F477601
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 725 | 313 | 716 | 210 |
Family's Representative Sequence
| Representative Sequence | 3300005467|Ga0070706_100000670|Ga0070706_1000006703 |
| Length | 231 |
| Sequence | MGVRRGRFADVNSLLHALQPLFAVAFTVLGAPFTWLELVAFVLAVAMVVFNIRVNPLGWPLAIVSSLLYFALFWSSRLYGDASLQIFFAAVALWGWWQWLRGTQADGGALRVRTLGPRGRTLIVLVLAAAWPATGLFLKRYTDTDVPWWDAFPTAASVIGQWLLGRKYLENWVAWIVVNIVSVGLFAYKGLWLTVVLYTIFVAMSVVGWRAWRRLLGATSAAAAARAPHAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 2 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 3 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 4 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 5 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 6 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 7 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 8 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 9 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 10 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 11 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 12 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 13 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 14 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 15 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 16 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 17 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 19 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 26 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 28 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 61 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 66 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 68 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 69 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 70 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 71 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 72 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 73 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 74 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 75 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 77 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 78 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 79 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 81 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 103 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 104 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 105 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 106 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 107 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 108 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 111 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 163 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 169 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 170 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 171 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 172 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 173 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 174 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 175 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 176 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 177 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 178 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 179 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 180 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 181 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 182 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 183 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 184 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 185 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 186 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 187 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 188 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 189 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 190 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 191 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 192 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 193 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 194 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 195 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 196 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 197 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 198 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 199 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 200 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 201 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 202 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 203 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 204 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 205 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 206 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 207 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 208 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 209 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 210 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 211 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 212 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 213 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 214 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 215 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 216 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 217 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 218 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 219 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 220 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 221 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 222 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 223 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 224 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 225 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 226 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 260 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 261 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 262 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 263 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 264 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 265 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 266 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 267 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 268 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 269 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 271 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 276 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 279 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 280 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 281 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 282 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 283 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 284 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 285 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 286 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 287 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 292 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 293 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 294 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 295 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 296 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 297 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 298 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 299 | 3300053127 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere | Metagenome | Endosphere |
| 300 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 301 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 302 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 303 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 304 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 305 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 306 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 307 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 308 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 309 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 310 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 311 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 312 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 313 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.76 |
| Metatranscriptomes | 0 |
| Isolates | 1.24 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 17.38 |
| Nodule | 0.28 |
| Rhizoplane | 1.93 |
| Rhizosphere | 71.72 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.69 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25152J39213_1001709 | 3300002773 | Bacteria | 9004 |
| 2 | JGI25152J39213_1002886 | 3300002773 | Bacteria | 6145 |
| 3 | JGI25153J46596_10029375 | 3300003215 | Bacteria | 1889 |
| 4 | rootL2_10175725 | 3300003322 | Bacteria | 1210 |
| 5 | rootH1_10012451 | 3300003323 | Bacteria | 2217 |
| 6 | rootH1_10029292 | 3300003323 | Bacteria | 1640 |
| 7 | Ga0055526_1004651 | 3300003771 | Bacteria | 8162 |
| 8 | Ga0055530_10011329 | 3300003791 | Bacteria | 3210 |
| 9 | Ga0055530_10013387 | 3300003791 | Bacteria | 2803 |
| 10 | Ga0055540_1000002 | 3300003792 | Bacteria | 436954 |
| 11 | Ga0055531_10004641 | 3300003794 | Bacteria | 8250 |
| 12 | Ga0065165_1003311 | 3300005262 | Bacteria | 11548 |
| 13 | Ga0070658_10839318 | 3300005327 | Bacteria | 798 |
| 14 | Ga0070676_10009865 | 3300005328 | Bacteria | 5167 |
| 15 | Ga0070676_10013248 | 3300005328 | Bacteria | 4517 |
| 16 | Ga0070676_10014725 | 3300005328 | Bacteria | 4302 |
| 17 | Ga0070676_10026643 | 3300005328 | Bacteria | 3273 |
| 18 | Ga0070676_10109878 | 3300005328 | Bacteria | 1715 |
| 19 | Ga0070676_10380063 | 3300005328 | Bacteria | 978 |
| 20 | Ga0070683_100186750 | 3300005329 | Bacteria | 1968 |
| 21 | Ga0070690_100123156 | 3300005330 | Bacteria | 1743 |
| 22 | Ga0070670_100001820 | 3300005331 | Bacteria | 17371 |
| 23 | Ga0070670_100016116 | 3300005331 | Bacteria | 6414 |
| 24 | Ga0070670_100097990 | 3300005331 | Bacteria | 2522 |
| 25 | Ga0070670_100101058 | 3300005331 | Bacteria | 2483 |
| 26 | Ga0070670_100415891 | 3300005331 | Bacteria | 1188 |
| 27 | Ga0070677_10001548 | 3300005333 | Bacteria | 7279 |
| 28 | Ga0070677_10009375 | 3300005333 | Bacteria | 3317 |
| 29 | Ga0070677_10027675 | 3300005333 | Bacteria | 2136 |
| 30 | Ga0070677_10037333 | 3300005333 | Bacteria | 1895 |
| 31 | Ga0068869_100004621 | 3300005334 | Bacteria | 8588 |
| 32 | Ga0068869_100013561 | 3300005334 | Bacteria | 5424 |
| 33 | Ga0068869_100027665 | 3300005334 | Bacteria | 3956 |
| 34 | Ga0068869_100227886 | 3300005334 | Bacteria | 1480 |
| 35 | Ga0070666_10041643 | 3300005335 | Bacteria | 3070 |
| 36 | Ga0068868_100081103 | 3300005338 | Bacteria | 2600 |
| 37 | Ga0068868_100097025 | 3300005338 | Bacteria | 2381 |
| 38 | Ga0068868_100146793 | 3300005338 | Bacteria | 1940 |
| 39 | Ga0068868_100334934 | 3300005338 | Bacteria | 1292 |
| 40 | Ga0070689_100034512 | 3300005340 | Bacteria | 3860 |
| 41 | Ga0070689_100175586 | 3300005340 | Bacteria | 1737 |
| 42 | Ga0070689_100896337 | 3300005340 | Bacteria | 784 |
| 43 | Ga0070687_100014736 | 3300005343 | Bacteria | 3519 |
| 44 | Ga0070661_100290663 | 3300005344 | Bacteria | 1270 |
| 45 | Ga0070661_100621432 | 3300005344 | Bacteria | 875 |
| 46 | Ga0070668_100004953 | 3300005347 | Bacteria | 9859 |
| 47 | Ga0070668_100009291 | 3300005347 | Bacteria | 7292 |
| 48 | Ga0070668_100386909 | 3300005347 | Bacteria | 1191 |
| 49 | Ga0070669_100006105 | 3300005353 | Bacteria | 8694 |
| 50 | Ga0070669_100025041 | 3300005353 | Bacteria | 4283 |
| 51 | Ga0070669_100066477 | 3300005353 | Bacteria | 2657 |
| 52 | Ga0070669_100261286 | 3300005353 | Bacteria | 1382 |
| 53 | Ga0070675_100001535 | 3300005354 | Bacteria | 17078 |
| 54 | Ga0070675_100005184 | 3300005354 | Bacteria | 9937 |
| 55 | Ga0070675_100028715 | 3300005354 | Bacteria | 4478 |
| 56 | Ga0070675_101052871 | 3300005354 | Bacteria | 747 |
| 57 | Ga0070671_100021133 | 3300005355 | Bacteria | 5314 |
| 58 | Ga0070671_100040868 | 3300005355 | Bacteria | 3853 |
| 59 | Ga0070671_100081753 | 3300005355 | Bacteria | 2701 |
| 60 | Ga0070671_100357690 | 3300005355 | Bacteria | 1246 |
| 61 | Ga0070671_100398329 | 3300005355 | Bacteria | 1177 |
| 62 | Ga0070671_100674958 | 3300005355 | Bacteria | 895 |
| 63 | Ga0070674_100008300 | 3300005356 | Bacteria | 6178 |
| 64 | Ga0070674_100030634 | 3300005356 | Bacteria | 3558 |
| 65 | Ga0070674_100069521 | 3300005356 | Bacteria | 2484 |
| 66 | Ga0070674_100236318 | 3300005356 | Bacteria | 1428 |
| 67 | Ga0070674_100263727 | 3300005356 | Bacteria | 1358 |
| 68 | Ga0070673_100005136 | 3300005364 | Bacteria | 8348 |
| 69 | Ga0070673_100008629 | 3300005364 | Bacteria | 6789 |
| 70 | Ga0070673_100072711 | 3300005364 | Bacteria | 2766 |
| 71 | Ga0070673_100234991 | 3300005364 | Bacteria | 1591 |
| 72 | Ga0070673_100261577 | 3300005364 | Bacteria | 1512 |
