_100043049 Ga0070667_1000430494 210
499 3300005367 Ga0070667_100419924 Ga0070667_1004199241 210
500 3300005455 Ga0070663_100415337 Ga0070663_1004153372 210
501 3300005456 Ga0070678_100001334 Ga0070678_1000013349 210
502 3300005456 Ga0070678_100009607 Ga0070678_1000096073 210
503 3300005456 Ga0070678_100096522 Ga0070678_1000965224 210
504 3300005457 Ga0070662_100034601 Ga0070662_1000346015 210
505 3300005459 Ga0068867_100002971 Ga0068867_1000029716 210
506 3300005459 Ga0068867_100032757 Ga0068867_1000327573 210
507 3300005459 Ga0068867_100042848 Ga0068867_1000428482 210
508 3300005459 Ga0068867_100139769 Ga0068867_1001397692 210
509 3300005467 Ga0070706_100000670 Ga0070706_1000006703 210
510 3300005468 Ga0070707_100557157 Ga0070707_1005571572 210
511 3300005518 Ga0070699_100224034 Ga0070699_1002240341 210
512 3300005543 Ga0070672_100002062 Ga0070672_1000020628 210
513 3300005543 Ga0070672_100023394 Ga0070672_1000233944 210
514 3300005543 Ga0070672_100042983 Ga0070672_1000429833 210
515 3300005543 Ga0070672_100062465 Ga0070672_1000624653 210
516 3300005543 Ga0070672_100205866 Ga0070672_1002058663 210
517 3300005543 Ga0070672_100272832 Ga0070672_1002728322 210
518 3300005544 Ga0070686_100789242 Ga0070686_1007892421 210
519 3300005548 Ga0070665_100471710 Ga0070665_1004717101 210
520 3300005578 Ga0068854_100143833 Ga0068854_1001438333 210
521 3300005616 Ga0068852_100601482 Ga0068852_1006014823 210
522 3300005617 Ga0068859_100002636 Ga0068859_1000026365 210
523 3300005618 Ga0068864_100020879 Ga0068864_1000208794 210
524 3300005618 Ga0068864_100045556 Ga0068864_1000455563 210
525 3300005618 Ga0068864_100525333 Ga0068864_1005253332 210
526 3300005718 Ga0068866_10119073 Ga0068866_101190732 210
527 3300005719 Ga0068861_100063998 Ga0068861_1000639983 210
528 3300005834 Ga0068851_10104658 Ga0068851_101046582 210
529 3300005841 Ga0068863_100147201 Ga0068863_1001472013 210
530 3300005841 Ga0068863_100376200 Ga0068863_1003762002 210
531 3300005841 Ga0068863_100654072 Ga0068863_1006540722 210
532 3300005842 Ga0068858_100054908 Ga0068858_1000549084 210
533 3300005843 Ga0068860_100299585 Ga0068860_1002995852 210
534 3300005843 Ga0068860_100536719 Ga0068860_1005367192 210
535 3300005844 Ga0068862_100025669 Ga0068862_1000256695 210
536 3300006042 Ga0075368_10024067 Ga0075368_100240673 210
537 3300006186 Ga0075369_10010341 Ga0075369_100103413 210
538 3300006195 Ga0075366_10013799 Ga0075366_100137993 210
539 3300006195 Ga0075366_10034429 Ga0075366_100344293 210
540 3300006195 Ga0075366_10059108 Ga0075366_100591083 210
541 3300006195 Ga0075366_10189916 Ga0075366_101899162 210
542 3300006195 Ga0075366_10334354 Ga0075366_103343542 210
543 3300006237 Ga0097621_100020890 Ga0097621_1000208903 210
544 3300006237 Ga0097621_100067657 Ga0097621_1000676574 210
545 3300006237 Ga0097621_100083076 Ga0097621_1000830763 210
546 3300006237 Ga0097621_100325218 Ga0097621_1003252182 210
547 3300006353 Ga0075370_10001743 Ga0075370_100017433 210
548 3300006353 Ga0075370_10152705 Ga0075370_101527053 210
549 3300006358 Ga0068871_100005010 Ga0068871_1000050103 210
550 3300006358 Ga0068871_100040812 Ga0068871_1000408122 210