| 73 | Ga0070673_100305514 | 3300005364 | Bacteria | 1402 |
| 74 | Ga0070673_100413928 | 3300005364 | Bacteria | 1207 |
| 75 | Ga0070673_100762403 | 3300005364 | Bacteria | 891 |
| 76 | Ga0070673_101090464 | 3300005364 | Bacteria | 746 |
| 77 | Ga0070688_100068326 | 3300005365 | Bacteria | 2265 |
| 78 | Ga0070667_100001171 | 3300005367 | Bacteria | 23847 |
| 79 | Ga0070667_100003010 | 3300005367 | Bacteria | 14476 |
| 80 | Ga0070667_100043049 | 3300005367 | Bacteria | 3789 |
| 81 | Ga0070667_100089205 | 3300005367 | Bacteria | 2648 |
| 82 | Ga0070667_100106214 | 3300005367 | Bacteria | 2430 |
| 83 | Ga0070667_100419924 | 3300005367 | Bacteria | 1219 |
| 84 | Ga0070667_100432808 | 3300005367 | Bacteria | 1200 |
| 85 | Ga0070667_100990802 | 3300005367 | Bacteria | 784 |
| 86 | Ga0070663_100029789 | 3300005455 | Bacteria | 3734 |
| 87 | Ga0070663_100275335 | 3300005455 | Bacteria | 1339 |
| 88 | Ga0070663_100415337 | 3300005455 | Bacteria | 1103 |
| 89 | Ga0070678_100001334 | 3300005456 | Bacteria | 13117 |
| 90 | Ga0070678_100009607 | 3300005456 | Bacteria | 5871 |
| 91 | Ga0070678_100096522 | 3300005456 | Bacteria | 2280 |
| 92 | Ga0070678_100477514 | 3300005456 | Bacteria | 1096 |
| 93 | Ga0070678_100621406 | 3300005456 | Bacteria | 966 |
| 94 | Ga0070678_100711885 | 3300005456 | Bacteria | 905 |
| 95 | Ga0070678_100938836 | 3300005456 | Bacteria | 792 |
| 96 | Ga0070662_100010471 | 3300005457 | Bacteria | 6087 |
| 97 | Ga0070662_100032584 | 3300005457 | Bacteria | 3662 |
| 98 | Ga0070662_100034601 | 3300005457 | Bacteria | 3563 |
| 99 | Ga0070662_100813706 | 3300005457 | Bacteria | 794 |
| 100 | Ga0068867_100002841 | 3300005459 | Bacteria | 12176 |
| 101 | Ga0068867_100002971 | 3300005459 | Bacteria | 11946 |
| 102 | Ga0068867_100032757 | 3300005459 | Bacteria | 3760 |
| 103 | Ga0068867_100042848 | 3300005459 | Bacteria | 3312 |
| 104 | Ga0068867_100052489 | 3300005459 | Bacteria | 3009 |
| 105 | Ga0068867_100105376 | 3300005459 | Bacteria | 2159 |
| 106 | Ga0068867_100139769 | 3300005459 | Bacteria | 1892 |
| 107 | Ga0068867_100146767 | 3300005459 | Bacteria | 1849 |
| 108 | Ga0070706_100000670 | 3300005467 | Bacteria | 38829 |
| 109 | Ga0070707_100557157 | 3300005468 | Bacteria | 1108 |
| 110 | Ga0070699_100224034 | 3300005518 | Bacteria | 1676 |
| 111 | Ga0070679_100194436 | 3300005530 | Bacteria | 1996 |
| 112 | Ga0070672_100002062 | 3300005543 | Bacteria | 12665 |
| 113 | Ga0070672_100003281 | 3300005543 | Bacteria | 10476 |
| 114 | Ga0070672_100010713 | 3300005543 | Bacteria | 6369 |
| 115 | Ga0070672_100023394 | 3300005543 | Bacteria | 4554 |
| 116 | Ga0070672_100042983 | 3300005543 | Bacteria | 3481 |
| 117 | Ga0070672_100048996 | 3300005543 | Bacteria | 3285 |
| 118 | Ga0070672_100062465 | 3300005543 | Bacteria | 2939 |
| 119 | Ga0070672_100140374 | 3300005543 | Bacteria | 1992 |
| 120 | Ga0070672_100205866 | 3300005543 | Bacteria | 1647 |
| 121 | Ga0070672_100272832 | 3300005543 | Bacteria | 1428 |
| 122 | Ga0070672_100282596 | 3300005543 | Bacteria | 1403 |
| 123 | Ga0070672_100388970 | 3300005543 | Bacteria | 1194 |
| 124 | Ga0070686_100789242 | 3300005544 | Bacteria | 765 |
| 125 | Ga0070693_100079779 | 3300005547 | Bacteria | 1948 |
| 126 | Ga0070665_100191214 | 3300005548 | Bacteria | 2047 |
| 127 | Ga0070665_100471710 | 3300005548 | Bacteria | 1266 |
| 128 | Ga0070664_100104728 | 3300005564 | Bacteria | 2463 |
| 129 | Ga0070664_100706313 | 3300005564 | Bacteria | 940 |
| 130 | Ga0068857_100012825 | 3300005577 | Bacteria | 7303 |
| 131 | Ga0068857_100025437 | 3300005577 | Bacteria | 5212 |
| 132 | Ga0068854_100018059 | 3300005578 | Bacteria | 4728 |
| 133 | Ga0068854_100030430 | 3300005578 | Bacteria | 3744 |
| 134 | Ga0068854_100143833 | 3300005578 | Bacteria | 1833 |
| 135 | Ga0068856_100059001 | 3300005614 | Bacteria | 3790 |
| 136 | Ga0068852_100070012 | 3300005616 | Bacteria | 3076 |
| 137 | Ga0068852_100164833 | 3300005616 | Bacteria | 2073 |
| 138 | Ga0068852_100601482 | 3300005616 | Bacteria | 1104 |
| 139 | Ga0068852_101136915 | 3300005616 | Bacteria | 801 |
| 140 | Ga0068859_100002636 | 3300005617 | Bacteria | 18245 |
| 141 | Ga0068859_100012962 | 3300005617 | Bacteria | 8376 |
| 142 | Ga0068859_100078982 | 3300005617 | Bacteria | 3330 |
| 143 | Ga0068864_100020879 | 3300005618 | Bacteria | 5482 |
| 144 | Ga0068864_100045556 | 3300005618 | Bacteria | 3762 |
| 145 | Ga0068864_100110843 | 3300005618 | Bacteria | 2444 |
| 146 | Ga0068864_100201786 | 3300005618 | Bacteria | 1827 |
| 147 | Ga0068864_100525333 | 3300005618 | Bacteria | 1141 |
| 148 | Ga0068866_10007367 | 3300005718 | Bacteria | 4605 |
| 149 | Ga0068866_10119073 | 3300005718 | Bacteria | 1485 |
| 150 | Ga0068861_100040775 | 3300005719 | Bacteria | 3474 |
| 151 | Ga0068861_100063998 | 3300005719 | Bacteria | 2828 |
| 152 | Ga0068851_10104658 | 3300005834 | Bacteria | 1505 |
| 153 | Ga0068851_10397291 | 3300005834 | Bacteria | 810 |
| 154 | Ga0068870_10041700 | 3300005840 | Bacteria | 2386 |
| 155 | Ga0068870_10042666 | 3300005840 | Bacteria | 2362 |
| 156 | Ga0068863_100004608 | 3300005841 | Bacteria | 13579 |
| 157 | Ga0068863_100131899 | 3300005841 | Bacteria | 2386 |
| 158 | Ga0068863_100147201 | 3300005841 | Bacteria | 2253 |
| 159 | Ga0068863_100292604 | 3300005841 | Bacteria | 1579 |
| 160 | Ga0068863_100376200 | 3300005841 | Bacteria | 1386 |
| 161 | Ga0068863_100486275 | 3300005841 | Bacteria | 1214 |
| 162 | Ga0068863_100654072 | 3300005841 | Bacteria | 1042 |
| 163 | Ga0068858_100001760 | 3300005842 | Bacteria | 22084 |
| 164 | Ga0068858_100054908 | 3300005842 | Bacteria | 3683 |
| 165 | Ga0068858_100104820 | 3300005842 | Bacteria | 2639 |
| 166 | Ga0068860_100001433 | 3300005843 | Bacteria | 25834 |
| 167 | Ga0068860_100299585 | 3300005843 | Bacteria | 1575 |
| 168 | Ga0068860_100373451 | 3300005843 | Bacteria | 1407 |
| 169 | Ga0068860_100536719 | 3300005843 | Bacteria | 1171 |
| 170 | Ga0068862_100025669 | 3300005844 | Bacteria | 4948 |
| 171 | Ga0068862_100036314 | 3300005844 | Bacteria | 4177 |
| 172 | Ga0070717_10873321 | 3300006028 | Bacteria | 819 |
| 173 | Ga0075365_10106212 | 3300006038 | Bacteria | 1926 |
| 174 | Ga0075368_10024067 | 3300006042 | Bacteria | 2330 |
| 175 | Ga0075368_10064592 | 3300006042 | Bacteria | 1470 |
| 176 | Ga0075363_100044589 | 3300006048 | Bacteria | 2350 |
| 177 | Ga0075363_100072670 | 3300006048 | Bacteria | 1871 |
| 178 | Ga0075363_100084357 | 3300006048 | Bacteria | 1742 |
| 179 | Ga0075363_100197021 | 3300006048 | Bacteria | 1150 |
| 180 | Ga0075364_10050756 | 3300006051 | Bacteria | 2708 |
| 181 | Ga0075362_10058661 | 3300006177 | Bacteria | 1736 |
| 182 | Ga0075362_10127865 | 3300006177 | Bacteria | 1207 |
| 183 | Ga0075362_10305949 | 3300006177 | Bacteria | 789 |
| 184 | Ga0075367_10022479 | 3300006178 | Bacteria | 3537 |
| 185 | Ga0075367_10029363 | 3300006178 | Bacteria | 3144 |
| 186 | Ga0075367_10294385 | 3300006178 | Bacteria | 1021 |
| 187 | Ga0075369_10010341 | 3300006186 | Bacteria | 3647 |
| 188 | Ga0075366_10013799 | 3300006195 | Bacteria | 4606 |
| 189 | Ga0075366_10023472 | 3300006195 | Bacteria | 3593 |
| 190 | Ga0075366_10034429 | 3300006195 | Bacteria | 2983 |
| 191 | Ga0075366_10042422 | 3300006195 | Bacteria | 2693 |
| 192 | Ga0075366_10059108 | 3300006195 | Bacteria | 2277 |
| 193 | Ga0075366_10189916 | 3300006195 | Bacteria | 1248 |
| 194 | Ga0075366_10334354 | 3300006195 | Bacteria | 929 |
| 195 | Ga0097621_100020890 | 3300006237 | Bacteria | 5051 |
| 196 | Ga0097621_100067657 | 3300006237 | Bacteria | 2944 |
| 197 | Ga0097621_100083076 | 3300006237 | Bacteria | 2668 |
| 198 | Ga0097621_100325218 | 3300006237 | Bacteria | 1363 |
| 199 | Ga0097621_100439860 | 3300006237 | Bacteria | 1173 |
| 200 | Ga0097621_100894581 | 3300006237 | Bacteria | 827 |
| 201 | Ga0075370_10001743 | 3300006353 | Bacteria | 9690 |
| 202 | Ga0075370_10007921 | 3300006353 | Bacteria | 5439 |
| 203 | Ga0075370_10011666 | 3300006353 | Bacteria | 4624 |
| 204 | Ga0075370_10032948 | 3300006353 | Bacteria | 2899 |
| 205 | Ga0075370_10038650 | 3300006353 | Bacteria | 2686 |
| 206 | Ga0075370_10125572 | 3300006353 | Bacteria | 1495 |
| 207 | Ga0075370_10152705 | 3300006353 | Bacteria | 1353 |
| 208 | Ga0075370_10204779 | 3300006353 | Bacteria | 1164 |
| 209 | Ga0068871_100005010 | 3300006358 | Bacteria | 9253 |
| 210 | Ga0068871_100040812 | 3300006358 | Bacteria | 3718 |
| 211 | Ga0068871_100137399 | 3300006358 | Bacteria | 2076 |
| 212 | Ga0068871_100141677 | 3300006358 | Bacteria | 2045 |
| 213 | Ga0068871_100195663 | 3300006358 | Bacteria | 1743 |
| 214 | Ga0068865_100010127 | 3300006881 | Bacteria | 5862 |
| 215 | Ga0068865_100036259 | 3300006881 | Bacteria | 3323 |
| 216 | Ga0097620_100002636 | 3300006931 | Bacteria | 18245 |
| 217 | Ga0097620_100012962 | 3300006931 | Bacteria | 8376 |
| 218 | Ga0097620_100078978 | 3300006931 | Bacteria | 3330 |
| 219 | Ga0079104_1000017 | 3300006946 | Bacteria | 313784 |
| 220 | Ga0105245_10048773 | 3300009098 | Bacteria | 3789 |
| 221 | Ga0105245_10122662 | 3300009098 | Bacteria | 2429 |
| 222 | Ga0105245_10256066 | 3300009098 | Bacteria | 1702 |
| 223 | Ga0105243_10049442 | 3300009148 | Bacteria | 3317 |
| 224 | Ga0105243_10082533 | 3300009148 | Bacteria | 2627 |
| 225 | Ga0105243_10187471 | 3300009148 | Bacteria | 1804 |
| 226 | Ga0105243_10232044 | 3300009148 | Bacteria | 1638 |
| 227 | Ga0105241_10953023 | 3300009174 | Bacteria | 800 |
| 228 | Ga0105242_10014443 | 3300009176 | Bacteria | 6119 |
| 229 | Ga0105242_10204457 | 3300009176 | Bacteria | 1756 |
| 230 | Ga0105248_10138031 | 3300009177 | Bacteria | 2751 |
| 231 | Ga0105248_10180017 | 3300009177 | Bacteria | 2382 |
| 232 | Ga0105237_10003466 | 3300009545 | Bacteria | 18708 |
| 233 | Ga0105237_10008395 | 3300009545 | Bacteria | 11193 |
| 234 | Ga0105237_10157249 | 3300009545 | Bacteria | 2270 |
| 235 | Ga0105238_10007665 | 3300009551 | Bacteria | 10803 |
| 236 | Ga0105238_10824318 | 3300009551 | Bacteria | 944 |
| 237 | Ga0105249_10009522 | 3300009553 | Bacteria | 8513 |
| 238 | Ga0105249_10052686 | 3300009553 | Bacteria | 3717 |
| 239 | Ga0105239_10003789 | 3300010375 | Bacteria | 18406 |
| 240 | Ga0105239_10060249 | 3300010375 | Bacteria | 4166 |
| 241 | Ga0157371_10031263 | 3300013102 | Bacteria | 3835 |
| 242 | Ga0157369_10660417 | 3300013105 | Bacteria | 1078 |
| 243 | Ga0157374_10121407 | 3300013296 | Bacteria | 2522 |
| 244 | Ga0157374_10561120 | 3300013296 | Bacteria | 1150 |
| 245 | Ga0157374_10641785 | 3300013296 | Bacteria | 1073 |
| 246 | Ga0157378_10044989 | 3300013297 | Bacteria | 3921 |
| 247 | Ga0157378_10078498 | 3300013297 | Bacteria | 2978 |
| 248 | Ga0157378_10271274 | 3300013297 | Bacteria | 1632 |
| 249 | Ga0163162_10028472 | 3300013306 | Bacteria | 5529 |
| 250 | Ga0163162_10052435 | 3300013306 | Bacteria | 4097 |
| 251 | Ga0163162_10060587 | 3300013306 | Bacteria | 3821 |
| 252 | Ga0163162_10166173 | 3300013306 | Bacteria | 2330 |
| 253 | Ga0163162_10194073 | 3300013306 | Bacteria | 2159 |
| 254 | Ga0157375_10003544 | 3300013308 | Bacteria | 13558 |
| 255 | Ga0157375_10031329 | 3300013308 | Bacteria | 5025 |
| 256 | Ga0157375_10039345 | 3300013308 | Bacteria | 4551 |
| 257 | Ga0157375_10056327 | 3300013308 | Bacteria | 3881 |
| 258 | Ga0157375_10135933 | 3300013308 | Bacteria | 2582 |
| 259 | Ga0157375_10237311 | 3300013308 | Bacteria | 1983 |
| 260 | Ga0157375_11266767 | 3300013308 | Bacteria | 866 |
| 261 | Ga0163163_10083873 | 3300014325 | Bacteria | 3192 |
| 262 | Ga0163163_10179958 | 3300014325 | Bacteria | 2161 |
| 263 | Ga0163163_10510020 | 3300014325 | Bacteria | 1265 |
| 264 | Ga0157380_10102647 | 3300014326 | Bacteria | 2385 |
| 265 | Ga0157380_10318490 | 3300014326 | Bacteria | 1441 |
| 266 | Ga0157380_10556477 | 3300014326 | Bacteria | 1126 |
| 267 | Ga0157377_10068176 | 3300014745 | Bacteria | 2050 |
| 268 | Ga0157379_10013894 | 3300014968 | Bacteria | 7057 |
| 269 | Ga0157379_10031728 | 3300014968 | Bacteria | 4707 |
| 270 | Ga0157376_10051337 | 3300014969 | Bacteria | 3425 |
| 271 | Ga0157376_10327596 | 3300014969 | Bacteria | 1458 |
| 272 | Ga0157376_10361085 | 3300014969 | Bacteria | 1393 |
| 273 | Ga0163161_10031938 | 3300017792 | Bacteria | 3755 |
| 274 | Ga0163161_10049540 | 3300017792 | Bacteria | 3036 |
| 275 | Ga0163161_10051865 | 3300017792 | Bacteria | 2973 |
| 276 | Ga0213872_10042754 | 3300021361 | Bacteria | 2066 |
| 277 | Ga0207425_1000131 | 3300025245 | Bacteria | 68511 |
| 278 | Ga0209129_1000075 | 3300025258 | Bacteria | 201273 |
| 279 | Ga0209673_1002275 | 3300025273 | Bacteria | 13761 |
| 280 | Ga0209673_1051328 | 3300025273 | Bacteria | 1089 |
| 281 | Ga0209675_1006935 | 3300025291 | Bacteria | 4444 |
| 282 | Ga0209564_1000046 | 3300025295 | Bacteria | 373787 |
| 283 | Ga0209758_1000045 | 3300025297 | Bacteria | 369174 |
| 284 | Ga0209758_1000052 | 3300025297 | Bacteria | 338962 |
| 285 | Ga0209050_1000247 | 3300025298 | Bacteria | 116514 |
| 286 | Ga0209050_1000457 | 3300025298 | Bacteria | 73281 |
| 287 | Ga0209050_1022563 | 3300025298 | Bacteria | 2251 |
| 288 | Ga0209256_1000011 | 3300025299 | Bacteria | 865309 |
| 289 | Ga0209256_1013851 | 3300025299 | Bacteria | 2959 |
| 290 | Ga0209256_1064149 | 3300025299 | Bacteria | 846 |
| 291 | Ga0209051_1000024 | 3300025303 | Bacteria | 437007 |
| 292 | Ga0209051_1002674 | 3300025303 | Bacteria | 12469 |