551 3300006358 Ga0068871_100137399 Ga0068871_1001373991 210
552 3300006358 Ga0068871_100141677 Ga0068871_1001416772 210
553 3300006881 Ga0068865_100036259 Ga0068865_1000362593 210
554 3300006931 Ga0097620_100002636 Ga0097620_1000026365 210
555 3300009098 Ga0105245_10122662 Ga0105245_101226623 210
556 3300009148 Ga0105243_10082533 Ga0105243_100825334 210
557 3300009177 Ga0105248_10138031 Ga0105248_101380313 210
558 3300009551 Ga0105238_10824318 Ga0105238_108243182 210
559 3300009553 Ga0105249_10052686 Ga0105249_100526864 210
560 3300013296 Ga0157374_10121407 Ga0157374_101214073 210
561 3300013296 Ga0157374_10641785 Ga0157374_106417852 210
562 3300013306 Ga0163162_10028472 Ga0163162_100284725 210
563 3300013306 Ga0163162_10052435 Ga0163162_100524354 210
564 3300013308 Ga0157375_10039345 Ga0157375_100393455 210
565 3300013308 Ga0157375_10056327 Ga0157375_100563273 210
566 3300013308 Ga0157375_10135933 Ga0157375_101359333 210
567 3300013308 Ga0157375_10237311 Ga0157375_102373113 210
568 3300013308 Ga0157375_11266767 Ga0157375_112667672 210
569 3300014325 Ga0163163_10083873 Ga0163163_100838734 210
570 3300014326 Ga0157380_10102647 Ga0157380_101026473 210
571 3300014326 Ga0157380_10556477 Ga0157380_105564772 210
572 3300014968 Ga0157379_10013894 Ga0157379_100138945 210
573 3300014969 Ga0157376_10051337 Ga0157376_100513374 210
574 3300014969 Ga0157376_10327596 Ga0157376_103275963 210
575 3300017792 Ga0163161_10049540 Ga0163161_100495403 210
576 3300017792 Ga0163161_10051865 Ga0163161_100518654 210
577 3300025245 Ga0207425_1000131 Ga0207425_100013126 210
578 3300025258 Ga0209129_1000075 Ga0209129_100007574 210
579 3300025295 Ga0209564_1000046 Ga0209564_1000046238 210
580 3300025297 Ga0209758_1000052 Ga0209758_1000052225 210
581 3300025299 Ga0209256_1013851 Ga0209256_10138514 210
582 3300025299 Ga0209256_1064149 Ga0209256_10641492 210
583 3300025304 Ga0209257_1030582 Ga0209257_10305821 210
584 3300025321 Ga0207656_10111072 Ga0207656_101110722 210
585 3300025893 Ga0207682_10001523 Ga0207682_100015238 210
586 3300025893 Ga0207682_10027272 Ga0207682_100272722 210
587 3300025893 Ga0207682_10063659 Ga0207682_100636592 210
588 3300025899 Ga0207642_10018235 Ga0207642_100182354 210
589 3300025899 Ga0207642_10051757 Ga0207642_100517572 210
590 3300025903 Ga0207680_10325724 Ga0207680_103257242 210
591 3300025907 Ga0207645_10008686 Ga0207645_100086862 210
592 3300025908 Ga0207643_10049838 Ga0207643_100498383 210
593 3300025909 Ga0207705_10534207 Ga0207705_105342072 210
594 3300025910 Ga0207684_10068094 Ga0207684_100680943 210
595 3300025920 Ga0207649_10549080 Ga0207649_105490802 210
596 3300025922 Ga0207646_10771870 Ga0207646_107718701 210
597 3300025923 Ga0207681_10018380 Ga0207681_100183805 210
598 3300025923 Ga0207681_10049977 Ga0207681_100499773 210
599 3300025923 Ga0207681_10409725 Ga0207681_104097252 210
600 3300025925 Ga0207650_10002460 Ga0207650_100024606 210
601 3300025925 Ga0207650_10285723 Ga0207650_102857232 210
602 3300025925 Ga0207650_10469996 Ga0207650_104699962 210
603 3300025926 Ga0207659_10064026 Ga0207659_100640264 210
604 3300025927 Ga0207687_10075296 Ga0207687_100752963 210