| 293 | Ga0209051_1018049 | 3300025303 | Bacteria | 3135 |
| 294 | Ga0209257_1000079 | 3300025304 | Bacteria | 316420 |
| 295 | Ga0209257_1030582 | 3300025304 | Bacteria | 1736 |
| 296 | Ga0207697_10017238 | 3300025315 | Bacteria | 2969 |
| 297 | Ga0207656_10111072 | 3300025321 | Bacteria | 1267 |
| 298 | Ga0207656_10193028 | 3300025321 | Bacteria | 981 |
| 299 | Ga0207682_10001523 | 3300025893 | Bacteria | 10677 |
| 300 | Ga0207682_10027272 | 3300025893 | Bacteria | 2274 |
| 301 | Ga0207682_10033070 | 3300025893 | Bacteria | 2080 |
| 302 | Ga0207682_10049175 | 3300025893 | Bacteria | 1740 |
| 303 | Ga0207682_10063659 | 3300025893 | Bacteria | 1549 |
| 304 | Ga0207642_10018235 | 3300025899 | Bacteria | 2689 |
| 305 | Ga0207642_10030161 | 3300025899 | Bacteria | 2256 |
| 306 | Ga0207642_10051757 | 3300025899 | Bacteria | 1860 |
| 307 | Ga0207642_10157072 | 3300025899 | Bacteria | 1217 |
| 308 | Ga0207680_10110209 | 3300025903 | Bacteria | 1784 |
| 309 | Ga0207680_10325724 | 3300025903 | Bacteria | 1075 |
| 310 | Ga0207680_10394355 | 3300025903 | Bacteria | 977 |
| 311 | Ga0207645_10003743 | 3300025907 | Bacteria | 11440 |
| 312 | Ga0207645_10008686 | 3300025907 | Bacteria | 7073 |
| 313 | Ga0207645_10012119 | 3300025907 | Bacteria | 5857 |
| 314 | Ga0207643_10049838 | 3300025908 | Bacteria | 2374 |
| 315 | Ga0207643_10057915 | 3300025908 | Bacteria | 2207 |
| 316 | Ga0207643_10068631 | 3300025908 | Bacteria | 2037 |
| 317 | Ga0207705_10262264 | 3300025909 | Bacteria | 1319 |
| 318 | Ga0207705_10534207 | 3300025909 | Bacteria | 911 |
| 319 | Ga0207684_10068094 | 3300025910 | Bacteria | 3026 |
| 320 | Ga0207654_10039557 | 3300025911 | Bacteria | 2653 |
| 321 | Ga0207695_10031173 | 3300025913 | Bacteria | 5854 |
| 322 | Ga0207671_10005697 | 3300025914 | Bacteria | 11382 |
| 323 | Ga0207662_10005052 | 3300025918 | Bacteria | 6989 |
| 324 | Ga0207657_10034678 | 3300025919 | Bacteria | 4535 |
| 325 | Ga0207649_10183643 | 3300025920 | Bacteria | 1466 |
| 326 | Ga0207649_10549080 | 3300025920 | Bacteria | 884 |
| 327 | Ga0207646_10771870 | 3300025922 | Bacteria | 857 |
| 328 | Ga0207681_10018380 | 3300025923 | Bacteria | 4403 |
| 329 | Ga0207681_10037586 | 3300025923 | Bacteria | 3200 |
| 330 | Ga0207681_10049977 | 3300025923 | Bacteria | 2828 |
| 331 | Ga0207681_10409725 | 3300025923 | Bacteria | 1096 |
| 332 | Ga0207694_10024013 | 3300025924 | Bacteria | 4630 |
| 333 | Ga0207650_10002460 | 3300025925 | Bacteria | 12887 |
| 334 | Ga0207650_10009009 | 3300025925 | Bacteria | 6823 |
| 335 | Ga0207650_10075499 | 3300025925 | Bacteria | 2544 |
| 336 | Ga0207650_10285723 | 3300025925 | Bacteria | 1344 |
| 337 | Ga0207650_10332674 | 3300025925 | Bacteria | 1246 |
| 338 | Ga0207650_10469996 | 3300025925 | Bacteria | 1048 |
| 339 | Ga0207659_10006295 | 3300025926 | Bacteria | 7260 |
| 340 | Ga0207659_10041441 | 3300025926 | Bacteria | 3224 |
| 341 | Ga0207659_10064026 | 3300025926 | Bacteria | 2660 |
| 342 | Ga0207659_10160710 | 3300025926 | Bacteria | 1763 |
| 343 | Ga0207659_10253830 | 3300025926 | Bacteria | 1428 |
| 344 | Ga0207687_10053973 | 3300025927 | Bacteria | 2810 |
| 345 | Ga0207687_10075296 | 3300025927 | Bacteria | 2422 |
| 346 | Ga0207644_10016645 | 3300025931 | Bacteria | 4949 |
| 347 | Ga0207644_10020354 | 3300025931 | Bacteria | 4511 |
| 348 | Ga0207644_10042428 | 3300025931 | Bacteria | 3224 |
| 349 | Ga0207644_10049561 | 3300025931 | Bacteria | 3007 |
| 350 | Ga0207644_10219693 | 3300025931 | Bacteria | 1506 |
| 351 | Ga0207644_10308767 | 3300025931 | Bacteria | 1276 |
| 352 | Ga0207706_10031191 | 3300025933 | Bacteria | 4750 |
| 353 | Ga0207706_10113749 | 3300025933 | Bacteria | 2380 |
| 354 | Ga0207706_10242717 | 3300025933 | Bacteria | 1575 |
| 355 | Ga0207686_10025578 | 3300025934 | Bacteria | 3435 |
| 356 | Ga0207709_10021922 | 3300025935 | Bacteria | 3619 |
| 357 | Ga0207709_10394828 | 3300025935 | Bacteria | 1056 |
| 358 | Ga0207670_10035459 | 3300025936 | Bacteria | 3234 |
| 359 | Ga0207670_10188582 | 3300025936 | Bacteria | 1559 |
| 360 | Ga0207669_10014898 | 3300025937 | Bacteria | 3909 |
| 361 | Ga0207669_10066497 | 3300025937 | Bacteria | 2241 |
| 362 | Ga0207669_10074985 | 3300025937 | Bacteria | 2142 |
| 363 | Ga0207669_10115988 | 3300025937 | Bacteria | 1806 |
| 364 | Ga0207669_10132696 | 3300025937 | Bacteria | 1714 |
| 365 | Ga0207669_10158269 | 3300025937 | Bacteria | 1596 |
| 366 | Ga0207704_10008558 | 3300025938 | Bacteria | 4899 |
| 367 | Ga0207704_10027482 | 3300025938 | Bacteria | 3141 |
| 368 | Ga0207691_10001741 | 3300025940 | Bacteria | 21453 |
| 369 | Ga0207691_10006082 | 3300025940 | Bacteria | 11664 |
| 370 | Ga0207691_10007915 | 3300025940 | Bacteria | 10231 |
| 371 | Ga0207691_10021169 | 3300025940 | Bacteria | 6144 |
| 372 | Ga0207691_10038362 | 3300025940 | Bacteria | 4434 |
| 373 | Ga0207691_10045325 | 3300025940 | Bacteria | 4043 |
| 374 | Ga0207691_10082658 | 3300025940 | Bacteria | 2884 |
| 375 | Ga0207691_10085262 | 3300025940 | Bacteria | 2835 |
| 376 | Ga0207691_10106713 | 3300025940 | Bacteria | 2494 |
| 377 | Ga0207691_10157816 | 3300025940 | Bacteria | 1991 |
| 378 | Ga0207691_10172455 | 3300025940 | Bacteria | 1894 |
| 379 | Ga0207691_10531419 | 3300025940 | Bacteria | 998 |
| 380 | Ga0207691_10821458 | 3300025940 | Bacteria | 780 |
| 381 | Ga0207711_10077302 | 3300025941 | Bacteria | 2901 |
| 382 | Ga0207711_10297657 | 3300025941 | Bacteria | 1488 |
| 383 | Ga0207689_10011178 | 3300025942 | Bacteria | 7701 |
| 384 | Ga0207689_10014824 | 3300025942 | Bacteria | 6617 |
| 385 | Ga0207689_10055774 | 3300025942 | Bacteria | 3252 |
| 386 | Ga0207689_10315909 | 3300025942 | Bacteria | 1296 |
| 387 | Ga0207661_10130483 | 3300025944 | Bacteria | 2152 |
| 388 | Ga0207679_10084416 | 3300025945 | Bacteria | 2437 |
| 389 | Ga0207679_10171165 | 3300025945 | Bacteria | 1788 |
| 390 | Ga0207679_10274408 | 3300025945 | Bacteria | 1443 |
| 391 | Ga0207651_10006687 | 3300025960 | Bacteria | 6069 |
| 392 | Ga0207651_10037495 | 3300025960 | Bacteria | 3176 |
| 393 | Ga0207651_10155760 | 3300025960 | Bacteria | 1784 |
| 394 | Ga0207651_10275512 | 3300025960 | Bacteria | 1388 |
| 395 | Ga0207651_10770105 | 3300025960 | Bacteria | 852 |
| 396 | Ga0207712_10005181 | 3300025961 | Bacteria | 8251 |
| 397 | Ga0207712_10076222 | 3300025961 | Bacteria | 2427 |
| 398 | Ga0207668_10033305 | 3300025972 | Bacteria | 3412 |
| 399 | Ga0207668_10092840 | 3300025972 | Bacteria | 2222 |
| 400 | Ga0207640_10451546 | 3300025981 | Bacteria | 1059 |
| 401 | Ga0207640_10714845 | 3300025981 | Bacteria | 860 |
| 402 | Ga0207658_10000959 | 3300025986 | Bacteria | 23778 |
| 403 | Ga0207658_10009082 | 3300025986 | Bacteria | 6742 |
| 404 | Ga0207658_10034313 | 3300025986 | Bacteria | 3626 |
| 405 | Ga0207658_10059730 | 3300025986 | Bacteria | 2842 |
| 406 | Ga0207658_10087064 | 3300025986 | Bacteria | 2411 |
| 407 | Ga0207658_10314803 | 3300025986 | Bacteria | 1353 |
| 408 | Ga0207677_10072104 | 3300026023 | Bacteria | 2440 |
| 409 | Ga0207677_10092228 | 3300026023 | Bacteria | 2205 |
| 410 | Ga0207677_10133104 | 3300026023 | Bacteria | 1891 |
| 411 | Ga0207677_10219121 | 3300026023 | Bacteria | 1525 |
| 412 | Ga0207703_10001350 | 3300026035 | Bacteria | 22464 |
| 413 | Ga0207703_10206014 | 3300026035 | Bacteria | 1750 |
| 414 | Ga0207678_10010696 | 3300026067 | Bacteria | 8061 |
| 415 | Ga0207678_10041360 | 3300026067 | Bacteria | 3996 |
| 416 | Ga0207702_10241988 | 3300026078 | Bacteria | 1691 |
| 417 | Ga0207641_10009363 | 3300026088 | Bacteria | 8078 |
| 418 | Ga0207641_10049902 | 3300026088 | Bacteria | 3538 |
| 419 | Ga0207641_10069885 | 3300026088 | Bacteria | 3016 |
| 420 | Ga0207641_10112479 | 3300026088 | Bacteria | 2416 |
| 421 | Ga0207641_10323964 | 3300026088 | Bacteria | 1462 |
| 422 | Ga0207641_10918976 | 3300026088 | Bacteria | 869 |
| 423 | Ga0207648_10002848 | 3300026089 | Bacteria | 18311 |
| 424 | Ga0207648_10010781 | 3300026089 | Bacteria | 8636 |
| 425 | Ga0207648_10033465 | 3300026089 | Bacteria | 4533 |
| 426 | Ga0207648_10038606 | 3300026089 | Bacteria | 4201 |
| 427 | Ga0207648_10052175 | 3300026089 | Bacteria | 3576 |
| 428 | Ga0207648_10054667 | 3300026089 | Bacteria | 3487 |
| 429 | Ga0207648_10097960 | 3300026089 | Bacteria | 2567 |
| 430 | Ga0207648_10105316 | 3300026089 | Bacteria | 2474 |
| 431 | Ga0207676_10015099 | 3300026095 | Bacteria | 5569 |
| 432 | Ga0207676_10026111 | 3300026095 | Bacteria | 4341 |
| 433 | Ga0207676_10026609 | 3300026095 | Bacteria | 4302 |
| 434 | Ga0207676_10508889 | 3300026095 | Bacteria | 1144 |
| 435 | Ga0207674_10008218 | 3300026116 | Bacteria | 12093 |
| 436 | Ga0207674_10022905 | 3300026116 | Bacteria | 6701 |
| 437 | Ga0207675_100025434 | 3300026118 | Bacteria | 5511 |
| 438 | Ga0207675_100075512 | 3300026118 | Bacteria | 3155 |
| 439 | Ga0207675_101167756 | 3300026118 | Bacteria | 790 |
| 440 | Ga0207683_10006663 | 3300026121 | Bacteria | 9879 |
| 441 | Ga0207683_10011765 | 3300026121 | Bacteria | 7468 |
| 442 | Ga0207683_10013159 | 3300026121 | Bacteria | 7059 |
| 443 | Ga0207683_10048071 | 3300026121 | Bacteria | 3736 |
| 444 | Ga0207683_10052477 | 3300026121 | Bacteria | 3573 |
| 445 | Ga0207683_10084334 | 3300026121 | Bacteria | 2824 |
| 446 | Ga0207683_10118931 | 3300026121 | Bacteria | 2371 |
| 447 | Ga0207683_10176541 | 3300026121 | Bacteria | 1936 |
| 448 | Ga0207683_10188520 | 3300026121 | Bacteria | 1872 |
| 449 | Ga0207698_10036460 | 3300026142 | Bacteria | 3610 |
| 450 | Ga0207698_10280502 | 3300026142 | Bacteria | 1541 |
| 451 | Ga0207698_10461291 | 3300026142 | Bacteria | 1229 |
| 452 | Ga0207698_11003022 | 3300026142 | Bacteria | 846 |
| 453 | Ga0209281_1000042 | 3300027111 | Bacteria | 344748 |
| 454 | Ga0209813_10064684 | 3300027866 | Bacteria | 1176 |
| 455 | Ga0209974_10132095 | 3300027876 | Bacteria | 891 |
| 456 | Ga0268266_10490045 | 3300028379 | Bacteria | 1172 |
| 457 | Ga0268266_10722222 | 3300028379 | Bacteria | 961 |
| 458 | Ga0268265_10058350 | 3300028380 | Bacteria | 2946 |
| 459 | Ga0268265_10756346 | 3300028380 | Bacteria | 944 |
| 460 | Ga0268264_10004852 | 3300028381 | Bacteria | 11396 |
| 461 | Ga0268264_10092858 | 3300028381 | Bacteria | 2606 |
| 462 | Ga0268264_10238395 | 3300028381 | Bacteria | 1684 |
| 463 | Ga0268264_10258278 | 3300028381 | Bacteria | 1622 |
| 464 | Ga0307517_10001871 | 3300028786 | Bacteria | 34464 |
| 465 | Ga0307517_10080650 | 3300028786 | Bacteria | 2784 |
| 466 | Ga0307517_10091945 | 3300028786 | Bacteria | 2473 |
| 467 | Ga0307517_10229954 | 3300028786 | Bacteria | 1115 |
| 468 | Ga0307515_10000991 | 3300028794 | Bacteria | 64898 |
| 469 | Ga0307515_10001283 | 3300028794 | Bacteria | 57022 |
| 470 | Ga0307515_10038740 | 3300028794 | Bacteria | 7610 |
| 471 | Ga0307515_10064124 | 3300028794 | Bacteria | 5141 |
| 472 | Ga0307515_10252323 | 3300028794 | Bacteria | 1514 |
| 473 | Ga0307515_10336081 | 3300028794 | Bacteria | 1166 |
| 474 | Ga0307515_10477683 | 3300028794 | Bacteria | 859 |
| 475 | Ga0307512_10113458 | 3300030522 | Bacteria | 1773 |
| 476 | Ga0307513_10034868 | 3300031456 | Bacteria | 5639 |
| 477 | Ga0307513_10116867 | 3300031456 | Bacteria | 2645 |
| 478 | Ga0307513_10119691 | 3300031456 | Bacteria | 2604 |
| 479 | Ga0307513_10168930 | 3300031456 | Bacteria | 2067 |
| 480 | Ga0307513_10236591 | 3300031456 | Bacteria | 1635 |
| 481 | Ga0307513_10471060 | 3300031456 | Bacteria | 977 |
| 482 | Ga0307513_10617064 | 3300031456 | Bacteria | 793 |
| 483 | Ga0307509_10000041 | 3300031507 | Bacteria | 182302 |
| 484 | Ga0307509_10025279 | 3300031507 | Bacteria | 6635 |
| 485 | Ga0307509_10030443 | 3300031507 | Bacteria | 5970 |
| 486 | Ga0307509_10064009 | 3300031507 | Bacteria | 3870 |
| 487 | Ga0307509_10139159 | 3300031507 | Bacteria | 2367 |
| 488 | Ga0307509_10214130 | 3300031507 | Bacteria | 1748 |
| 489 | Ga0307508_10000227 | 3300031616 | Bacteria | 68533 |
| 490 | Ga0307508_10038562 | 3300031616 | Bacteria | 4293 |
| 491 | Ga0307514_10001840 | 3300031649 | Bacteria | 23499 |
| 492 | Ga0307514_10077945 | 3300031649 | Bacteria | 2463 |
| 493 | Ga0307514_10100606 | 3300031649 | Bacteria | 2077 |
| 494 | Ga0307516_10000312 | 3300031730 | Bacteria | 62905 |
| 495 | Ga0307516_10000497 | 3300031730 | Bacteria | 52295 |
| 496 | Ga0307516_10004946 | 3300031730 | Bacteria | 16201 |
| 497 | Ga0307516_10005605 | 3300031730 | Bacteria | 14948 |
| 498 | Ga0307516_10350336 | 3300031730 | Bacteria | 1142 |
| 499 | Ga0307405_10006547 | 3300031731 | Bacteria | 5739 |
| 500 | Ga0307413_10094755 | 3300031824 | Bacteria | 1955 |
| 501 | Ga0307410_10009817 | 3300031852 | Bacteria | 5391 |
| 502 | Ga0307406_10034996 | 3300031901 | Bacteria | 3085 |
| 503 | Ga0307407_10101551 | 3300031903 | Bacteria | 1786 |
| 504 | Ga0307412_10018914 | 3300031911 | Bacteria | 4158 |
| 505 | Ga0307409_100094217 | 3300031995 | Bacteria | 2463 |
| 506 | Ga0307409_100255757 | 3300031995 | Bacteria | 1604 |
| 507 | Ga0307416_100088088 | 3300032002 | Bacteria | 2653 |
| 508 | Ga0307416_100158615 | 3300032002 | Bacteria | 2087 |
| 509 | Ga0307411_10048663 | 3300032005 | Bacteria | 2749 |
| 510 | Ga0307507_10040065 | 3300033179 | Bacteria | 4714 |
| 511 | Ga0307510_10020701 | 3300033180 | Bacteria | 7681 |
| 512 | Ga0307510_10026627 | 3300033180 | Bacteria | 6642 |
| 513 | Ga0307510_10100095 | 3300033180 | Bacteria | 2694 |