605 3300025931 Ga0207644_10016645 Ga0207644_100166452 210
606 3300025931 Ga0207644_10020354 Ga0207644_100203544 210
607 3300025931 Ga0207644_10049561 Ga0207644_100495615 210
608 3300025931 Ga0207644_10219693 Ga0207644_102196932 210
609 3300025931 Ga0207644_10308767 Ga0207644_103087671 210
610 3300025936 Ga0207670_10035459 Ga0207670_100354593 210
611 3300025937 Ga0207669_10014898 Ga0207669_100148983 210
612 3300025937 Ga0207669_10158269 Ga0207669_101582691 210
613 3300025938 Ga0207704_10027482 Ga0207704_100274823 210
614 3300025940 Ga0207691_10001741 Ga0207691_1000174118 210
615 3300025940 Ga0207691_10006082 Ga0207691_100060826 210
616 3300025940 Ga0207691_10045325 Ga0207691_100453254 210
617 3300025940 Ga0207691_10106713 Ga0207691_101067132 210
618 3300025940 Ga0207691_10157816 Ga0207691_101578163 210
619 3300025942 Ga0207689_10014824 Ga0207689_100148245 210
620 3300025942 Ga0207689_10315909 Ga0207689_103159092 210
621 3300025945 Ga0207679_10274408 Ga0207679_102744083 210
622 3300025960 Ga0207651_10037495 Ga0207651_100374953 210
623 3300025960 Ga0207651_10155760 Ga0207651_101557602 210
624 3300025960 Ga0207651_10275512 Ga0207651_102755122 210
625 3300025960 Ga0207651_10770105 Ga0207651_107701051 210
626 3300025961 Ga0207712_10076222 Ga0207712_100762223 210
627 3300025972 Ga0207668_10033305 Ga0207668_100333053 210
628 3300025981 Ga0207640_10451546 Ga0207640_104515462 210
629 3300025986 Ga0207658_10000959 Ga0207658_100009596 210
630 3300025986 Ga0207658_10034313 Ga0207658_100343134 210
631 3300025986 Ga0207658_10087064 Ga0207658_100870643 210
632 3300025986 Ga0207658_10314803 Ga0207658_103148032 210
633 3300026023 Ga0207677_10072104 Ga0207677_100721043 210
634 3300026023 Ga0207677_10092228 Ga0207677_100922283 210
635 3300026035 Ga0207703_10206014 Ga0207703_102060143 210
636 3300026088 Ga0207641_10049902 Ga0207641_100499022 210
637 3300026088 Ga0207641_10112479 Ga0207641_101124793 210
638 3300026088 Ga0207641_10918976 Ga0207641_109189762 210
639 3300026089 Ga0207648_10002848 Ga0207648_100028483 210
640 3300026089 Ga0207648_10038606 Ga0207648_100386062 210
641 3300026089 Ga0207648_10097960 Ga0207648_100979603 210
642 3300026089 Ga0207648_10105316 Ga0207648_101053163 210
643 3300026095 Ga0207676_10015099 Ga0207676_100150996 210
644 3300026095 Ga0207676_10026111 Ga0207676_100261112 210
645 3300026095 Ga0207676_10026609 Ga0207676_100266095 210
646 3300026118 Ga0207675_100025434 Ga0207675_1000254343 210
647 3300026118 Ga0207675_101167756 Ga0207675_1011677561 210
648 3300026121 Ga0207683_10006663 Ga0207683_100066638 210
649 3300026121 Ga0207683_10013159 Ga0207683_100131598 210
650 3300026121 Ga0207683_10052477 Ga0207683_100524773 210
651 3300026121 Ga0207683_10084334 Ga0207683_100843344 210
652 3300026121 Ga0207683_10176541 Ga0207683_101765412 210
653 3300026121 Ga0207683_10188520 Ga0207683_101885203 210
654 3300026142 Ga0207698_10461291 Ga0207698_104612913 210
655 3300028379 Ga0268266_10722222 Ga0268266_107222222 210
656 3300028380 Ga0268265_10756346 Ga0268265_107563462 210
657 3300028381 Ga0268264_10238395 Ga0268264_102383952 210