| 514 | Ga0307510_10105002 | 3300033180 | Bacteria | 2595 |
| 515 | Ga0373953_0051288 | 3300035117 | Bacteria | 1668 |
| 516 | Ga0373943_0031464 | 3300035170 | Bacteria | 2518 |
| 517 | Ga0373924_0062125 | 3300035410 | Bacteria | 1564 |
| 518 | Ga0373931_0033207 | 3300035691 | Bacteria | 2673 |
| 519 | Ga0373935_0224379 | 3300035692 | Bacteria | 1306 |
| 520 | Ga0373927_0266747 | 3300035695 | Bacteria | 1126 |
| 521 | Ga0373933_0332096 | 3300035724 | Bacteria | 986 |
| 522 | Ga0373947_0028227 | 3300035725 | Bacteria | 3288 |
| 523 | Ga0373937_0028691 | 3300036401 | Bacteria | 5037 |
| 524 | Ga0373937_0075115 | 3300036401 | Bacteria | 3120 |
| 525 | Ga0373937_0134894 | 3300036401 | Bacteria | 2307 |
| 526 | Ga0395900_0572842 | 3300037418 | Bacteria | 1072 |
| 527 | Ga0395900_0966104 | 3300037418 | Bacteria | 773 |
| 528 | Ga0395898_0060715 | 3300037466 | Bacteria | 3673 |
| 529 | Ga0395905_0000431 | 3300037471 | Bacteria | 58717 |
| 530 | Ga0395905_0013446 | 3300037471 | Bacteria | 7843 |
| 531 | Ga0395905_0016819 | 3300037471 | Bacteria | 6948 |
| 532 | Ga0395905_0017199 | 3300037471 | Bacteria | 6868 |
| 533 | Ga0395905_0022443 | 3300037471 | Bacteria | 5968 |
| 534 | Ga0395905_0188665 | 3300037471 | Bacteria | 1934 |
| 535 | Ga0395905_0235876 | 3300037471 | Bacteria | 1710 |
| 536 | Ga0395905_0398234 | 3300037471 | Bacteria | 1271 |
| 537 | Ga0436361_0537689 | 3300039447 | Bacteria | 1286 |
| 538 | Ga0436361_0552361 | 3300039447 | Bacteria | 2748 |
| 539 | Ga0439439_0055533 | 3300041406 | Bacteria | 1045 |
| 540 | Ga0451789_0966433 | 3300041443 | Bacteria | 813 |
| 541 | Ga0451791_0680598 | 3300041451 | Bacteria | 771 |
| 542 | Ga0451793_0607649 | 3300041452 | Bacteria | 1389 |
| 543 | Ga0451793_1038358 | 3300041452 | Bacteria | 761 |
| 544 | Ga0451793_1656761 | 3300041452 | Bacteria | 854 |
| 545 | Ga0451797_0679364 | 3300041453 | Bacteria | 1105 |
| 546 | Ga0451807_1925146 | 3300041486 | Bacteria | 1082 |
| 547 | Ga0451835_1076998 | 3300041492 | Bacteria | 791 |
| 548 | Ga0451839_0531012 | 3300041496 | Unclassified | 772 |
| 549 | Ga0451851_0230368 | 3300041507 | Bacteria | 734 |
| 550 | Ga0451853_1613797 | 3300041512 | Bacteria | 1792 |
| 551 | Ga0450911_003584 | 3300042115 | Bacteria | 2704 |
| 552 | Ga0450919_000514 | 3300042121 | Bacteria | 4843 |
| 553 | Ga0439459_0015933 | 3300042438 | Bacteria | 1383 |
| 554 | Ga0450918_000377 | 3300042531 | Bacteria | 9735 |
| 555 | Ga0450893_0009216 | 3300042532 | Bacteria | 1611 |
| 556 | Ga0451577_0356691 | 3300042876 | Bacteria | 1326 |
| 557 | Ga0451577_0403684 | 3300042876 | Bacteria | 1240 |
| 558 | Ga0466969_0109207 | 3300044656 | Bacteria | 1296 |
| 559 | Ga0466965_0243806 | 3300044683 | Bacteria | 962 |
| 560 | Ga0466961_0112239 | 3300044693 | Bacteria | 1714 |
| 561 | Ga0466964_0002777 | 3300044706 | Bacteria | 6290 |
| 562 | Ga0453684_0703456 | 3300044712 | Bacteria | 1098 |
| 563 | Ga0466971_0015449 | 3300044719 | Bacteria | 3360 |
| 564 | Ga0466968_0314042 | 3300044735 | Bacteria | 756 |
| 565 | Ga0466970_0087113 | 3300044765 | Bacteria | 1693 |
| 566 | Ga0466959_0015984 | 3300045049 | Bacteria | 5477 |
| 567 | Ga0451576_0114403 | 3300045051 | Bacteria | 2808 |
| 568 | Ga0495592_0000028 | 3300046454 | Bacteria | 132590 |
| 569 | Ga0495590_0007405 | 3300046457 | Bacteria | 4236 |
| 570 | Ga0495629_0069203 | 3300046459 | Bacteria | 2463 |
| 571 | Ga0495638_0054568 | 3300046460 | Bacteria | 2484 |
| 572 | Ga0495638_0235906 | 3300046460 | Bacteria | 1015 |
| 573 | Ga0495610_0053593 | 3300046512 | Bacteria | 1952 |
| 574 | Ga0495610_0095059 | 3300046512 | Bacteria | 1344 |
| 575 | Ga0495616_0090863 | 3300046513 | Bacteria | 1446 |
| 576 | Ga0495618_0192528 | 3300046514 | Bacteria | 1293 |
| 577 | Ga0495620_0059119 | 3300046515 | Bacteria | 1603 |
| 578 | Ga0495628_0380886 | 3300046516 | Bacteria | 1033 |
| 579 | Ga0495628_0528178 | 3300046516 | Bacteria | 849 |
| 580 | Ga0495630_0047998 | 3300046517 | Bacteria | 3195 |
| 581 | Ga0495632_0007745 | 3300046519 | Bacteria | 6701 |
| 582 | Ga0495632_0055676 | 3300046519 | Bacteria | 1935 |
| 583 | Ga0495632_0179215 | 3300046519 | Bacteria | 971 |
| 584 | Ga0495666_0036781 | 3300046526 | Bacteria | 2384 |
| 585 | Ga0495654_0022190 | 3300046530 | Bacteria | 3299 |
| 586 | Ga0495621_0005578 | 3300046539 | Bacteria | 3627 |
| 587 | Ga0495621_0054314 | 3300046539 | Bacteria | 1440 |
| 588 | Ga0495621_0066745 | 3300046539 | Bacteria | 1317 |
| 589 | Ga0495621_0157671 | 3300046539 | Bacteria | 896 |
| 590 | Ga0495621_0198156 | 3300046539 | Bacteria | 807 |
| 591 | Ga0495597_0108459 | 3300046542 | Bacteria | 1166 |
| 592 | Ga0495645_0067784 | 3300046543 | Bacteria | 2577 |
| 593 | Ga0495645_0156318 | 3300046543 | Bacteria | 1580 |
| 594 | Ga0495645_0425101 | 3300046543 | Bacteria | 842 |
| 595 | Ga0495622_0242412 | 3300046557 | Bacteria | 794 |
| 596 | Ga0495625_0019171 | 3300046660 | Bacteria | 5316 |
| 597 | Ga0495625_0022014 | 3300046660 | Bacteria | 4894 |
| 598 | Ga0495625_0156033 | 3300046660 | Bacteria | 1532 |
| 599 | Ga0495625_0453014 | 3300046660 | Bacteria | 792 |
| 600 | Ga0495635_0563347 | 3300046663 | Bacteria | 746 |
| 601 | Ga0495646_0084859 | 3300046680 | Bacteria | 1838 |
| 602 | Ga0495647_0216216 | 3300046681 | Bacteria | 845 |
| 603 | Ga0495658_0129338 | 3300046683 | Bacteria | 1535 |
| 604 | Ga0495658_0145588 | 3300046683 | Bacteria | 1452 |
| 605 | Ga0495613_0219569 | 3300046689 | Bacteria | 1335 |
| 606 | Ga0495624_0053869 | 3300046690 | Bacteria | 2538 |
| 607 | Ga0495671_0133351 | 3300046692 | Bacteria | 1211 |
| 608 | Ga0495649_0004724 | 3300046694 | Bacteria | 8839 |
| 609 | Ga0495660_0105785 | 3300046810 | Bacteria | 1442 |
| 610 | Ga0495674_0278914 | 3300047319 | Bacteria | 1370 |
| 611 | Ga0495687_000594 | 3300047443 | Bacteria | 42250 |
| 612 | Ga0495687_005079 | 3300047443 | Bacteria | 8539 |
| 613 | Ga0495687_006945 | 3300047443 | Bacteria | 6806 |
| 614 | Ga0495684_0138480 | 3300047471 | Bacteria | 1826 |
| 615 | Ga0495684_0339469 | 3300047471 | Bacteria | 1069 |
| 616 | Ga0495686_0001297 | 3300047472 | Bacteria | 28173 |
| 617 | Ga0495593_0029380 | 3300047673 | Bacteria | 3014 |
| 618 | Ga0495626_0026314 | 3300048091 | Bacteria | 2837 |
| 619 | Ga0496104_0272846 | 3300048907 | Bacteria | 1604 |
| 620 | Ga0496105_0272040 | 3300048908 | Bacteria | 1368 |
| 621 | Ga0496106_0351541 | 3300048909 | Bacteria | 1184 |
| 622 | Ga0496108_0273204 | 3300048911 | Bacteria | 1471 |
| 623 | Ga0496109_0128519 | 3300048912 | Bacteria | 2364 |
| 624 | Ga0496110_0235992 | 3300048913 | Bacteria | 1664 |
| 625 | Ga0496114_0013197 | 3300048917 | Bacteria | 6622 |
| 626 | Ga0496121_0018535 | 3300048924 | Bacteria | 7012 |
| 627 | Ga0496121_0026536 | 3300048924 | Bacteria | 5454 |
| 628 | Ga0496124_0000317 | 3300048927 | Bacteria | 89188 |
| 629 | Ga0496124_0136939 | 3300048927 | Bacteria | 1937 |
| 630 | Ga0496124_0639209 | 3300048927 | Bacteria | 685 |
| 631 | Ga0496125_0022403 | 3300048928 | Bacteria | 5867 |
| 632 | Ga0496125_0060586 | 3300048928 | Bacteria | 3040 |
| 633 | Ga0496125_0080252 | 3300048928 | Bacteria | 2497 |
| 634 | Ga0496125_0145801 | 3300048928 | Bacteria | 1636 |
| 635 | Ga0496125_0199471 | 3300048928 | Bacteria | 1312 |
| 636 | Ga0495682_0079819 | 3300049460 | Bacteria | 1177 |
| 637 | Ga0501292_010355 | 3300049515 | Bacteria | 1395 |
| 638 | Ga0501043_0000004 | 3300049579 | Bacteria | 291085 |
| 639 | Ga0501046_0000016 | 3300049580 | Bacteria | 234374 |
| 640 | Ga0501047_0000012 | 3300049581 | Bacteria | 368824 |
| 641 | Ga0501048_0035397 | 3300049582 | Bacteria | 3594 |
| 642 | Ga0501252_007397 | 3300049682 | Bacteria | 1243 |
| 643 | Ga0501035_0207821 | 3300049822 | Bacteria | 1676 |
| 644 | Ga0501045_0192075 | 3300049824 | Bacteria | 1522 |
| 645 | nmdc:mga03683_149396_c1 | 3300050489 | Bacteria | 1054 |
| 646 | nmdc:mga03683_358208_c1 | 3300050489 | Bacteria | 691 |
| 647 | nmdc:mga03683_9019_c1 | 3300050489 | Bacteria | 3529 |
| 648 | nmdc:mga03n38_307349_c1 | 3300050490 | Bacteria | 853 |
| 649 | nmdc:mga03n38_326475_c1 | 3300050490 | Bacteria | 830 |
| 650 | nmdc:mga03n38_72335_c1 | 3300050490 | Bacteria | 1598 |
| 651 | nmdc:mga00v17_256147_c1 | 3300050491 | Bacteria | 1135 |
| 652 | nmdc:mga0yw44_47259_c1 | 3300050492 | Bacteria | 2589 |
| 653 | nmdc:mga0k408_106001_c1 | 3300050493 | Bacteria | 1660 |
| 654 | nmdc:mga0k408_14932_c1 | 3300050493 | Bacteria | 4289 |
| 655 | nmdc:mga0k408_161057_c1 | 3300050493 | Bacteria | 1337 |
| 656 | nmdc:mga0k408_24186_c1 | 3300050493 | Bacteria | 2706 |
| 657 | nmdc:mga0k408_25980_c1 | 3300050493 | Bacteria | 3319 |
| 658 | nmdc:mga0k408_34475_c1 | 3300050493 | Bacteria | 2898 |
| 659 | nmdc:mga0k408_41741_c1 | 3300050493 | Bacteria | 2642 |
| 660 | nmdc:mga0k408_570007_c1 | 3300050493 | Bacteria | 669 |
| 661 | nmdc:mga0k408_66956_c1 | 3300050493 | Bacteria | 2093 |
| 662 | nmdc:mga0k408_83039_c1 | 3300050493 | Bacteria | 1878 |
| 663 | nmdc:mga0k408_8818_c1 | 3300050493 | Bacteria | 5428 |
| 664 | nmdc:mga0k408_9344_c1 | 3300050493 | Bacteria | 5283 |
| 665 | nmdc:mga06z11_110420_c1 | 3300050494 | Bacteria | 1522 |
| 666 | nmdc:mga06z11_123658_c1 | 3300050494 | Bacteria | 1446 |
| 667 | nmdc:mga06z11_248091_c1 | 3300050494 | Bacteria | 1048 |
| 668 | nmdc:mga04h51_40466_c1 | 3300050495 | Bacteria | 1519 |
| 669 | nmdc:mga04h51_70965_c1 | 3300050495 | Bacteria | 1216 |
| 670 | nmdc:mga07m45_167580_c1 | 3300050496 | Bacteria | 1276 |
| 671 | nmdc:mga07m45_192112_c1 | 3300050496 | Bacteria | 1187 |
| 672 | nmdc:mga07m45_219578_c1 | 3300050496 | Bacteria | 1106 |
| 673 | nmdc:mga07m45_2993_c2 | 3300050496 | Bacteria | 5533 |
| 674 | nmdc:mga07m45_35470_c1 | 3300050496 | Bacteria | 2774 |
| 675 | nmdc:mga07m45_408656_c1 | 3300050496 | Bacteria | 788 |
| 676 | nmdc:mga07m45_436225_c1 | 3300050496 | Bacteria | 760 |
| 677 | nmdc:mga07m45_68110_c1 | 3300050496 | Bacteria | 2024 |
| 678 | nmdc:mga07m45_9585_c1 | 3300050496 | Bacteria | 5031 |
| 679 | nmdc:mga0sz30_3098_c1 | 3300050516 | Bacteria | 5961 |
| 680 | Ga0495601_0299709 | 3300053077 | Bacteria | 1047 |
| 681 | Ga0495612_0257763 | 3300053078 | Bacteria | 777 |
| 682 | Ga0495595_0089668 | 3300053084 | Bacteria | 1474 |
| 683 | Ga0495619_0476371 | 3300053085 | Bacteria | 860 |
| 684 | Ga0500578_0000282 | 3300053086 | Bacteria | 62821 |
| 685 | Ga0500578_0035984 | 3300053086 | Bacteria | 3181 |
| 686 | Ga0500644_0055142 | 3300053088 | Bacteria | 1379 |
| 687 | Ga0500646_0001831 | 3300053090 | Bacteria | 5587 |
| 688 | Ga0500647_0056143 | 3300053091 | Bacteria | 1894 |
| 689 | Ga0500651_0013178 | 3300053093 | Bacteria | 5028 |
| 690 | Ga0500651_0079698 | 3300053093 | Bacteria | 2029 |
| 691 | Ga0500651_0389613 | 3300053093 | Bacteria | 784 |
| 692 | Ga0500650_0065740 | 3300053098 | Bacteria | 1694 |
| 693 | Ga0500650_0139505 | 3300053098 | Bacteria | 1124 |
| 694 | Ga0500569_023259 | 3300053109 | Bacteria | 1663 |
| 695 | Ga0500607_115033 | 3300053121 | Bacteria | 1312 |
| 696 | Ga0500623_120745 | 3300053127 | Bacteria | 1149 |
| 697 | Ga0500642_0000652 | 3300053130 | Bacteria | 10322 |
| 698 | Ga0500652_000492 | 3300053131 | Bacteria | 13875 |
| 699 | Ga0500658_0008541 | 3300053134 | Bacteria | 3783 |
| 700 | Ga0500559_0017642 | 3300053136 | Bacteria | 3015 |
| 701 | Ga0500559_0133526 | 3300053136 | Bacteria | 1160 |
| 702 | Ga0500568_0028846 | 3300053139 | Bacteria | 2310 |
| 703 | Ga0500568_0053545 | 3300053139 | Bacteria | 1581 |
| 704 | Ga0500568_0072439 | 3300053139 | Bacteria | 1317 |
| 705 | Ga0500590_020753 | 3300053148 | Bacteria | 3410 |
| 706 | Ga0500604_0003349 | 3300053151 | Bacteria | 4309 |
| 707 | Ga0500604_0116829 | 3300053151 | Bacteria | 889 |
| 708 | Ga0500619_000180 | 3300053154 | Bacteria | 15135 |
| 709 | Ga0500622_0000202 | 3300053156 | Bacteria | 63233 |
| 710 | Ga0500622_0043686 | 3300053156 | Bacteria | 2324 |
| 711 | Ga0500622_0081863 | 3300053156 | Bacteria | 1615 |
| 712 | Ga0500634_0088639 | 3300053161 | Bacteria | 1576 |
| 713 | Ga0500636_0077845 | 3300053177 | Bacteria | 1915 |
| 714 | Ga0500645_002406 | 3300053730 | Bacteria | 8396 |
| 715 | Ga0500587_000298 | 3300053739 | Bacteria | 5554 |
| 716 | Ga0466962_0002769 | 3300061719 | Bacteria | 8328 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053085 | Ga0495619_0476371 | Ga0495619_0476371_284_844 | 182 |
| 2 | 3300037418 | Ga0395900_0572842 | Ga0395900_0572842_131_691 | 185 |
| 3 | 3300037418 | Ga0395900_0966104 | Ga0395900_0966104_35_595 | 185 |
| 4 | 3300037466 | Ga0395898_0060715 | Ga0395898_0060715_2163_2723 | 185 |
| 5 | 3300037471 | Ga0395905_0000431 | Ga0395905_0000431_52229_52789 | 185 |
| 6 | 3300037471 | Ga0395905_0017199 | Ga0395905_0017199_1852_2412 | 185 |
| 7 | 3300037471 | Ga0395905_0022443 | Ga0395905_0022443_2275_2835 | 185 |
| 8 | 3300037471 | Ga0395905_0188665 | Ga0395905_0188665_1307_1867 | 185 |
| 9 | 3300037471 | Ga0395905_0235876 | Ga0395905_0235876_838_1398 | 185 |
| 10 | 3300037471 | Ga0395905_0398234 | Ga0395905_0398234_265_825 | 185 |
| 11 | 3300044656 | Ga0466969_0109207 | Ga0466969_0109207_211_771 | 185 |
| 12 | 3300044693 | Ga0466961_0112239 | Ga0466961_0112239_83_643 | 185 |
| 13 | 3300044765 | Ga0466970_0087113 | Ga0466970_0087113_897_1457 | 185 |
| 14 | 3300045049 | Ga0466959_0015984 | Ga0466959_0015984_2435_2995 | 185 |
| 15 | 3300044683 | Ga0466965_0243806 | Ga0466965_0243806_380_946 | 186 |