658 3300028794 Ga0307515_10336081 Ga0307515_103360812 210
659 3300028794 Ga0307515_10477683 Ga0307515_104776832 210
660 3300031456 Ga0307513_10168930 Ga0307513_101689303 210
661 3300031456 Ga0307513_10236591 Ga0307513_102365912 210
662 3300031995 Ga0307409_100255757 Ga0307409_1002557573 210
663 3300032005 Ga0307411_10048663 Ga0307411_100486631 210
664 3300035170 Ga0373943_0031464 Ga0373943_0031464_1829_2473 210
665 3300035725 Ga0373947_0028227 Ga0373947_0028227_1284_1925 210
666 3300036401 Ga0373937_0028691 Ga0373937_0028691_3902_4543 210
667 3300041492 Ga0451835_1076998 Ga0451835_1076998_40_672 210
668 3300041507 Ga0451851_0230368 Ga0451851_0230368_15_656 210
669 3300042115 Ga0450911_003584 Ga0450911_003584_1052_1699 210
670 3300042438 Ga0439459_0015933 Ga0439459_0015933_441_1079 210
671 3300042876 Ga0451577_0356691 Ga0451577_0356691_363_998 210
672 3300044712 Ga0453684_0703456 Ga0453684_0703456_43_678 210
673 3300046457 Ga0495590_0007405 Ga0495590_0007405_233_865 210
674 3300046459 Ga0495629_0069203 Ga0495629_0069203_1326_1967 210
675 3300046516 Ga0495628_0528178 Ga0495628_0528178_75_716 210
676 3300046519 Ga0495632_0007745 Ga0495632_0007745_628_1260 210
677 3300046539 Ga0495621_0054314 Ga0495621_0054314_676_1323 210
678 3300046539 Ga0495621_0066745 Ga0495621_0066745_467_1111 210
679 3300046543 Ga0495645_0156318 Ga0495645_0156318_367_1008 210
680 3300046543 Ga0495645_0425101 Ga0495645_0425101_63_704 210
681 3300046660 Ga0495625_0019171 Ga0495625_0019171_4365_4997 210
682 3300046681 Ga0495647_0216216 Ga0495647_0216216_58_705 210
683 3300046683 Ga0495658_0145588 Ga0495658_0145588_430_1074 210
684 3300046689 Ga0495613_0219569 Ga0495613_0219569_370_1011 210
685 3300046694 Ga0495649_0004724 Ga0495649_0004724_988_1620 210
686 3300046810 Ga0495660_0105785 Ga0495660_0105785_273_905 210
687 3300047443 Ga0495687_005079 Ga0495687_005079_7231_7863 210
688 3300047443 Ga0495687_006945 Ga0495687_006945_4324_4956 210
689 3300047471 Ga0495684_0138480 Ga0495684_0138480_576_1217 210
690 3300048907 Ga0496104_0272846 Ga0496104_0272846_846_1493 210
691 3300048908 Ga0496105_0272040 Ga0496105_0272040_434_1081 210
692 3300048909 Ga0496106_0351541 Ga0496106_0351541_76_723 210
693 3300048911 Ga0496108_0273204 Ga0496108_0273204_271_912 210
694 3300048912 Ga0496109_0128519 Ga0496109_0128519_222_869 210
695 3300048913 Ga0496110_0235992 Ga0496110_0235992_579_1220 210
696 3300048924 Ga0496121_0018535 Ga0496121_0018535_5203_5850 210
697 3300048927 Ga0496124_0136939 Ga0496124_0136939_562_1209 210
698 3300048928 Ga0496125_0060586 Ga0496125_0060586_1182_1829 210
699 3300048928 Ga0496125_0080252 Ga0496125_0080252_906_1553 210
700 3300048928 Ga0496125_0145801 Ga0496125_0145801_578_1225 210
701 3300049460 Ga0495682_0079819 Ga0495682_0079819_399_1031 210
702 3300049579 Ga0501043_0000004 Ga0501043_0000004_149879_150532 210
703 3300049580 Ga0501046_0000016 Ga0501046_0000016_141304_141957 210
704 3300049581 Ga0501047_0000012 Ga0501047_0000012_140984_141637 210
705 3300049582 Ga0501048_0035397 Ga0501048_0035397_796_1449 210
706 3300049824 Ga0501045_0192075 Ga0501045_0192075_683_1336 210