| 16 | 3300044735 | Ga0466968_0314042 | Ga0466968_0314042_60_626 | 186 |
| 17 | 3300031730 | Ga0307516_10005605 | Ga0307516_100056058 | 188 |
| 18 | 3300028786 | Ga0307517_10001871 | Ga0307517_100018717 | 189 |
| 19 | 3300047472 | Ga0495686_0001297 | Ga0495686_0001297_24191_24814 | 189 |
| 20 | 3300028794 | Ga0307515_10038740 | Ga0307515_100387407 | 190 |
| 21 | 3300031456 | Ga0307513_10119691 | Ga0307513_101196914 | 190 |
| 22 | 3300036401 | Ga0373937_0075115 | Ga0373937_0075115_1135_1776 | 190 |
| 23 | 3300049822 | Ga0501035_0207821 | Ga0501035_0207821_548_1177 | 190 |
| 24 | 3300005327 | Ga0070658_10839318 | Ga0070658_108393181 | 193 |
| 25 | 3300005354 | Ga0070675_101052871 | Ga0070675_1010528711 | 193 |
| 26 | 3300005355 | Ga0070671_100398329 | Ga0070671_1003983292 | 193 |
| 27 | 3300005364 | Ga0070673_101090464 | Ga0070673_1010904641 | 193 |
| 28 | 3300013296 | Ga0157374_10561120 | Ga0157374_105611203 | 193 |
| 29 | 3300025899 | Ga0207642_10157072 | Ga0207642_101570722 | 193 |
| 30 | 3300025909 | Ga0207705_10262264 | Ga0207705_102622642 | 193 |
| 31 | 3300037471 | Ga0395905_0013446 | Ga0395905_0013446_1334_1975 | 193 |
| 32 | 3300050489 | nmdc:mga03683_358208_c1 | nmdc:mga03683_358208_c1_19_660 | 193 |
| 33 | 3300042876 | Ga0451577_0403684 | Ga0451577_0403684_122_736 | 194 |
| 34 | 3300045051 | Ga0451576_0114403 | Ga0451576_0114403_725_1339 | 194 |
| 35 | 3300005262 | Ga0065165_1003311 | Ga0065165_10033117 | 195 |
| 36 | 3300005455 | Ga0070663_100275335 | Ga0070663_1002753352 | 195 |
| 37 | 3300005543 | Ga0070672_100048996 | Ga0070672_1000489964 | 195 |
| 38 | 3300005578 | Ga0068854_100030430 | Ga0068854_1000304305 | 195 |
| 39 | 3300005843 | Ga0068860_100373451 | Ga0068860_1003734513 | 195 |
| 40 | 3300025273 | Ga0209673_1002275 | Ga0209673_100227515 | 195 |
| 41 | 3300025321 | Ga0207656_10193028 | Ga0207656_101930282 | 195 |
| 42 | 3300025926 | Ga0207659_10160710 | Ga0207659_101607102 | 195 |
| 43 | 3300025933 | Ga0207706_10242717 | Ga0207706_102427173 | 195 |
| 44 | 3300025940 | Ga0207691_10021169 | Ga0207691_100211692 | 195 |
| 45 | 3300026067 | Ga0207678_10010696 | Ga0207678_100106968 | 195 |
| 46 | 3300026095 | Ga0207676_10508889 | Ga0207676_105088891 | 195 |
| 47 | 3300026121 | Ga0207683_10118931 | Ga0207683_101189314 | 195 |
| 48 | 3300031456 | Ga0307513_10617064 | Ga0307513_106170641 | 195 |
| 49 | 3300003323 | rootH1_10029292 | rootH1_100292922 | 196 |
| 50 | 3300031649 | Ga0307514_10077945 | Ga0307514_100779451 | 197 |
| 51 | 3300005331 | Ga0070670_100101058 | Ga0070670_1001010582 | 199 |
| 52 | 3300009148 | Ga0105243_10232044 | Ga0105243_102320441 | 199 |
| 53 | 3300025925 | Ga0207650_10075499 | Ga0207650_100754993 | 199 |
| 54 | 3300027876 | Ga0209974_10132095 | Ga0209974_101320952 | 199 |
| 55 | 3300031731 | Ga0307405_10006547 | Ga0307405_100065473 | 199 |
| 56 | 3300031824 | Ga0307413_10094755 | Ga0307413_100947552 | 199 |
| 57 | 3300031852 | Ga0307410_10009817 | Ga0307410_100098175 | 199 |
| 58 | 3300031901 | Ga0307406_10034996 | Ga0307406_100349962 | 199 |
| 59 | 3300031903 | Ga0307407_10101551 | Ga0307407_101015513 | 199 |
| 60 | 3300031911 | Ga0307412_10018914 | Ga0307412_100189144 | 199 |
| 61 | 3300031995 | Ga0307409_100094217 | Ga0307409_1000942173 | 199 |
| 62 | 3300032002 | Ga0307416_100088088 | Ga0307416_1000880883 | 199 |
| 63 | 3300041406 | Ga0439439_0055533 | Ga0439439_0055533_65_667 | 199 |
| 64 | 3300050490 | nmdc:mga03n38_307349_c1 | nmdc:mga03n38_307349_c1_120_722 | 199 |
| 65 | 3300053098 | Ga0500650_0065740 | Ga0500650_0065740_140_766 | 199 |
| 66 | 3300006038 | Ga0075365_10106212 | Ga0075365_101062122 | 200 |
| 67 | 3300006048 | Ga0075363_100197021 | Ga0075363_1001970212 | 200 |
| 68 | 3300006177 | Ga0075362_10058661 | Ga0075362_100586613 | 200 |
| 69 | 3300006177 | Ga0075362_10127865 | Ga0075362_101278652 | 200 |
| 70 | 3300042532 | Ga0450893_0009216 | Ga0450893_0009216_494_1102 | 200 |
| 71 | 3300050490 | nmdc:mga03n38_326475_c1 | nmdc:mga03n38_326475_c1_193_798 | 200 |
| 72 | 3300050496 | nmdc:mga07m45_192112_c1 | nmdc:mga07m45_192112_c1_130_735 | 200 |
| 73 | 3300031507 | Ga0307509_10214130 | Ga0307509_102141303 | 201 |
| 74 | 3300041452 | Ga0451793_1038358 | Ga0451793_1038358_84_722 | 201 |
| 75 | 3300025297 | Ga0209758_1000045 | Ga0209758_1000045233 | 202 |
| 76 | 3300053161 | Ga0500634_0088639 | Ga0500634_0088639_906_1523 | 202 |
| 77 | 3300003322 | rootL2_10175725 | rootL2_101757252 | 203 |
| 78 | 3300005356 | Ga0070674_100236318 | Ga0070674_1002363183 | 203 |
| 79 | 3300005456 | Ga0070678_100938836 | Ga0070678_1009388361 | 203 |
| 80 | 3300005543 | Ga0070672_100140374 | Ga0070672_1001403742 | 203 |
| 81 | 3300005564 | Ga0070664_100706313 | Ga0070664_1007063132 | 203 |
| 82 | 3300009176 | Ga0105242_10014443 | Ga0105242_100144432 | 203 |
| 83 | 3300025934 | Ga0207686_10025578 | Ga0207686_100255785 | 203 |
| 84 | 3300025937 | Ga0207669_10074985 | Ga0207669_100749853 | 203 |
| 85 | 3300025940 | Ga0207691_10085262 | Ga0207691_100852624 | 203 |
| 86 | 3300025945 | Ga0207679_10084416 | Ga0207679_100844163 | 203 |
| 87 | 3300026121 | Ga0207683_10048071 | Ga0207683_100480715 | 203 |
| 88 | iso_pu_bacteria | 2643221654 | 2644304273 | 203 |
| 89 | 3300006178 | Ga0075367_10022479 | Ga0075367_100224794 | 204 |
| 90 | 3300006353 | Ga0075370_10032948 | Ga0075370_100329482 | 204 |
| 91 | 3300050495 | nmdc:mga04h51_40466_c1 | nmdc:mga04h51_40466_c1_463_1131 | 204 |
| 92 | iso_pu_bacteria | 2643221644 | 2644245713 | 204 |
| 93 | iso_pu_bacteria | 2643221660 | 2644338342 | 204 |
| 94 | 3300006048 | Ga0075363_100072670 | Ga0075363_1000726703 | 205 |
| 95 | 3300006178 | Ga0075367_10294385 | Ga0075367_102943852 | 205 |
| 96 | 3300028794 | Ga0307515_10000991 | Ga0307515_1000099154 | 205 |
| 97 | 3300031456 | Ga0307513_10471060 | Ga0307513_104710602 | 205 |
| 98 | 3300031730 | Ga0307516_10004946 | Ga0307516_100049469 | 205 |
| 99 | 3300041451 | Ga0451791_0680598 | Ga0451791_0680598_79_699 | 205 |
| 100 | 3300041452 | Ga0451793_1656761 | Ga0451793_1656761_76_696 | 205 |
| 101 | 3300041453 | Ga0451797_0679364 | Ga0451797_0679364_114_734 | 205 |
| 102 | 3300041486 | Ga0451807_1925146 | Ga0451807_1925146_283_903 | 205 |
| 103 | 3300041496 | Ga0451839_0531012 | Ga0451839_0531012_100_720 | 205 |
| 104 | 3300041512 | Ga0451853_1613797 | Ga0451853_1613797_803_1423 | 205 |
| 105 | 3300046512 | Ga0495610_0095059 | Ga0495610_0095059_709_1329 | 205 |
| 106 | 3300046513 | Ga0495616_0090863 | Ga0495616_0090863_637_1254 | 205 |
| 107 | 3300046519 | Ga0495632_0055676 | Ga0495632_0055676_640_1260 | 205 |
| 108 | 3300046539 | Ga0495621_0005578 | Ga0495621_0005578_1049_1681 | 205 |
| 109 | 3300046660 | Ga0495625_0022014 | Ga0495625_0022014_3278_3898 | 205 |
| 110 | 3300048927 | Ga0496124_0000317 | Ga0496124_0000317_22069_22686 | 205 |
| 111 | 3300048928 | Ga0496125_0022403 | Ga0496125_0022403_657_1274 | 205 |
| 112 | 3300050493 | nmdc:mga0k408_34475_c1 | nmdc:mga0k408_34475_c1_1934_2554 | 205 |
| 113 | 3300050493 | nmdc:mga0k408_570007_c1 | nmdc:mga0k408_570007_c1_20_640 | 205 |
| 114 | 3300053739 | Ga0500587_000298 | Ga0500587_000298_585_1205 | 205 |
| 115 | iso_pu_bacteria | 2585428057 | 2587730558 | 205 |
| 116 | iso_pu_bacteria | 2585428058 | 2587734918 | 205 |
| 117 | iso_pu_bacteria | 2588253510 | 2588293137 | 205 |
| 118 | iso_pu_bacteria | 2643221592 | 2643968359 | 205 |
| 119 | iso_pu_bacteria | 2643221625 | 2644141849 | 205 |
| 120 | iso_pu_bacteria | 2643221648 | 2644272482 | 205 |
| 121 | 3300005328 | Ga0070676_10026643 | Ga0070676_100266434 | 206 |
| 122 | 3300005353 | Ga0070669_100261286 | Ga0070669_1002612862 | 206 |
| 123 | 3300005364 | Ga0070673_100305514 | Ga0070673_1003055141 | 206 |
| 124 | 3300005367 | Ga0070667_100106214 | Ga0070667_1001062142 | 206 |
| 125 | 3300005455 | Ga0070663_100029789 | Ga0070663_1000297893 | 206 |
| 126 | 3300005543 | Ga0070672_100388970 | Ga0070672_1003889701 | 206 |
| 127 | 3300005577 | Ga0068857_100012825 | Ga0068857_1000128258 | 206 |
| 128 | 3300005578 | Ga0068854_100018059 | Ga0068854_1000180597 | 206 |
| 129 | 3300005616 | Ga0068852_100164833 | Ga0068852_1001648332 | 206 |
| 130 | 3300006048 | Ga0075363_100044589 | Ga0075363_1000445894 | 206 |
| 131 | 3300006051 | Ga0075364_10050756 | Ga0075364_100507562 | 206 |
| 132 | 3300006178 | Ga0075367_10029363 | Ga0075367_100293634 | 206 |
| 133 | 3300006353 | Ga0075370_10007921 | Ga0075370_100079217 | 206 |
| 134 | 3300006353 | Ga0075370_10204779 | Ga0075370_102047791 | 206 |
| 135 | 3300009545 | Ga0105237_10008395 | Ga0105237_100083953 | 206 |
| 136 | 3300010375 | Ga0105239_10060249 | Ga0105239_100602494 | 206 |
| 137 | 3300025903 | Ga0207680_10394355 | Ga0207680_103943552 | 206 |
| 138 | 3300025940 | Ga0207691_10172455 | Ga0207691_101724552 | 206 |
| 139 | 3300025942 | Ga0207689_10055774 | Ga0207689_100557744 | 206 |
| 140 | 3300025986 | Ga0207658_10059730 | Ga0207658_100597304 | 206 |
| 141 | 3300026067 | Ga0207678_10041360 | Ga0207678_100413603 | 206 |
| 142 | 3300026116 | Ga0207674_10022905 | Ga0207674_100229054 | 206 |
| 143 | 3300031730 | Ga0307516_10000312 | Ga0307516_100003123 | 206 |
| 144 | 3300046530 | Ga0495654_0022190 | Ga0495654_0022190_2148_2780 | 206 |
| 145 | 3300047443 | Ga0495687_000594 | Ga0495687_000594_1989_2609 | 206 |
| 146 | 3300048091 | Ga0495626_0026314 | Ga0495626_0026314_1394_2014 | 206 |
| 147 | 3300050489 | nmdc:mga03683_149396_c1 | nmdc:mga03683_149396_c1_29_649 | 206 |
| 148 | 3300050491 | nmdc:mga00v17_256147_c1 | nmdc:mga00v17_256147_c1_22_642 | 206 |
| 149 | 3300050493 | nmdc:mga0k408_41741_c1 | nmdc:mga0k408_41741_c1_808_1428 | 206 |
| 150 | 3300050496 | nmdc:mga07m45_68110_c1 | nmdc:mga07m45_68110_c1_406_1026 | 206 |
| 151 | 3300009174 | Ga0105241_10953023 | Ga0105241_109530231 | 207 |
| 152 | 3300009545 | Ga0105237_10003466 | Ga0105237_1000346619 | 207 |
| 153 | 3300009551 | Ga0105238_10007665 | Ga0105238_100076655 | 207 |
| 154 | 3300010375 | Ga0105239_10003789 | Ga0105239_100037899 | 207 |
| 155 | 3300025911 | Ga0207654_10039557 | Ga0207654_100395574 | 207 |
| 156 | 3300025913 | Ga0207695_10031173 | Ga0207695_100311735 | 207 |
| 157 | 3300025914 | Ga0207671_10005697 | Ga0207671_1000569712 | 207 |
| 158 | 3300025924 | Ga0207694_10024013 | Ga0207694_100240134 | 207 |
| 159 | 3300028381 | Ga0268264_10092858 | Ga0268264_100928583 | 207 |
| 160 | 3300028794 | Ga0307515_10001283 | Ga0307515_1000128321 | 207 |
| 161 | 3300031456 | Ga0307513_10034868 | Ga0307513_100348686 | 207 |
| 162 | 3300031649 | Ga0307514_10001840 | Ga0307514_100018406 | 207 |
| 163 | 3300048924 | Ga0496121_0026536 | Ga0496121_0026536_2226_2849 | 207 |
| 164 | 3300048927 | Ga0496124_0639209 | Ga0496124_0639209_21_644 | 207 |
| 165 | 3300048928 | Ga0496125_0199471 | Ga0496125_0199471_539_1192 | 207 |
| 166 | 3300053086 | Ga0500578_0035984 | Ga0500578_0035984_445_1077 | 207 |
| 167 | 3300053730 | Ga0500645_002406 | Ga0500645_002406_6717_7349 | 207 |
| 168 | 3300003791 | Ga0055530_10013387 | Ga0055530_100133873 | 208 |
| 169 | 3300003792 | Ga0055540_1000002 | Ga0055540_1000002249 | 208 |
| 170 | 3300003794 | Ga0055531_10004641 | Ga0055531_100046415 | 208 |
| 171 | 3300005328 | Ga0070676_10014725 | Ga0070676_100147255 | 208 |
| 172 | 3300005334 | Ga0068869_100013561 | Ga0068869_1000135616 | 208 |
| 173 | 3300005338 | Ga0068868_100097025 | Ga0068868_1000970253 | 208 |
| 174 | 3300005344 | Ga0070661_100290663 | Ga0070661_1002906631 | 208 |
| 175 | 3300005354 | Ga0070675_100005184 | Ga0070675_1000051848 | 208 |
| 176 | 3300005355 | Ga0070671_100081753 | Ga0070671_1000817533 | 208 |
| 177 | 3300005364 | Ga0070673_100261577 | Ga0070673_1002615773 | 208 |
| 178 | 3300005367 | Ga0070667_100089205 | Ga0070667_1000892053 | 208 |
| 179 | 3300005367 | Ga0070667_100990802 | Ga0070667_1009908021 | 208 |
| 180 | 3300005457 | Ga0070662_100032584 | Ga0070662_1000325842 | 208 |
| 181 | 3300005459 | Ga0068867_100002841 | Ga0068867_10000284115 | 208 |
| 182 | 3300005459 | Ga0068867_100146767 | Ga0068867_1001467673 | 208 |
| 183 | 3300005543 | Ga0070672_100010713 | Ga0070672_1000107134 | 208 |
| 184 | 3300005577 | Ga0068857_100025437 | Ga0068857_1000254373 | 208 |
| 185 | 3300005614 | Ga0068856_100059001 | Ga0068856_1000590015 | 208 |
| 186 | 3300005834 | Ga0068851_10397291 | Ga0068851_103972912 | 208 |
| 187 | 3300005840 | Ga0068870_10042666 | Ga0068870_100426663 | 208 |
| 188 | 3300005841 | Ga0068863_100292604 | Ga0068863_1002926043 | 208 |
| 189 | 3300006042 | Ga0075368_10064592 | Ga0075368_100645922 | 208 |
| 190 | 3300006177 | Ga0075362_10305949 | Ga0075362_103059492 | 208 |
| 191 | 3300006195 | Ga0075366_10042422 | Ga0075366_100424223 | 208 |
| 192 | 3300006237 | Ga0097621_100439860 | Ga0097621_1004398602 | 208 |
| 193 | 3300006353 | Ga0075370_10038650 | Ga0075370_100386503 | 208 |
| 194 | 3300006353 | Ga0075370_10125572 | Ga0075370_101255722 | 208 |
| 195 | 3300006946 | Ga0079104_1000017 | Ga0079104_1000017204 | 208 |
| 196 | 3300009098 | Ga0105245_10256066 | Ga0105245_102560662 | 208 |
| 197 | 3300009148 | Ga0105243_10187471 | Ga0105243_101874713 | 208 |
| 198 | 3300009545 | Ga0105237_10157249 | Ga0105237_101572492 | 208 |
| 199 | 3300013105 | Ga0157369_10660417 | Ga0157369_106604172 | 208 |
| 200 | 3300013297 | Ga0157378_10078498 | Ga0157378_100784982 | 208 |
| 201 | 3300014325 | Ga0163163_10510020 | Ga0163163_105100202 | 208 |