707 3300050489 nmdc:mga03683_9019_c1 nmdc:mga03683_9019_c1_773_1405 210
708 3300050492 nmdc:mga0yw44_47259_c1 nmdc:mga0yw44_47259_c1_1385_2017 210
709 3300050493 nmdc:mga0k408_14932_c1 nmdc:mga0k408_14932_c1_750_1415 210
710 3300050493 nmdc:mga0k408_24186_c1 nmdc:mga0k408_24186_c1_1607_2242 210
711 3300050493 nmdc:mga0k408_83039_c1 nmdc:mga0k408_83039_c1_834_1466 210
712 3300050493 nmdc:mga0k408_8818_c1 nmdc:mga0k408_8818_c1_1264_1896 210
713 3300050493 nmdc:mga0k408_9344_c1 nmdc:mga0k408_9344_c1_968_1600 210
714 3300050494 nmdc:mga06z11_110420_c1 nmdc:mga06z11_110420_c1_615_1277 210
715 3300050494 nmdc:mga06z11_123658_c1 nmdc:mga06z11_123658_c1_484_1116 210
716 3300050494 nmdc:mga06z11_248091_c1 nmdc:mga06z11_248091_c1_10_642 210
717 3300050495 nmdc:mga04h51_70965_c1 nmdc:mga04h51_70965_c1_10_642 210
718 3300050496 nmdc:mga07m45_167580_c1 nmdc:mga07m45_167580_c1_359_1015 210
719 3300050496 nmdc:mga07m45_2993_c2 nmdc:mga07m45_2993_c2_828_1460 210
720 3300050496 nmdc:mga07m45_35470_c1 nmdc:mga07m45_35470_c1_1205_1870 210
721 3300050516 nmdc:mga0sz30_3098_c1 nmdc:mga0sz30_3098_c1_4557_5189 210
722 3300053077 Ga0495601_0299709 Ga0495601_0299709_47_688 210
723 3300053084 Ga0495595_0089668 Ga0495595_0089668_222_863 210
724 3300053134 Ga0500658_0008541 Ga0500658_0008541_2078_2710 210
725 3300053139 Ga0500568_0028846 Ga0500568_0028846_1253_1885 210

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04973

NMN_transporter

Nicotinamide mononucleotide transporter

34

214

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4qtn-assembly1.cif.gz_B crystal structure of the vitamin b3 transporter pnuc 0.8279 25 205
4qtn-assembly1.cif.gz_B crystal structure of the vitamin b3 transporter pnuc 0.7184 25 205
2chp-assembly1.cif.gz_A crystal structure of the dodecameric ferritin mrga from b. subtilis 168 0.4633 111 204
3t9j-assembly1.cif.gz_A-4 crystal structure hp-nap from strain ys39 in apo form 0.4549 113 205
3t9j-assembly1.cif.gz_A-2 crystal structure hp-nap from strain ys39 in apo form 0.4549 113 205
ID Description Score Start End Superfamily
af_D3ZYP5_7_123_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.5512 108 196 1.20.120.550
af_Q54UQ6_235_311_1.20.1280.20 Mainly Alpha;Up-down Bundle;Monooxygenase;HscB, C-terminal domain 0.5421 105 204 1.20.1280.20
af_E1JH38_1_134_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.528 110 205 1.20.140.150
af_Q54K44_8_93_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.5184 109 203 1.20.1280.290
af_Q9VUN8_10_99_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.5153 107 210 1.20.1280.290
ID Description Score Start End GO Terms
AF-J2KBV2-F1-model_v4 Nicotinamide riboside transporter PnuC 0.991 6 207 GO:0005886
GO:0034257
AF-A0A257JKJ3-F1-model_v4 Nicotinamide riboside transporter PnuC 0.9873 1 205 GO:0005886
GO:0034257
AF-A0A4R1ZLJ2-F1-model_v4 deleted 0.9743 17 209
AF-A2SJR4-F1-model_v4 Nicotinamide riboside transporter PnuC 0.9597 2 205 GO:0005886
GO:0034257
AF-A0A257JKJ3-F1-model_v4 Nicotinamide riboside transporter PnuC 0.9595 1 205 GO:0005886
GO:0034257

Feature Viewer

pLDDT pTM Quality
93.26 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map