| 202 | 3300014745 | Ga0157377_10068176 | Ga0157377_100681762 | 208 |
| 203 | 3300014969 | Ga0157376_10361085 | Ga0157376_103610853 | 208 |
| 204 | 3300025273 | Ga0209673_1051328 | Ga0209673_10513282 | 208 |
| 205 | 3300025291 | Ga0209675_1006935 | Ga0209675_10069353 | 208 |
| 206 | 3300025298 | Ga0209050_1000457 | Ga0209050_100045779 | 208 |
| 207 | 3300025298 | Ga0209050_1022563 | Ga0209050_10225633 | 208 |
| 208 | 3300025299 | Ga0209256_1000011 | Ga0209256_1000011639 | 208 |
| 209 | 3300025303 | Ga0209051_1000024 | Ga0209051_1000024250 | 208 |
| 210 | 3300025304 | Ga0209257_1000079 | Ga0209257_1000079250 | 208 |
| 211 | 3300025907 | Ga0207645_10012119 | Ga0207645_100121195 | 208 |
| 212 | 3300025908 | Ga0207643_10057915 | Ga0207643_100579153 | 208 |
| 213 | 3300025919 | Ga0207657_10034678 | Ga0207657_100346783 | 208 |
| 214 | 3300025926 | Ga0207659_10006295 | Ga0207659_100062958 | 208 |
| 215 | 3300025927 | Ga0207687_10053973 | Ga0207687_100539733 | 208 |
| 216 | 3300025931 | Ga0207644_10042428 | Ga0207644_100424284 | 208 |
| 217 | 3300025933 | Ga0207706_10113749 | Ga0207706_101137492 | 208 |
| 218 | 3300025940 | Ga0207691_10007915 | Ga0207691_100079157 | 208 |
| 219 | 3300025960 | Ga0207651_10006687 | Ga0207651_100066873 | 208 |
| 220 | 3300025981 | Ga0207640_10714845 | Ga0207640_107148452 | 208 |
| 221 | 3300026023 | Ga0207677_10219121 | Ga0207677_102191213 | 208 |
| 222 | 3300026078 | Ga0207702_10241988 | Ga0207702_102419883 | 208 |
| 223 | 3300026089 | Ga0207648_10010781 | Ga0207648_100107818 | 208 |
| 224 | 3300026089 | Ga0207648_10052175 | Ga0207648_100521754 | 208 |
| 225 | 3300026116 | Ga0207674_10008218 | Ga0207674_100082186 | 208 |
| 226 | 3300026142 | Ga0207698_10280502 | Ga0207698_102805021 | 208 |
| 227 | 3300027111 | Ga0209281_1000042 | Ga0209281_1000042145 | 208 |
| 228 | 3300027866 | Ga0209813_10064684 | Ga0209813_100646842 | 208 |
| 229 | 3300028786 | Ga0307517_10080650 | Ga0307517_100806502 | 208 |
| 230 | 3300028794 | Ga0307515_10064124 | Ga0307515_100641243 | 208 |
| 231 | 3300028794 | Ga0307515_10252323 | Ga0307515_102523232 | 208 |
| 232 | 3300030522 | Ga0307512_10113458 | Ga0307512_101134583 | 208 |
| 233 | 3300031456 | Ga0307513_10116867 | Ga0307513_101168673 | 208 |
| 234 | 3300031507 | Ga0307509_10000041 | Ga0307509_10000041157 | 208 |
| 235 | 3300031507 | Ga0307509_10025279 | Ga0307509_100252795 | 208 |
| 236 | 3300031507 | Ga0307509_10030443 | Ga0307509_100304436 | 208 |
| 237 | 3300031507 | Ga0307509_10064009 | Ga0307509_100640094 | 208 |
| 238 | 3300031507 | Ga0307509_10139159 | Ga0307509_101391592 | 208 |
| 239 | 3300031616 | Ga0307508_10000227 | Ga0307508_1000022724 | 208 |
| 240 | 3300031616 | Ga0307508_10038562 | Ga0307508_100385623 | 208 |
| 241 | 3300031649 | Ga0307514_10100606 | Ga0307514_101006063 | 208 |
| 242 | 3300031730 | Ga0307516_10350336 | Ga0307516_103503362 | 208 |
| 243 | 3300033179 | Ga0307507_10040065 | Ga0307507_100400653 | 208 |
| 244 | 3300033180 | Ga0307510_10020701 | Ga0307510_100207018 | 208 |
| 245 | 3300033180 | Ga0307510_10026627 | Ga0307510_100266275 | 208 |
| 246 | 3300033180 | Ga0307510_10100095 | Ga0307510_101000953 | 208 |
| 247 | 3300033180 | Ga0307510_10105002 | Ga0307510_101050023 | 208 |
| 248 | 3300035691 | Ga0373931_0033207 | Ga0373931_0033207_480_1106 | 208 |
| 249 | 3300042121 | Ga0450919_000514 | Ga0450919_000514_3738_4367 | 208 |
| 250 | 3300042531 | Ga0450918_000377 | Ga0450918_000377_8411_9040 | 208 |
| 251 | 3300046454 | Ga0495592_0000028 | Ga0495592_0000028_56282_56908 | 208 |
| 252 | 3300046460 | Ga0495638_0235906 | Ga0495638_0235906_141_767 | 208 |
| 253 | 3300046512 | Ga0495610_0053593 | Ga0495610_0053593_439_1065 | 208 |
| 254 | 3300046514 | Ga0495618_0192528 | Ga0495618_0192528_131_757 | 208 |
| 255 | 3300046515 | Ga0495620_0059119 | Ga0495620_0059119_190_816 | 208 |
| 256 | 3300046516 | Ga0495628_0380886 | Ga0495628_0380886_272_898 | 208 |
| 257 | 3300046517 | Ga0495630_0047998 | Ga0495630_0047998_2101_2727 | 208 |
| 258 | 3300046519 | Ga0495632_0179215 | Ga0495632_0179215_276_902 | 208 |
| 259 | 3300046526 | Ga0495666_0036781 | Ga0495666_0036781_1029_1655 | 208 |
| 260 | 3300046557 | Ga0495622_0242412 | Ga0495622_0242412_71_697 | 208 |
| 261 | 3300046660 | Ga0495625_0156033 | Ga0495625_0156033_538_1164 | 208 |
| 262 | 3300046680 | Ga0495646_0084859 | Ga0495646_0084859_838_1464 | 208 |
| 263 | 3300046690 | Ga0495624_0053869 | Ga0495624_0053869_636_1262 | 208 |
| 264 | 3300046692 | Ga0495671_0133351 | Ga0495671_0133351_228_878 | 208 |
| 265 | 3300047673 | Ga0495593_0029380 | Ga0495593_0029380_843_1469 | 208 |
| 266 | 3300048917 | Ga0496114_0013197 | Ga0496114_0013197_5058_5687 | 208 |
| 267 | 3300049682 | Ga0501252_007397 | Ga0501252_007397_323_952 | 208 |
| 268 | 3300050493 | nmdc:mga0k408_106001_c1 | nmdc:mga0k408_106001_c1_761_1387 | 208 |
| 269 | 3300050493 | nmdc:mga0k408_161057_c1 | nmdc:mga0k408_161057_c1_375_1001 | 208 |
| 270 | 3300050493 | nmdc:mga0k408_25980_c1 | nmdc:mga0k408_25980_c1_2562_3188 | 208 |
| 271 | 3300050496 | nmdc:mga07m45_219578_c1 | nmdc:mga07m45_219578_c1_383_1009 | 208 |
| 272 | 3300050496 | nmdc:mga07m45_408656_c1 | nmdc:mga07m45_408656_c1_50_676 | 208 |
| 273 | 3300050496 | nmdc:mga07m45_436225_c1 | nmdc:mga07m45_436225_c1_116_742 | 208 |
| 274 | 3300053088 | Ga0500644_0055142 | Ga0500644_0055142_400_1026 | 208 |
| 275 | 3300053091 | Ga0500647_0056143 | Ga0500647_0056143_485_1111 | 208 |
| 276 | 3300053093 | Ga0500651_0079698 | Ga0500651_0079698_899_1525 | 208 |
| 277 | 3300053093 | Ga0500651_0389613 | Ga0500651_0389613_16_642 | 208 |
| 278 | 3300053121 | Ga0500607_115033 | Ga0500607_115033_167_793 | 208 |
| 279 | 3300053136 | Ga0500559_0017642 | Ga0500559_0017642_1255_1881 | 208 |
| 280 | 3300053139 | Ga0500568_0072439 | Ga0500568_0072439_266_892 | 208 |
| 281 | 3300053148 | Ga0500590_020753 | Ga0500590_020753_1340_1966 | 208 |
| 282 | 3300053156 | Ga0500622_0043686 | Ga0500622_0043686_441_1067 | 208 |
| 283 | 3300053177 | Ga0500636_0077845 | Ga0500636_0077845_72_698 | 208 |
| 284 | 3300003323 | rootH1_10012451 | rootH1_100124513 | 209 |
| 285 | 3300003791 | Ga0055530_10011329 | Ga0055530_100113294 | 209 |
| 286 | 3300005328 | Ga0070676_10009865 | Ga0070676_100098654 | 209 |
| 287 | 3300005329 | Ga0070683_100186750 | Ga0070683_1001867502 | 209 |
| 288 | 3300005330 | Ga0070690_100123156 | Ga0070690_1001231563 | 209 |
| 289 | 3300005331 | Ga0070670_100001820 | Ga0070670_1000018205 | 209 |
| 290 | 3300005331 | Ga0070670_100415891 | Ga0070670_1004158912 | 209 |
| 291 | 3300005333 | Ga0070677_10009375 | Ga0070677_100093754 | 209 |
| 292 | 3300005333 | Ga0070677_10027675 | Ga0070677_100276753 | 209 |
| 293 | 3300005334 | Ga0068869_100004621 | Ga0068869_1000046218 | 209 |
| 294 | 3300005335 | Ga0070666_10041643 | Ga0070666_100416433 | 209 |
| 295 | 3300005338 | Ga0068868_100146793 | Ga0068868_1001467933 | 209 |
| 296 | 3300005338 | Ga0068868_100334934 | Ga0068868_1003349343 | 209 |
| 297 | 3300005340 | Ga0070689_100175586 | Ga0070689_1001755863 | 209 |
| 298 | 3300005340 | Ga0070689_100896337 | Ga0070689_1008963371 | 209 |
| 299 | 3300005343 | Ga0070687_100014736 | Ga0070687_1000147364 | 209 |
| 300 | 3300005347 | Ga0070668_100009291 | Ga0070668_1000092915 | 209 |
| 301 | 3300005353 | Ga0070669_100066477 | Ga0070669_1000664773 | 209 |
| 302 | 3300005354 | Ga0070675_100028715 | Ga0070675_1000287155 | 209 |
| 303 | 3300005355 | Ga0070671_100357690 | Ga0070671_1003576903 | 209 |
| 304 | 3300005355 | Ga0070671_100674958 | Ga0070671_1006749581 | 209 |
| 305 | 3300005356 | Ga0070674_100069521 | Ga0070674_1000695213 | 209 |
| 306 | 3300005356 | Ga0070674_100263727 | Ga0070674_1002637272 | 209 |
| 307 | 3300005364 | Ga0070673_100413928 | Ga0070673_1004139281 | 209 |
| 308 | 3300005364 | Ga0070673_100762403 | Ga0070673_1007624032 | 209 |
| 309 | 3300005367 | Ga0070667_100003010 | Ga0070667_1000030105 | 209 |
| 310 | 3300005367 | Ga0070667_100432808 | Ga0070667_1004328081 | 209 |
| 311 | 3300005456 | Ga0070678_100477514 | Ga0070678_1004775141 | 209 |
| 312 | 3300005456 | Ga0070678_100621406 | Ga0070678_1006214062 | 209 |
| 313 | 3300005456 | Ga0070678_100711885 | Ga0070678_1007118851 | 209 |
| 314 | 3300005457 | Ga0070662_100010471 | Ga0070662_1000104715 | 209 |
| 315 | 3300005457 | Ga0070662_100813706 | Ga0070662_1008137061 | 209 |
| 316 | 3300005459 | Ga0068867_100052489 | Ga0068867_1000524894 | 209 |
| 317 | 3300005459 | Ga0068867_100105376 | Ga0068867_1001053764 | 209 |
| 318 | 3300005530 | Ga0070679_100194436 | Ga0070679_1001944363 | 209 |
| 319 | 3300005543 | Ga0070672_100003281 | Ga0070672_1000032812 | 209 |
| 320 | 3300005543 | Ga0070672_100282596 | Ga0070672_1002825962 | 209 |
| 321 | 3300005547 | Ga0070693_100079779 | Ga0070693_1000797793 | 209 |
| 322 | 3300005548 | Ga0070665_100191214 | Ga0070665_1001912143 | 209 |
| 323 | 3300005564 | Ga0070664_100104728 | Ga0070664_1001047282 | 209 |
| 324 | 3300005616 | Ga0068852_100070012 | Ga0068852_1000700122 | 209 |
| 325 | 3300005616 | Ga0068852_101136915 | Ga0068852_1011369152 | 209 |
| 326 | 3300005617 | Ga0068859_100012962 | Ga0068859_1000129628 | 209 |
| 327 | 3300005617 | Ga0068859_100078982 | Ga0068859_1000789824 | 209 |
| 328 | 3300005618 | Ga0068864_100110843 | Ga0068864_1001108433 | 209 |
| 329 | 3300005618 | Ga0068864_100201786 | Ga0068864_1002017862 | 209 |
| 330 | 3300005718 | Ga0068866_10007367 | Ga0068866_100073674 | 209 |
| 331 | 3300005719 | Ga0068861_100040775 | Ga0068861_1000407754 | 209 |
| 332 | 3300005840 | Ga0068870_10041700 | Ga0068870_100417003 | 209 |
| 333 | 3300005841 | Ga0068863_100004608 | Ga0068863_10000460812 | 209 |
| 334 | 3300005841 | Ga0068863_100131899 | Ga0068863_1001318993 | 209 |
| 335 | 3300005841 | Ga0068863_100486275 | Ga0068863_1004862752 | 209 |
| 336 | 3300005842 | Ga0068858_100001760 | Ga0068858_1000017603 | 209 |
| 337 | 3300005842 | Ga0068858_100104820 | Ga0068858_1001048202 | 209 |
| 338 | 3300005843 | Ga0068860_100001433 | Ga0068860_1000014335 | 209 |
| 339 | 3300005844 | Ga0068862_100036314 | Ga0068862_1000363143 | 209 |
| 340 | 3300006028 | Ga0070717_10873321 | Ga0070717_108733212 | 209 |
| 341 | 3300006048 | Ga0075363_100084357 | Ga0075363_1000843572 | 209 |
| 342 | 3300006195 | Ga0075366_10023472 | Ga0075366_100234722 | 209 |
| 343 | 3300006237 | Ga0097621_100894581 | Ga0097621_1008945812 | 209 |
| 344 | 3300006353 | Ga0075370_10011666 | Ga0075370_100116664 | 209 |
| 345 | 3300006358 | Ga0068871_100195663 | Ga0068871_1001956633 | 209 |
| 346 | 3300006881 | Ga0068865_100010127 | Ga0068865_1000101277 | 209 |
| 347 | 3300006931 | Ga0097620_100012962 | Ga0097620_1000129628 | 209 |
| 348 | 3300006931 | Ga0097620_100078978 | Ga0097620_1000789784 | 209 |
| 349 | 3300009098 | Ga0105245_10048773 | Ga0105245_100487735 | 209 |
| 350 | 3300009148 | Ga0105243_10049442 | Ga0105243_100494422 | 209 |
| 351 | 3300009176 | Ga0105242_10204457 | Ga0105242_102044571 | 209 |
| 352 | 3300009177 | Ga0105248_10180017 | Ga0105248_101800172 | 209 |
| 353 | 3300009553 | Ga0105249_10009522 | Ga0105249_100095228 | 209 |
| 354 | 3300013102 | Ga0157371_10031263 | Ga0157371_100312633 | 209 |
| 355 | 3300013297 | Ga0157378_10044989 | Ga0157378_100449895 | 209 |
| 356 | 3300013297 | Ga0157378_10271274 | Ga0157378_102712742 | 209 |
| 357 | 3300013306 | Ga0163162_10060587 | Ga0163162_100605875 | 209 |
| 358 | 3300013306 | Ga0163162_10166173 | Ga0163162_101661733 | 209 |
| 359 | 3300013306 | Ga0163162_10194073 | Ga0163162_101940733 | 209 |
| 360 | 3300013308 | Ga0157375_10003544 | Ga0157375_1000354412 | 209 |
| 361 | 3300013308 | Ga0157375_10031329 | Ga0157375_100313295 | 209 |
| 362 | 3300014325 | Ga0163163_10179958 | Ga0163163_101799583 | 209 |
| 363 | 3300014326 | Ga0157380_10318490 | Ga0157380_103184902 | 209 |
| 364 | 3300014968 | Ga0157379_10031728 | Ga0157379_100317285 | 209 |
| 365 | 3300017792 | Ga0163161_10031938 | Ga0163161_100319382 | 209 |
| 366 | 3300021361 | Ga0213872_10042754 | Ga0213872_100427542 | 209 |
| 367 | 3300025298 | Ga0209050_1000247 | Ga0209050_100024786 | 209 |
| 368 | 3300025303 | Ga0209051_1002674 | Ga0209051_10026747 | 209 |
| 369 | 3300025303 | Ga0209051_1018049 | Ga0209051_10180492 | 209 |
| 370 | 3300025315 | Ga0207697_10017238 | Ga0207697_100172384 | 209 |
| 371 | 3300025893 | Ga0207682_10033070 | Ga0207682_100330703 | 209 |
| 372 | 3300025893 | Ga0207682_10049175 | Ga0207682_100491752 | 209 |
| 373 | 3300025899 | Ga0207642_10030161 | Ga0207642_100301614 | 209 |
| 374 | 3300025903 | Ga0207680_10110209 | Ga0207680_101102093 | 209 |
| 375 | 3300025907 | Ga0207645_10003743 | Ga0207645_1000374310 | 209 |
| 376 | 3300025908 | Ga0207643_10068631 | Ga0207643_100686313 | 209 |
| 377 | 3300025918 | Ga0207662_10005052 | Ga0207662_100050523 | 209 |
| 378 | 3300025920 | Ga0207649_10183643 | Ga0207649_101836432 | 209 |
| 379 | 3300025923 | Ga0207681_10037586 | Ga0207681_100375864 | 209 |
| 380 | 3300025925 | Ga0207650_10009009 | Ga0207650_100090095 | 209 |
| 381 | 3300025925 | Ga0207650_10332674 | Ga0207650_103326742 | 209 |
| 382 | 3300025926 | Ga0207659_10041441 | Ga0207659_100414414 | 209 |
| 383 | 3300025926 | Ga0207659_10253830 | Ga0207659_102538302 | 209 |
| 384 | 3300025933 | Ga0207706_10031191 | Ga0207706_100311915 | 209 |
| 385 | 3300025935 | Ga0207709_10021922 | Ga0207709_100219223 | 209 |
| 386 | 3300025935 | Ga0207709_10394828 | Ga0207709_103948283 | 209 |
| 387 | 3300025936 | Ga0207670_10188582 | Ga0207670_101885822 | 209 |
| 388 | 3300025937 | Ga0207669_10066497 | Ga0207669_100664973 | 209 |
| 389 | 3300025937 | Ga0207669_10115988 | Ga0207669_101159883 | 209 |
| 390 | 3300025937 | Ga0207669_10132696 | Ga0207669_101326961 | 209 |
| 391 | 3300025938 | Ga0207704_10008558 | Ga0207704_100085583 | 209 |
| 392 | 3300025940 | Ga0207691_10038362 | Ga0207691_100383622 | 209 |
| 393 | 3300025940 | Ga0207691_10082658 | Ga0207691_100826582 | 209 |
| 394 | 3300025940 | Ga0207691_10531419 | Ga0207691_105314192 | 209 |
| 395 | 3300025940 | Ga0207691_10821458 | Ga0207691_108214581 | 209 |
| 396 | 3300025941 | Ga0207711_10077302 | Ga0207711_100773023 | 209 |
| 397 | 3300025941 | Ga0207711_10297657 | Ga0207711_102976572 | 209 |
| 398 | 3300025942 | Ga0207689_10011178 | Ga0207689_100111785 | 209 |
| 399 | 3300025944 | Ga0207661_10130483 | Ga0207661_101304833 | 209 |
| 400 | 3300025945 | Ga0207679_10171165 | Ga0207679_101711652 | 209 |
| 401 | 3300025961 | Ga0207712_10005181 | Ga0207712_100051813 | 209 |
| 402 | 3300025972 | Ga0207668_10092840 | Ga0207668_100928403 | 209 |
| 403 | 3300025986 | Ga0207658_10009082 | Ga0207658_100090825 | 209 |
| 404 | 3300026023 | Ga0207677_10133104 | Ga0207677_101331043 | 209 |
| 405 | 3300026035 | Ga0207703_10001350 | Ga0207703_100013505 | 209 |
| 406 | 3300026088 | Ga0207641_10009363 | Ga0207641_100093635 | 209 |
| 407 | 3300026088 | Ga0207641_10069885 | Ga0207641_100698852 | 209 |
| 408 | 3300026088 | Ga0207641_10323964 | Ga0207641_103239642 | 209 |
| 409 | 3300026089 | Ga0207648_10033465 | Ga0207648_100334655 | 209 |
| 410 | 3300026089 | Ga0207648_10054667 | Ga0207648_100546671 | 209 |
| 411 | 3300026118 | Ga0207675_100075512 | Ga0207675_1000755123 | 209 |
| 412 | 3300026121 | Ga0207683_10011765 | Ga0207683_100117659 | 209 |
| 413 | 3300026142 | Ga0207698_10036460 | Ga0207698_100364604 | 209 |
| 414 | 3300026142 | Ga0207698_11003022 | Ga0207698_110030222 | 209 |
| 415 | 3300028379 | Ga0268266_10490045 | Ga0268266_104900453 | 209 |
| 416 | 3300028380 | Ga0268265_10058350 | Ga0268265_100583503 | 209 |
| 417 | 3300028381 | Ga0268264_10004852 | Ga0268264_100048528 | 209 |
| 418 | 3300028381 | Ga0268264_10258278 | Ga0268264_102582783 | 209 |
| 419 | 3300028786 | Ga0307517_10091945 | Ga0307517_100919453 | 209 |
| 420 | 3300028786 | Ga0307517_10229954 | Ga0307517_102299542 | 209 |
| 421 | 3300031730 | Ga0307516_10000497 | Ga0307516_1000049732 | 209 |
| 422 | 3300032002 | Ga0307416_100158615 | Ga0307416_1001586153 | 209 |
| 423 | 3300035117 | Ga0373953_0051288 | Ga0373953_0051288_802_1443 | 209 |
| 424 | 3300035410 | Ga0373924_0062125 | Ga0373924_0062125_381_1022 | 209 |
| 425 | 3300035692 | Ga0373935_0224379 | Ga0373935_0224379_54_695 | 209 |
| 426 | 3300035695 | Ga0373927_0266747 | Ga0373927_0266747_414_1055 | 209 |
| 427 | 3300035724 | Ga0373933_0332096 | Ga0373933_0332096_204_845 | 209 |
| 428 | 3300036401 | Ga0373937_0134894 | Ga0373937_0134894_1548_2189 | 209 |
| 429 | 3300037471 | Ga0395905_0016819 | Ga0395905_0016819_3176_3805 | 209 |
| 430 | 3300039447 | Ga0436361_0537689 | Ga0436361_0537689_117_773 | 209 |
| 431 | 3300039447 | Ga0436361_0552361 | Ga0436361_0552361_1578_2234 | 209 |
| 432 | 3300041443 | Ga0451789_0966433 | Ga0451789_0966433_100_729 | 209 |
| 433 | 3300041452 | Ga0451793_0607649 | Ga0451793_0607649_311_940 | 209 |
| 434 | 3300044706 | Ga0466964_0002777 | Ga0466964_0002777_878_1546 | 209 |
| 435 | 3300044719 | Ga0466971_0015449 | Ga0466971_0015449_2127_2795 | 209 |
| 436 | 3300046460 | Ga0495638_0054568 | Ga0495638_0054568_477_1106 | 209 |
| 437 | 3300046539 | Ga0495621_0157671 | Ga0495621_0157671_112_753 | 209 |
| 438 | 3300046539 | Ga0495621_0198156 | Ga0495621_0198156_114_746 | 209 |
| 439 | 3300046542 | Ga0495597_0108459 | Ga0495597_0108459_483_1112 | 209 |
| 440 | 3300046543 | Ga0495645_0067784 | Ga0495645_0067784_158_799 | 209 |
| 441 | 3300046660 | Ga0495625_0453014 | Ga0495625_0453014_84_713 | 209 |
| 442 | 3300046663 | Ga0495635_0563347 | Ga0495635_0563347_62_703 | 209 |
| 443 | 3300046683 | Ga0495658_0129338 | Ga0495658_0129338_633_1274 | 209 |
| 444 | 3300047319 | Ga0495674_0278914 | Ga0495674_0278914_111_752 | 209 |
| 445 | 3300047471 | Ga0495684_0339469 | Ga0495684_0339469_292_933 | 209 |
| 446 | 3300049515 | Ga0501292_010355 | Ga0501292_010355_89_718 | 209 |
| 447 | 3300050490 | nmdc:mga03n38_72335_c1 | nmdc:mga03n38_72335_c1_625_1254 | 209 |
| 448 | 3300050493 | nmdc:mga0k408_66956_c1 | nmdc:mga0k408_66956_c1_81_710 | 209 |
| 449 | 3300050496 | nmdc:mga07m45_9585_c1 | nmdc:mga07m45_9585_c1_3013_3642 | 209 |
| 450 | 3300053078 | Ga0495612_0257763 | Ga0495612_0257763_29_667 | 209 |
| 451 | 3300053086 | Ga0500578_0000282 | Ga0500578_0000282_55905_56534 | 209 |
| 452 | 3300053090 | Ga0500646_0001831 | Ga0500646_0001831_504_1133 | 209 |
| 453 | 3300053093 | Ga0500651_0013178 | Ga0500651_0013178_1044_1673 | 209 |
| 454 | 3300053098 | Ga0500650_0139505 | Ga0500650_0139505_479_1108 | 209 |
| 455 | 3300053109 | Ga0500569_023259 | Ga0500569_023259_804_1433 | 209 |
| 456 | 3300053127 | Ga0500623_120745 | Ga0500623_120745_53_682 | 209 |
| 457 | 3300053130 | Ga0500642_0000652 | Ga0500642_0000652_256_885 | 209 |
| 458 | 3300053131 | Ga0500652_000492 | Ga0500652_000492_9448_10077 | 209 |
| 459 | 3300053136 | Ga0500559_0133526 | Ga0500559_0133526_268_897 | 209 |
| 460 | 3300053139 | Ga0500568_0053545 | Ga0500568_0053545_73_702 | 209 |
| 461 | 3300053151 | Ga0500604_0003349 | Ga0500604_0003349_1042_1671 | 209 |
| 462 | 3300053151 | Ga0500604_0116829 | Ga0500604_0116829_145_774 | 209 |
| 463 | 3300053154 | Ga0500619_000180 | Ga0500619_000180_1170_1799 | 209 |
| 464 | 3300053156 | Ga0500622_0000202 | Ga0500622_0000202_32935_33564 | 209 |
| 465 | 3300053156 | Ga0500622_0081863 | Ga0500622_0081863_83_712 | 209 |
| 466 | 3300061719 | Ga0466962_0002769 | Ga0466962_0002769_3071_3739 | 209 |
| 467 | 3300002773 | JGI25152J39213_1001709 | JGI25152J39213_10017098 | 210 |
| 468 | 3300002773 | JGI25152J39213_1002886 | JGI25152J39213_10028864 | 210 |
| 469 | 3300003215 | JGI25153J46596_10029375 | JGI25153J46596_100293753 | 210 |
| 470 | 3300003771 | Ga0055526_1004651 | Ga0055526_10046516 | 210 |
| 471 | 3300005328 | Ga0070676_10013248 | Ga0070676_100132483 | 210 |
| 472 | 3300005328 | Ga0070676_10109878 | Ga0070676_101098782 | 210 |
| 473 | 3300005328 | Ga0070676_10380063 | Ga0070676_103800632 | 210 |
| 474 | 3300005331 | Ga0070670_100016116 | Ga0070670_1000161163 | 210 |
| 475 | 3300005331 | Ga0070670_100097990 | Ga0070670_1000979903 | 210 |
| 476 | 3300005333 | Ga0070677_10001548 | Ga0070677_100015485 | 210 |
| 477 | 3300005333 | Ga0070677_10037333 | Ga0070677_100373333 | 210 |
| 478 | 3300005334 | Ga0068869_100027665 | Ga0068869_1000276653 | 210 |
| 479 | 3300005334 | Ga0068869_100227886 | Ga0068869_1002278863 | 210 |
| 480 | 3300005338 | Ga0068868_100081103 | Ga0068868_1000811033 | 210 |
| 481 | 3300005340 | Ga0070689_100034512 | Ga0070689_1000345121 | 210 |
| 482 | 3300005344 | Ga0070661_100621432 | Ga0070661_1006214321 | 210 |
| 483 | 3300005347 | Ga0070668_100004953 | Ga0070668_1000049539 | 210 |
| 484 | 3300005347 | Ga0070668_100386909 | Ga0070668_1003869092 | 210 |
| 485 | 3300005353 | Ga0070669_100006105 | Ga0070669_1000061053 | 210 |
| 486 | 3300005353 | Ga0070669_100025041 | Ga0070669_1000250415 | 210 |
| 487 | 3300005354 | Ga0070675_100001535 | Ga0070675_10000153516 | 210 |
| 488 | 3300005355 | Ga0070671_100021133 | Ga0070671_1000211334 | 210 |
| 489 | 3300005355 | Ga0070671_100040868 | Ga0070671_1000408683 | 210 |
| 490 | 3300005356 | Ga0070674_100008300 | Ga0070674_1000083004 | 210 |
| 491 | 3300005356 | Ga0070674_100030634 | Ga0070674_1000306343 | 210 |
| 492 | 3300005364 | Ga0070673_100005136 | Ga0070673_1000051363 | 210 |
| 493 | 3300005364 | Ga0070673_100008629 | Ga0070673_1000086299 | 210 |
| 494 | 3300005364 | Ga0070673_100072711 | Ga0070673_1000727112 | 210 |
| 495 | 3300005364 | Ga0070673_100234991 | Ga0070673_1002349912 | 210 |
| 496 | 3300005365 | Ga0070688_100068326 | Ga0070688_1000683263 | 210 |
| 497 | 3300005367 | Ga0070667_100001171 | Ga0070667_1000011716 | 210 |
| 498 | 3300005367 | Ga0070667_100043049 | Ga0070667_1000430494 | 210 |
| 499 | 3300005367 | Ga0070667_100419924 | Ga0070667_1004199241 | 210 |
| 500 | 3300005455 | Ga0070663_100415337 | Ga0070663_1004153372 | 210 |
| 501 | 3300005456 | Ga0070678_100001334 | Ga0070678_1000013349 | 210 |
| 502 | 3300005456 | Ga0070678_100009607 | Ga0070678_1000096073 | 210 |
| 503 | 3300005456 | Ga0070678_100096522 | Ga0070678_1000965224 | 210 |
| 504 | 3300005457 | Ga0070662_100034601 | Ga0070662_1000346015 | 210 |
| 505 | 3300005459 | Ga0068867_100002971 | Ga0068867_1000029716 | 210 |
| 506 | 3300005459 | Ga0068867_100032757 | Ga0068867_1000327573 | 210 |
| 507 | 3300005459 | Ga0068867_100042848 | Ga0068867_1000428482 | 210 |
| 508 | 3300005459 | Ga0068867_100139769 | Ga0068867_1001397692 | 210 |
| 509 | 3300005467 | Ga0070706_100000670 | Ga0070706_1000006703 | 210 |
| 510 | 3300005468 | Ga0070707_100557157 | Ga0070707_1005571572 | 210 |
| 511 | 3300005518 | Ga0070699_100224034 | Ga0070699_1002240341 | 210 |
| 512 | 3300005543 | Ga0070672_100002062 | Ga0070672_1000020628 | 210 |
| 513 | 3300005543 | Ga0070672_100023394 | Ga0070672_1000233944 | 210 |
| 514 | 3300005543 | Ga0070672_100042983 | Ga0070672_1000429833 | 210 |
| 515 | 3300005543 | Ga0070672_100062465 | Ga0070672_1000624653 | 210 |
| 516 | 3300005543 | Ga0070672_100205866 | Ga0070672_1002058663 | 210 |
| 517 | 3300005543 | Ga0070672_100272832 | Ga0070672_1002728322 | 210 |
| 518 | 3300005544 | Ga0070686_100789242 | Ga0070686_1007892421 | 210 |
| 519 | 3300005548 | Ga0070665_100471710 | Ga0070665_1004717101 | 210 |
| 520 | 3300005578 | Ga0068854_100143833 | Ga0068854_1001438333 | 210 |
| 521 | 3300005616 | Ga0068852_100601482 | Ga0068852_1006014823 | 210 |
| 522 | 3300005617 | Ga0068859_100002636 | Ga0068859_1000026365 | 210 |
| 523 | 3300005618 | Ga0068864_100020879 | Ga0068864_1000208794 | 210 |
| 524 | 3300005618 | Ga0068864_100045556 | Ga0068864_1000455563 | 210 |
| 525 | 3300005618 | Ga0068864_100525333 | Ga0068864_1005253332 | 210 |
| 526 | 3300005718 | Ga0068866_10119073 | Ga0068866_101190732 | 210 |
| 527 | 3300005719 | Ga0068861_100063998 | Ga0068861_1000639983 | 210 |
| 528 | 3300005834 | Ga0068851_10104658 | Ga0068851_101046582 | 210 |
| 529 | 3300005841 | Ga0068863_100147201 | Ga0068863_1001472013 | 210 |
| 530 | 3300005841 | Ga0068863_100376200 | Ga0068863_1003762002 | 210 |
| 531 | 3300005841 | Ga0068863_100654072 | Ga0068863_1006540722 | 210 |
| 532 | 3300005842 | Ga0068858_100054908 | Ga0068858_1000549084 | 210 |
| 533 | 3300005843 | Ga0068860_100299585 | Ga0068860_1002995852 | 210 |
| 534 | 3300005843 | Ga0068860_100536719 | Ga0068860_1005367192 | 210 |
| 535 | 3300005844 | Ga0068862_100025669 | Ga0068862_1000256695 | 210 |
| 536 | 3300006042 | Ga0075368_10024067 | Ga0075368_100240673 | 210 |
| 537 | 3300006186 | Ga0075369_10010341 | Ga0075369_100103413 | 210 |
| 538 | 3300006195 | Ga0075366_10013799 | Ga0075366_100137993 | 210 |
| 539 | 3300006195 | Ga0075366_10034429 | Ga0075366_100344293 | 210 |
| 540 | 3300006195 | Ga0075366_10059108 | Ga0075366_100591083 | 210 |
| 541 | 3300006195 | Ga0075366_10189916 | Ga0075366_101899162 | 210 |
| 542 | 3300006195 | Ga0075366_10334354 | Ga0075366_103343542 | 210 |
| 543 | 3300006237 | Ga0097621_100020890 | Ga0097621_1000208903 | 210 |
| 544 | 3300006237 | Ga0097621_100067657 | Ga0097621_1000676574 | 210 |
| 545 | 3300006237 | Ga0097621_100083076 | Ga0097621_1000830763 | 210 |
| 546 | 3300006237 | Ga0097621_100325218 | Ga0097621_1003252182 | 210 |
| 547 | 3300006353 | Ga0075370_10001743 | Ga0075370_100017433 | 210 |
| 548 | 3300006353 | Ga0075370_10152705 | Ga0075370_101527053 | 210 |
| 549 | 3300006358 | Ga0068871_100005010 | Ga0068871_1000050103 | 210 |
| 550 | 3300006358 | Ga0068871_100040812 | Ga0068871_1000408122 | 210 |
| 551 | 3300006358 | Ga0068871_100137399 | Ga0068871_1001373991 | 210 |
| 552 | 3300006358 | Ga0068871_100141677 | Ga0068871_1001416772 | 210 |
| 553 | 3300006881 | Ga0068865_100036259 | Ga0068865_1000362593 | 210 |
| 554 | 3300006931 | Ga0097620_100002636 | Ga0097620_1000026365 | 210 |
| 555 | 3300009098 | Ga0105245_10122662 | Ga0105245_101226623 | 210 |
| 556 | 3300009148 | Ga0105243_10082533 | Ga0105243_100825334 | 210 |
| 557 | 3300009177 | Ga0105248_10138031 | Ga0105248_101380313 | 210 |
| 558 | 3300009551 | Ga0105238_10824318 | Ga0105238_108243182 | 210 |
| 559 | 3300009553 | Ga0105249_10052686 | Ga0105249_100526864 | 210 |
| 560 | 3300013296 | Ga0157374_10121407 | Ga0157374_101214073 | 210 |
| 561 | 3300013296 | Ga0157374_10641785 | Ga0157374_106417852 | 210 |
| 562 | 3300013306 | Ga0163162_10028472 | Ga0163162_100284725 | 210 |
| 563 | 3300013306 | Ga0163162_10052435 | Ga0163162_100524354 | 210 |
| 564 | 3300013308 | Ga0157375_10039345 | Ga0157375_100393455 | 210 |
| 565 | 3300013308 | Ga0157375_10056327 | Ga0157375_100563273 | 210 |
| 566 | 3300013308 | Ga0157375_10135933 | Ga0157375_101359333 | 210 |
| 567 | 3300013308 | Ga0157375_10237311 | Ga0157375_102373113 | 210 |
| 568 | 3300013308 | Ga0157375_11266767 | Ga0157375_112667672 | 210 |
| 569 | 3300014325 | Ga0163163_10083873 | Ga0163163_100838734 | 210 |
| 570 | 3300014326 | Ga0157380_10102647 | Ga0157380_101026473 | 210 |
| 571 | 3300014326 | Ga0157380_10556477 | Ga0157380_105564772 | 210 |
| 572 | 3300014968 | Ga0157379_10013894 | Ga0157379_100138945 | 210 |
| 573 | 3300014969 | Ga0157376_10051337 | Ga0157376_100513374 | 210 |
| 574 | 3300014969 | Ga0157376_10327596 | Ga0157376_103275963 | 210 |
| 575 | 3300017792 | Ga0163161_10049540 | Ga0163161_100495403 | 210 |
| 576 | 3300017792 | Ga0163161_10051865 | Ga0163161_100518654 | 210 |
| 577 | 3300025245 | Ga0207425_1000131 | Ga0207425_100013126 | 210 |
| 578 | 3300025258 | Ga0209129_1000075 | Ga0209129_100007574 | 210 |
| 579 | 3300025295 | Ga0209564_1000046 | Ga0209564_1000046238 | 210 |
| 580 | 3300025297 | Ga0209758_1000052 | Ga0209758_1000052225 | 210 |
| 581 | 3300025299 | Ga0209256_1013851 | Ga0209256_10138514 | 210 |
| 582 | 3300025299 | Ga0209256_1064149 | Ga0209256_10641492 | 210 |
| 583 | 3300025304 | Ga0209257_1030582 | Ga0209257_10305821 | 210 |
| 584 | 3300025321 | Ga0207656_10111072 | Ga0207656_101110722 | 210 |
| 585 | 3300025893 | Ga0207682_10001523 | Ga0207682_100015238 | 210 |
| 586 | 3300025893 | Ga0207682_10027272 | Ga0207682_100272722 | 210 |
| 587 | 3300025893 | Ga0207682_10063659 | Ga0207682_100636592 | 210 |
| 588 | 3300025899 | Ga0207642_10018235 | Ga0207642_100182354 | 210 |
| 589 | 3300025899 | Ga0207642_10051757 | Ga0207642_100517572 | 210 |
| 590 | 3300025903 | Ga0207680_10325724 | Ga0207680_103257242 | 210 |
| 591 | 3300025907 | Ga0207645_10008686 | Ga0207645_100086862 | 210 |
| 592 | 3300025908 | Ga0207643_10049838 | Ga0207643_100498383 | 210 |
| 593 | 3300025909 | Ga0207705_10534207 | Ga0207705_105342072 | 210 |
| 594 | 3300025910 | Ga0207684_10068094 | Ga0207684_100680943 | 210 |
| 595 | 3300025920 | Ga0207649_10549080 | Ga0207649_105490802 | 210 |
| 596 | 3300025922 | Ga0207646_10771870 | Ga0207646_107718701 | 210 |
| 597 | 3300025923 | Ga0207681_10018380 | Ga0207681_100183805 | 210 |
| 598 | 3300025923 | Ga0207681_10049977 | Ga0207681_100499773 | 210 |
| 599 | 3300025923 | Ga0207681_10409725 | Ga0207681_104097252 | 210 |
| 600 | 3300025925 | Ga0207650_10002460 | Ga0207650_100024606 | 210 |
| 601 | 3300025925 | Ga0207650_10285723 | Ga0207650_102857232 | 210 |
| 602 | 3300025925 | Ga0207650_10469996 | Ga0207650_104699962 | 210 |
| 603 | 3300025926 | Ga0207659_10064026 | Ga0207659_100640264 | 210 |
| 604 | 3300025927 | Ga0207687_10075296 | Ga0207687_100752963 | 210 |
| 605 | 3300025931 | Ga0207644_10016645 | Ga0207644_100166452 | 210 |
| 606 | 3300025931 | Ga0207644_10020354 | Ga0207644_100203544 | 210 |
| 607 | 3300025931 | Ga0207644_10049561 | Ga0207644_100495615 | 210 |
| 608 | 3300025931 | Ga0207644_10219693 | Ga0207644_102196932 | 210 |
| 609 | 3300025931 | Ga0207644_10308767 | Ga0207644_103087671 | 210 |
| 610 | 3300025936 | Ga0207670_10035459 | Ga0207670_100354593 | 210 |
| 611 | 3300025937 | Ga0207669_10014898 | Ga0207669_100148983 | 210 |
| 612 | 3300025937 | Ga0207669_10158269 | Ga0207669_101582691 | 210 |
| 613 | 3300025938 | Ga0207704_10027482 | Ga0207704_100274823 | 210 |
| 614 | 3300025940 | Ga0207691_10001741 | Ga0207691_1000174118 | 210 |
| 615 | 3300025940 | Ga0207691_10006082 | Ga0207691_100060826 | 210 |
| 616 | 3300025940 | Ga0207691_10045325 | Ga0207691_100453254 | 210 |
| 617 | 3300025940 | Ga0207691_10106713 | Ga0207691_101067132 | 210 |
| 618 | 3300025940 | Ga0207691_10157816 | Ga0207691_101578163 | 210 |
| 619 | 3300025942 | Ga0207689_10014824 | Ga0207689_100148245 | 210 |
| 620 | 3300025942 | Ga0207689_10315909 | Ga0207689_103159092 | 210 |
| 621 | 3300025945 | Ga0207679_10274408 | Ga0207679_102744083 | 210 |
| 622 | 3300025960 | Ga0207651_10037495 | Ga0207651_100374953 | 210 |
| 623 | 3300025960 | Ga0207651_10155760 | Ga0207651_101557602 | 210 |
| 624 | 3300025960 | Ga0207651_10275512 | Ga0207651_102755122 | 210 |
| 625 | 3300025960 | Ga0207651_10770105 | Ga0207651_107701051 | 210 |
| 626 | 3300025961 | Ga0207712_10076222 | Ga0207712_100762223 | 210 |
| 627 | 3300025972 | Ga0207668_10033305 | Ga0207668_100333053 | 210 |
| 628 | 3300025981 | Ga0207640_10451546 | Ga0207640_104515462 | 210 |
| 629 | 3300025986 | Ga0207658_10000959 | Ga0207658_100009596 | 210 |
| 630 | 3300025986 | Ga0207658_10034313 | Ga0207658_100343134 | 210 |
| 631 | 3300025986 | Ga0207658_10087064 | Ga0207658_100870643 | 210 |
| 632 | 3300025986 | Ga0207658_10314803 | Ga0207658_103148032 | 210 |
| 633 | 3300026023 | Ga0207677_10072104 | Ga0207677_100721043 | 210 |
| 634 | 3300026023 | Ga0207677_10092228 | Ga0207677_100922283 | 210 |
| 635 | 3300026035 | Ga0207703_10206014 | Ga0207703_102060143 | 210 |
| 636 | 3300026088 | Ga0207641_10049902 | Ga0207641_100499022 | 210 |
| 637 | 3300026088 | Ga0207641_10112479 | Ga0207641_101124793 | 210 |
| 638 | 3300026088 | Ga0207641_10918976 | Ga0207641_109189762 | 210 |
| 639 | 3300026089 | Ga0207648_10002848 | Ga0207648_100028483 | 210 |
| 640 | 3300026089 | Ga0207648_10038606 | Ga0207648_100386062 | 210 |
| 641 | 3300026089 | Ga0207648_10097960 | Ga0207648_100979603 | 210 |
| 642 | 3300026089 | Ga0207648_10105316 | Ga0207648_101053163 | 210 |
| 643 | 3300026095 | Ga0207676_10015099 | Ga0207676_100150996 | 210 |
| 644 | 3300026095 | Ga0207676_10026111 | Ga0207676_100261112 | 210 |
| 645 | 3300026095 | Ga0207676_10026609 | Ga0207676_100266095 | 210 |
| 646 | 3300026118 | Ga0207675_100025434 | Ga0207675_1000254343 | 210 |
| 647 | 3300026118 | Ga0207675_101167756 | Ga0207675_1011677561 | 210 |
| 648 | 3300026121 | Ga0207683_10006663 | Ga0207683_100066638 | 210 |
| 649 | 3300026121 | Ga0207683_10013159 | Ga0207683_100131598 | 210 |
| 650 | 3300026121 | Ga0207683_10052477 | Ga0207683_100524773 | 210 |
| 651 | 3300026121 | Ga0207683_10084334 | Ga0207683_100843344 | 210 |
| 652 | 3300026121 | Ga0207683_10176541 | Ga0207683_101765412 | 210 |
| 653 | 3300026121 | Ga0207683_10188520 | Ga0207683_101885203 | 210 |
| 654 | 3300026142 | Ga0207698_10461291 | Ga0207698_104612913 | 210 |
| 655 | 3300028379 | Ga0268266_10722222 | Ga0268266_107222222 | 210 |
| 656 | 3300028380 | Ga0268265_10756346 | Ga0268265_107563462 | 210 |
| 657 | 3300028381 | Ga0268264_10238395 | Ga0268264_102383952 | 210 |
| 658 | 3300028794 | Ga0307515_10336081 | Ga0307515_103360812 | 210 |
| 659 | 3300028794 | Ga0307515_10477683 | Ga0307515_104776832 | 210 |
| 660 | 3300031456 | Ga0307513_10168930 | Ga0307513_101689303 | 210 |
| 661 | 3300031456 | Ga0307513_10236591 | Ga0307513_102365912 | 210 |
| 662 | 3300031995 | Ga0307409_100255757 | Ga0307409_1002557573 | 210 |
| 663 | 3300032005 | Ga0307411_10048663 | Ga0307411_100486631 | 210 |
| 664 | 3300035170 | Ga0373943_0031464 | Ga0373943_0031464_1829_2473 | 210 |
| 665 | 3300035725 | Ga0373947_0028227 | Ga0373947_0028227_1284_1925 | 210 |
| 666 | 3300036401 | Ga0373937_0028691 | Ga0373937_0028691_3902_4543 | 210 |
| 667 | 3300041492 | Ga0451835_1076998 | Ga0451835_1076998_40_672 | 210 |
| 668 | 3300041507 | Ga0451851_0230368 | Ga0451851_0230368_15_656 | 210 |
| 669 | 3300042115 | Ga0450911_003584 | Ga0450911_003584_1052_1699 | 210 |
| 670 | 3300042438 | Ga0439459_0015933 | Ga0439459_0015933_441_1079 | 210 |
| 671 | 3300042876 | Ga0451577_0356691 | Ga0451577_0356691_363_998 | 210 |
| 672 | 3300044712 | Ga0453684_0703456 | Ga0453684_0703456_43_678 | 210 |
| 673 | 3300046457 | Ga0495590_0007405 | Ga0495590_0007405_233_865 | 210 |
| 674 | 3300046459 | Ga0495629_0069203 | Ga0495629_0069203_1326_1967 | 210 |
| 675 | 3300046516 | Ga0495628_0528178 | Ga0495628_0528178_75_716 | 210 |
| 676 | 3300046519 | Ga0495632_0007745 | Ga0495632_0007745_628_1260 | 210 |
| 677 | 3300046539 | Ga0495621_0054314 | Ga0495621_0054314_676_1323 | 210 |
| 678 | 3300046539 | Ga0495621_0066745 | Ga0495621_0066745_467_1111 | 210 |
| 679 | 3300046543 | Ga0495645_0156318 | Ga0495645_0156318_367_1008 | 210 |
| 680 | 3300046543 | Ga0495645_0425101 | Ga0495645_0425101_63_704 | 210 |
| 681 | 3300046660 | Ga0495625_0019171 | Ga0495625_0019171_4365_4997 | 210 |
| 682 | 3300046681 | Ga0495647_0216216 | Ga0495647_0216216_58_705 | 210 |
| 683 | 3300046683 | Ga0495658_0145588 | Ga0495658_0145588_430_1074 | 210 |
| 684 | 3300046689 | Ga0495613_0219569 | Ga0495613_0219569_370_1011 | 210 |
| 685 | 3300046694 | Ga0495649_0004724 | Ga0495649_0004724_988_1620 | 210 |
| 686 | 3300046810 | Ga0495660_0105785 | Ga0495660_0105785_273_905 | 210 |
| 687 | 3300047443 | Ga0495687_005079 | Ga0495687_005079_7231_7863 | 210 |
| 688 | 3300047443 | Ga0495687_006945 | Ga0495687_006945_4324_4956 | 210 |
| 689 | 3300047471 | Ga0495684_0138480 | Ga0495684_0138480_576_1217 | 210 |
| 690 | 3300048907 | Ga0496104_0272846 | Ga0496104_0272846_846_1493 | 210 |
| 691 | 3300048908 | Ga0496105_0272040 | Ga0496105_0272040_434_1081 | 210 |
| 692 | 3300048909 | Ga0496106_0351541 | Ga0496106_0351541_76_723 | 210 |
| 693 | 3300048911 | Ga0496108_0273204 | Ga0496108_0273204_271_912 | 210 |
| 694 | 3300048912 | Ga0496109_0128519 | Ga0496109_0128519_222_869 | 210 |
| 695 | 3300048913 | Ga0496110_0235992 | Ga0496110_0235992_579_1220 | 210 |
| 696 | 3300048924 | Ga0496121_0018535 | Ga0496121_0018535_5203_5850 | 210 |
| 697 | 3300048927 | Ga0496124_0136939 | Ga0496124_0136939_562_1209 | 210 |
| 698 | 3300048928 | Ga0496125_0060586 | Ga0496125_0060586_1182_1829 | 210 |
| 699 | 3300048928 | Ga0496125_0080252 | Ga0496125_0080252_906_1553 | 210 |
| 700 | 3300048928 | Ga0496125_0145801 | Ga0496125_0145801_578_1225 | 210 |
| 701 | 3300049460 | Ga0495682_0079819 | Ga0495682_0079819_399_1031 | 210 |
| 702 | 3300049579 | Ga0501043_0000004 | Ga0501043_0000004_149879_150532 | 210 |
| 703 | 3300049580 | Ga0501046_0000016 | Ga0501046_0000016_141304_141957 | 210 |
| 704 | 3300049581 | Ga0501047_0000012 | Ga0501047_0000012_140984_141637 | 210 |
| 705 | 3300049582 | Ga0501048_0035397 | Ga0501048_0035397_796_1449 | 210 |
| 706 | 3300049824 | Ga0501045_0192075 | Ga0501045_0192075_683_1336 | 210 |
| 707 | 3300050489 | nmdc:mga03683_9019_c1 | nmdc:mga03683_9019_c1_773_1405 | 210 |
| 708 | 3300050492 | nmdc:mga0yw44_47259_c1 | nmdc:mga0yw44_47259_c1_1385_2017 | 210 |
| 709 | 3300050493 | nmdc:mga0k408_14932_c1 | nmdc:mga0k408_14932_c1_750_1415 | 210 |
| 710 | 3300050493 | nmdc:mga0k408_24186_c1 | nmdc:mga0k408_24186_c1_1607_2242 | 210 |
| 711 | 3300050493 | nmdc:mga0k408_83039_c1 | nmdc:mga0k408_83039_c1_834_1466 | 210 |
| 712 | 3300050493 | nmdc:mga0k408_8818_c1 | nmdc:mga0k408_8818_c1_1264_1896 | 210 |
| 713 | 3300050493 | nmdc:mga0k408_9344_c1 | nmdc:mga0k408_9344_c1_968_1600 | 210 |
| 714 | 3300050494 | nmdc:mga06z11_110420_c1 | nmdc:mga06z11_110420_c1_615_1277 | 210 |
| 715 | 3300050494 | nmdc:mga06z11_123658_c1 | nmdc:mga06z11_123658_c1_484_1116 | 210 |
| 716 | 3300050494 | nmdc:mga06z11_248091_c1 | nmdc:mga06z11_248091_c1_10_642 | 210 |
| 717 | 3300050495 | nmdc:mga04h51_70965_c1 | nmdc:mga04h51_70965_c1_10_642 | 210 |
| 718 | 3300050496 | nmdc:mga07m45_167580_c1 | nmdc:mga07m45_167580_c1_359_1015 | 210 |
| 719 | 3300050496 | nmdc:mga07m45_2993_c2 | nmdc:mga07m45_2993_c2_828_1460 | 210 |
| 720 | 3300050496 | nmdc:mga07m45_35470_c1 | nmdc:mga07m45_35470_c1_1205_1870 | 210 |
| 721 | 3300050516 | nmdc:mga0sz30_3098_c1 | nmdc:mga0sz30_3098_c1_4557_5189 | 210 |
| 722 | 3300053077 | Ga0495601_0299709 | Ga0495601_0299709_47_688 | 210 |
| 723 | 3300053084 | Ga0495595_0089668 | Ga0495595_0089668_222_863 | 210 |
| 724 | 3300053134 | Ga0500658_0008541 | Ga0500658_0008541_2078_2710 | 210 |
| 725 | 3300053139 | Ga0500568_0028846 | Ga0500568_0028846_1253_1885 | 210 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4qtn-assembly1.cif.gz_B | crystal structure of the vitamin b3 transporter pnuc | 0.8279 | 25 | 205 |
| 4qtn-assembly1.cif.gz_B | crystal structure of the vitamin b3 transporter pnuc | 0.7184 | 25 | 205 |
| 2chp-assembly1.cif.gz_A | crystal structure of the dodecameric ferritin mrga from b. subtilis 168 | 0.4633 | 111 | 204 |
| 3t9j-assembly1.cif.gz_A-4 | crystal structure hp-nap from strain ys39 in apo form | 0.4549 | 113 | 205 |
| 3t9j-assembly1.cif.gz_A-2 | crystal structure hp-nap from strain ys39 in apo form | 0.4549 | 113 | 205 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_D3ZYP5_7_123_1.20.120.550 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.5512 | 108 | 196 | 1.20.120.550 |
| af_Q54UQ6_235_311_1.20.1280.20 | Mainly Alpha;Up-down Bundle;Monooxygenase;HscB, C-terminal domain | 0.5421 | 105 | 204 | 1.20.1280.20 |
| af_E1JH38_1_134_1.20.140.150 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; | 0.528 | 110 | 205 | 1.20.140.150 |
| af_Q54K44_8_93_1.20.1280.290 | Mainly Alpha;Up-down Bundle;Monooxygenase; | 0.5184 | 109 | 203 | 1.20.1280.290 |
| af_Q9VUN8_10_99_1.20.1280.290 | Mainly Alpha;Up-down Bundle;Monooxygenase; | 0.5153 | 107 | 210 | 1.20.1280.290 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-J2KBV2-F1-model_v4 | Nicotinamide riboside transporter PnuC | 0.991 | 6 | 207 |
GO:0005886
GO:0034257 |
| AF-A0A257JKJ3-F1-model_v4 | Nicotinamide riboside transporter PnuC | 0.9873 | 1 | 205 |
GO:0005886
GO:0034257 |
| AF-A0A4R1ZLJ2-F1-model_v4 | deleted | 0.9743 | 17 | 209 |
|
| AF-A2SJR4-F1-model_v4 | Nicotinamide riboside transporter PnuC | 0.9597 | 2 | 205 |
GO:0005886
GO:0034257 |
| AF-A0A257JKJ3-F1-model_v4 | Nicotinamide riboside transporter PnuC | 0.9595 | 1 | 205 |
GO:0005886
GO:0034257 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar