F477502

General Info

Members Datasets Scaffolds Average Seq Length
723 251 723 116

Family's Representative Sequence

Representative Sequence 3300035083|Ga0373926_0093766|Ga0373926_0093766_441_821
Length 126
Sequence MAPIKTGRTSVMAEYLILIYEDENGYATASPDVFQEVMEAHNRFAQQVGEKGGKLVAGNALQPTPTATTIRGDVVTDGPFTETKEALGGYYLIDARDLDHALDIAKLCPARFGGVEVRPIMVFSGG

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
48 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
85 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
120 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
121 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
122 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
123 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
124 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
125 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
126 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
127 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
128 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
131 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
132 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
133 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
134 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
135 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
136 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
137 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
138 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
139 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
140 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
141 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
142 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
143 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
144 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
145 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
146 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
147 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
148 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
149 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
150 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
151 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
152 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
153 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
154 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
155 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
156 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
157 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
158 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
159 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
160 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
161 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
162 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
163 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
166 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
167 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
168 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
169 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
170 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
171 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
172 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
173 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
174 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
175 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
176 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
177 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
178 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
179 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
180 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
181 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
182 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
183 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
184 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
185 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
186 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
187 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
188 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
189 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
190 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
191 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
192 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
193 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
194 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
195 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
196 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
197 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
198 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
199 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
200 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
201 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
202 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
203 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
204 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
205 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
206 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
207 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
208 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
209 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
210 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
211 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
212 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
213 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
214 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
215 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
216 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
217 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
218 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
219 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
220 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
221 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
222 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
223 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
224 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
225 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
226 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
227 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
228 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
229 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
230 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
231 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
232 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
233 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
234 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
235 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
236 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
237 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
238 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
239 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
240 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
241 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
242 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
243 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
244 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
245 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
246 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
247 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
248 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
249 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
250 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.34
Metatranscriptomes 1.66
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.84
Rhizosphere 94.47
Stem 0
Stem Tuber 0
Unclassified 0.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10086014 3300003320 Bacteria 1173
2 JGI25404J52841_10125491 3300003659 Bacteria 542
3 JGI25405J52794_10055132 3300003911 Bacteria 855
4 Ga0070658_11106343 3300005327 Bacteria 689
5 Ga0070683_100245599 3300005329 Bacteria 1703
6 Ga0070683_100707568 3300005329 Bacteria 965
7 Ga0070683_102303702 3300005329 Bacteria 517
8 Ga0070690_101571269 3300005330 Bacteria 533
9 Ga0070680_101723863 3300005336 Bacteria 543
10 Ga0070682_100019730 3300005337 Bacteria 3959
11 Ga0070682_100236652 3300005337 Bacteria 1309
12 Ga0070682_100962965 3300005337 Bacteria 706
13 Ga0068868_100075382 3300005338 Bacteria 2696
14 Ga0070691_10820756 3300005341 Bacteria 568
15 Ga0070661_100528424 3300005344 Bacteria 947
16 Ga0070661_101635115 3300005344 Bacteria 545
17 Ga0070673_101145027 3300005364 Bacteria 728
18 Ga0070709_10000823 3300005434 Bacteria 17323
19 Ga0070709_10024826 3300005434 Bacteria 3533
20 Ga0070709_10697497 3300005434 Bacteria 790
21 Ga0070714_100007188 3300005435 Bacteria 8642
22 Ga0070714_100014979 3300005435 Bacteria 6233
23 Ga0070714_100024330 3300005435 Bacteria 4984
24 Ga0070714_100109759 3300005435 Bacteria 2441
25 Ga0070714_100172340 3300005435 Bacteria 1964
26 Ga0070714_100182476 3300005435 Bacteria 1910
27 Ga0070714_100387957 3300005435 Bacteria 1318
28 Ga0070714_100837634 3300005435 Bacteria 892
29 Ga0070713_100007037 3300005436 Bacteria 7856
30 Ga0070713_100053922 3300005436 Bacteria 3333
31 Ga0070713_100068078 3300005436 Bacteria 3000
32 Ga0070713_100253649 3300005436 Bacteria 1605
33 Ga0070713_100282000 3300005436 Bacteria 1524
34 Ga0070713_100718572 3300005436 Bacteria 954
35 Ga0070713_100931741 3300005436 Bacteria 836
36 Ga0070710_10000868 3300005437 Bacteria 14460
37 Ga0070710_10022871 3300005437 Bacteria 3277
38 Ga0070710_10172496 3300005437 Bacteria 1348
39 Ga0070710_10355030 3300005437 Bacteria 971
40 Ga0070711_100011851 3300005439 Bacteria 5426
41 Ga0070711_100229955 3300005439 Bacteria 1445
42 Ga0070711_100309635 3300005439 Bacteria 1258
43 Ga0070711_100313195 3300005439 Bacteria 1252
44 Ga0070711_100626758 3300005439 Bacteria 899
45 Ga0070705_100074927 3300005440 Bacteria 2059
46 Ga0070694_100501618 3300005444 Bacteria 966
47 Ga0070708_100005821 3300005445 Bacteria 9785
48 Ga0070708_100117021 3300005445 Bacteria 2454
49 Ga0070708_101077309 3300005445 Bacteria 753
50 Ga0070663_100539351 3300005455 Bacteria 974
51 Ga0070678_100374655 3300005456 Bacteria 1230
52 Ga0070678_100489332 3300005456 Bacteria 1084
53 Ga0070678_100832249 3300005456 Bacteria 840
54 Ga0070681_10139426 3300005458 Bacteria 2355
55 Ga0070681_10622424 3300005458 Bacteria 994
56 Ga0070681_11977776 3300005458 Bacteria 511
57 Ga0068867_101176139 3300005459 Bacteria 703
58 Ga0070706_100002492 3300005467 Bacteria 18546
59 Ga0070706_100008070 3300005467 Bacteria 9822
60 Ga0070706_100011680 3300005467 Bacteria 8154
61 Ga0070706_100264192 3300005467 Bacteria 1606
62 Ga0070707_100000199 3300005468 Bacteria 60047
63 Ga0070707_100005322 3300005468 Bacteria 12043
64 Ga0070707_100069704 3300005468 Bacteria 3386
65 Ga0070707_100147984 3300005468 Bacteria 2286
66 Ga0070698_100000264 3300005471 Bacteria 52985
67 Ga0070698_100009166 3300005471 Bacteria 10623
68 Ga0070698_100124972 3300005471 Bacteria 2530
69 Ga0070698_100501578 3300005471 Bacteria 1151
70 Ga0070698_101064597 3300005471 Bacteria 757
71 Ga0070699_100144100 3300005518 Bacteria 2105
72 Ga0070699_101815849 3300005518 Bacteria 558
73 Ga0070679_100989066 3300005530 Bacteria 785
74 Ga0070679_101197011 3300005530 Bacteria 705
75 Ga0070679_101972476 3300005530 Bacteria 533
76 Ga0070684_100210725 3300005535 Bacteria 1771
77 Ga0070684_100421866 3300005535 Bacteria 1231
78 Ga0070697_100064922 3300005536 Bacteria 2982
79 Ga0070697_101218939 3300005536 Bacteria 671
80 Ga0070686_101022406 3300005544 Bacteria 679
81 Ga0070695_100803350 3300005545 Bacteria 754
82 Ga0070665_100020355 3300005548 Bacteria 6664
83 Ga0070665_100391780 3300005548 Bacteria 1397
84 Ga0070665_100643874 3300005548 Bacteria 1073
85 Ga0070704_100724648 3300005549 Bacteria 884
86 Ga0068855_100290727 3300005563 Bacteria 1812
87 Ga0068857_100322602 3300005577 Bacteria 1427
88 Ga0068856_100008925 3300005614 Bacteria 9751
89 Ga0068856_100027025 3300005614 Bacteria 5598
90 Ga0068856_100568478 3300005614 Bacteria 1155
91 Ga0068856_101458274 3300005614 Bacteria 698
92 Ga0070702_101434120 3300005615 Bacteria 566
93 Ga0068864_100142029 3300005618 Bacteria 2167
94 Ga0068863_100264671 3300005841 Bacteria 1663
95 Ga0068863_101330103 3300005841 Bacteria 726
96 Ga0068860_101830214 3300005843 Bacteria 629
97 Ga0068862_100561491 3300005844 Bacteria 1091
98 Ga0081455_10003996 3300005937 Bacteria 16742
99 Ga0081455_10258179 3300005937 Bacteria 1270
100 Ga0081540_1002480 3300005983 Bacteria 15030
101 Ga0081540_1152629 3300005983 Bacteria 909
102 Ga0070717_10016987 3300006028 Bacteria 5652
103 Ga0070717_10038389 3300006028 Bacteria 3892
104 Ga0070717_10084850 3300006028 Bacteria 2664
105 Ga0070717_10161866 3300006028 Bacteria 1942
106 Ga0070717_10174068 3300006028 Bacteria 1873
107 Ga0070717_10216055 3300006028 Bacteria 1684
108 Ga0070717_10707240 3300006028 Bacteria 915
109 Ga0070717_11074894 3300006028 Bacteria 733
110 Ga0070715_10001553 3300006163 Bacteria 6725
111 Ga0070715_10085323 3300006163 Bacteria 1442
112 Ga0070715_10277807 3300006163 Bacteria 887
113 Ga0070716_100003243 3300006173 Bacteria 7639
114 Ga0070716_100011703 3300006173 Bacteria 4422
115 Ga0070716_100088472 3300006173 Bacteria 1868
116 Ga0070716_100745331 3300006173 Bacteria 753
117 Ga0070712_100017503 3300006175 Bacteria 4640
118 Ga0070712_100024410 3300006175 Bacteria 4006
119 Ga0070712_100095396 3300006175 Bacteria 2188
120 Ga0097621_101367322 3300006237 Bacteria 670
121 Ga0075428_100260354 3300006844 Bacteria 1868
122 Ga0075431_100274473 3300006847 Bacteria 1708
123 Ga0075433_10256953 3300006852 Bacteria 1549
124 Ga0075434_100007491 3300006871 Bacteria 10099
125 Ga0075429_100003605 3300006880 Bacteria 13196
126 Ga0075436_100020302 3300006914 Bacteria 4560
127 Ga0075436_100313677 3300006914 Bacteria 1126
128 Ga0075436_100519349 3300006914 Bacteria 872
129 Ga0075435_100041630 3300007076 Bacteria 3673
130 Ga0075435_100163400 3300007076 Bacteria 1876
131 Ga0075435_100712075 3300007076 Bacteria 873
132 Ga0075435_101401104 3300007076 Bacteria 613
133 Ga0105251_10287464 3300009011 Bacteria 744
134 Ga0105240_11906369 3300009093 Bacteria 618
135 Ga0111539_10026492 3300009094 Bacteria 7087
136 Ga0105245_10016540 3300009098 Bacteria 6436
137 Ga0105245_11401781 3300009098 Bacteria 749
138 Ga0105245_12613750 3300009098 Bacteria 558
139 Ga0105247_10417442 3300009101 Bacteria 960
140 Ga0105247_10556569 3300009101 Bacteria 844
141 Ga0114129_10010771 3300009147 Bacteria 13031
142 Ga0114129_10018645 3300009147 Bacteria 9879
143 Ga0105241_10356832 3300009174 Bacteria 1271
144 Ga0105248_10119398 3300009177 Bacteria 2974
145 Ga0105248_11845621 3300009177 Bacteria 686
146 Ga0105237_10493119 3300009545 Bacteria 1231
147 Ga0105249_10780429 3300009553 Bacteria 1019
148 Ga0099796_10136017 3300010159 Bacteria 957
149 Ga0105239_10197953 3300010375 Bacteria 2250
150 Ga0105239_10258711 3300010375 Bacteria 1956
151 Ga0105239_11010799 3300010375 Bacteria 956
152 Ga0105239_12460734 3300010375 Bacteria 607
153 Ga0157370_10032973 3300013104 Bacteria 5052
154 Ga0157369_10039515 3300013105 Bacteria 5155
155 Ga0157374_10231720 3300013296 Bacteria 1814
156 Ga0157378_10207852 3300013297 Bacteria 1855
157 Ga0157378_10264984 3300013297 Bacteria 1650
158 Ga0157378_12573878 3300013297 Bacteria 561
159 Ga0163162_10260785 3300013306 Bacteria 1865
160 Ga0157372_11795945 3300013307 Bacteria 705
161 Ga0157372_12948521 3300013307 Bacteria 544
162 Ga0157375_10054315 3300013308 Bacteria 3945
163 Ga0163163_10047123 3300014325 Bacteria 4236
164 Ga0163163_10416366 3300014325 Bacteria 1402
165 Ga0157379_10132107 3300014968 Bacteria 2247
166 Ga0157376_10095146 3300014969 Bacteria 2590
167 Ga0157376_11204371 3300014969 Bacteria 785
168 Ga0163161_10188456 3300017792 Bacteria 1584
169 Ga0197907_10771707 3300020069 Bacteria 3419
170 Ga0206356_11619378 3300020070 Bacteria 1010
171 Ga0206349_1809199 3300020075 Bacteria 545
172 Ga0206355_1176711 3300020076 Bacteria 710
173 Ga0206355_1286002 3300020076 Bacteria 787
174 Ga0206350_11052987 3300020080 Bacteria 1061
175 Ga0206354_10046509 3300020081 Bacteria 812
176 Ga0206353_10146695 3300020082 Bacteria 1016
177 Ga0224712_10039731 3300022467 Bacteria 1766
178 Ga0224712_10410895 3300022467 Bacteria 646
179 Ga0224712_10621598 3300022467 Bacteria 528
180 Ga0207692_10002632 3300025898 Bacteria 6904
181 Ga0207692_10026757 3300025898 Bacteria 2709
182 Ga0207692_10071464 3300025898 Bacteria 1830
183 Ga0207692_10122656 3300025898 Bacteria 1457
184 Ga0207692_10548622 3300025898 Bacteria 738
185 Ga0207710_10257972 3300025900 Bacteria 873
186 Ga0207685_10003617 3300025905 Bacteria 3789
187 Ga0207685_10004266 3300025905 Bacteria 3609
188 Ga0207685_10017784 3300025905 Bacteria 2308
189 Ga0207699_10000458 3300025906 Bacteria 20841
190 Ga0207699_10001066 3300025906 Bacteria 12960
191 Ga0207699_10021537 3300025906 Bacteria 3476
192 Ga0207699_10253190 3300025906 Bacteria 1214
193 Ga0207684_10001761 3300025910 Bacteria 22878
194 Ga0207684_10008113 3300025910 Bacteria 9362
195 Ga0207684_10093884 3300025910 Bacteria 2559
196 Ga0207684_10235712 3300025910 Bacteria 1579
197 Ga0207684_10366728 3300025910 Bacteria 1239
198 Ga0207654_11095668 3300025911 Bacteria 580
199 Ga0207707_10491159 3300025912 Bacteria 1048
200 Ga0207671_10094985 3300025914 Bacteria 2251
201 Ga0207693_10011453 3300025915 Bacteria 7176
202 Ga0207693_10017652 3300025915 Bacteria 5690
203 Ga0207693_10031669 3300025915 Bacteria 4178
204 Ga0207693_10659718 3300025915 Bacteria 812
205 Ga0207693_10832993 3300025915 Bacteria 710
206 Ga0207663_10002072 3300025916 Bacteria 9557
207 Ga0207663_10005894 3300025916 Bacteria 6217
208 Ga0207663_10477708 3300025916 Bacteria 965
209 Ga0207663_10892311 3300025916 Bacteria 711
210 Ga0207660_10998748 3300025917 Bacteria 683
211 Ga0207652_10334736 3300025921 Bacteria 1367
212 Ga0207652_10625898 3300025921 Bacteria 964
213 Ga0207646_10000278 3300025922 Bacteria 70066
214 Ga0207646_10003994 3300025922 Bacteria 16334
215 Ga0207646_10023928 3300025922 Bacteria 5603
216 Ga0207646_10205035 3300025922 Bacteria 1781
217 Ga0207687_10156617 3300025927 Bacteria 1744
218 Ga0207700_10001366 3300025928 Bacteria 13833
219 Ga0207700_10004397 3300025928 Bacteria 8301
220 Ga0207700_10070074 3300025928 Bacteria 2694
221 Ga0207700_10076350 3300025928 Bacteria 2599
222 Ga0207700_10100254 3300025928 Bacteria 2308
223 Ga0207700_10154117 3300025928 Bacteria 1902
224 Ga0207700_10678419 3300025928 Bacteria 919
225 Ga0207664_10001412 3300025929 Bacteria 15806
226 Ga0207664_10015483 3300025929 Bacteria 5537
227 Ga0207664_10028261 3300025929 Bacteria 4260
228 Ga0207664_10159783 3300025929 Bacteria 1921
229 Ga0207664_10213288 3300025929 Bacteria 1671
230 Ga0207664_10918743 3300025929 Bacteria 786
231 Ga0207664_11801921 3300025929 Bacteria 535
232 Ga0207664_11821215 3300025929 Bacteria 531
233 Ga0207665_10000215 3300025939 Bacteria 38950
234 Ga0207665_10002825 3300025939 Bacteria 11643
235 Ga0207665_10020664 3300025939 Bacteria 4328
236 Ga0207665_10051109 3300025939 Bacteria 2781
237 Ga0207711_10840299 3300025941 Bacteria 855
238 Ga0207661_10470094 3300025944 Bacteria 1147
239 Ga0207661_11136368 3300025944 Bacteria 719
240 Ga0207667_10499843 3300025949 Bacteria 1233
241 Ga0207677_10207255 3300026023 Bacteria 1563
242 Ga0207703_10281218 3300026035 Bacteria 1511
243 Ga0207702_11476938 3300026078 Bacteria 673
244 Ga0207676_10017375 3300026095 Bacteria 5213
245 Ga0207674_12051485 3300026116 Bacteria 536
246 Ga0207683_10057274 3300026121 Bacteria 3421
247 Ga0207683_10219179 3300026121 Bacteria 1733
248 Ga0207683_10464597 3300026121 Bacteria 1167
249 Ga0207683_12070779 3300026121 Bacteria 517
250 Ga0207428_10018162 3300027907 Bacteria 6013
251 Ga0268266_10017666 3300028379 Bacteria 6083
252 Ga0268266_12116669 3300028379 Bacteria 535
253 Ga0268265_11986792 3300028380 Bacteria 589
254 Ga0268264_12132961 3300028381 Bacteria 569
255 Ga0265336_10004336 3300028666 Bacteria 5376
256 Ga0265338_10000827 3300028800 Bacteria 52237
257 Ga0265338_10008774 3300028800 Bacteria 12219
258 Ga0307408_100450980 3300031548 Bacteria 1116
259 Ga0307408_101527736 3300031548 Bacteria 632
260 Ga0307405_10140583 3300031731 Bacteria 1682
261 Ga0307405_10446875 3300031731 Bacteria 1024
262 Ga0307405_10725183 3300031731 Bacteria 826
263 Ga0307413_10109837 3300031824 Bacteria 1844
264 Ga0307413_10194829 3300031824 Bacteria 1458
265 Ga0307413_11699630 3300031824 Bacteria 563
266 Ga0307410_10845048 3300031852 Bacteria 781
267 Ga0307410_11349582 3300031852 Bacteria 625
268 Ga0307406_10070477 3300031901 Bacteria 2289
269 Ga0307406_10159376 3300031901 Bacteria 1620
270 Ga0307406_10272646 3300031901 Bacteria 1286
271 Ga0307406_10581931 3300031901 Bacteria 920
272 Ga0307407_10140418 3300031903 Bacteria 1558
273 Ga0307407_10312309 3300031903 Bacteria 1100
274 Ga0307407_10509654 3300031903 Bacteria 883
275 Ga0307407_11421859 3300031903 Bacteria 547
276 Ga0307412_10753094 3300031911 Bacteria 841
277 Ga0307409_100017384 3300031995 Bacteria 4791
278 Ga0307409_100985556 3300031995 Bacteria 860
279 Ga0307409_101493794 3300031995 Bacteria 703
280 Ga0307409_102332438 3300031995 Bacteria 564
281 Ga0307416_100170664 3300032002 Bacteria 2024
282 Ga0307416_100257444 3300032002 Bacteria 1703
283 Ga0307416_100753070 3300032002 Bacteria 1067
284 Ga0307416_102440675 3300032002 Bacteria 622
285 Ga0307416_102706554 3300032002 Bacteria 593
286 Ga0307416_103133877 3300032002 Bacteria 553
287 Ga0307416_103691138 3300032002 Bacteria 512
288 Ga0307416_103815936 3300032002 Bacteria 505
289 Ga0307414_10013607 3300032004 Bacteria 4850
290 Ga0307414_10996961 3300032004 Bacteria 771
291 Ga0307411_10284858 3300032005 Bacteria 1317
292 Ga0307411_10860870 3300032005 Bacteria 803
293 Ga0307411_11131526 3300032005 Bacteria 707
294 Ga0307411_11942706 3300032005 Bacteria 548
295 Ga0307415_100051097 3300032126 Bacteria 2804
296 Ga0307415_100274201 3300032126 Bacteria 1383
297 Ga0307415_100788873 3300032126 Bacteria 866
298 Ga0307415_101148679 3300032126 Bacteria 729
299 Ga0307415_101378515 3300032126 Bacteria 670
300 Ga0307507_10000013 3300033179 Bacteria 242708
301 Ga0373930_0133985 3300034816 Bacteria 612
302 Ga0373948_0022910 3300034817 Bacteria 1207
303 Ga0373958_0012635 3300034819 Bacteria 1448
304 Ga0373926_0000330 3300035083 Bacteria 11877
305 Ga0373926_0093766 3300035083 Bacteria 1118
306 Ga0373926_0116451 3300035083 Bacteria 1006
307 Ga0373934_0000006 3300035086 Bacteria 81073
308 Ga0373934_0017152 3300035086 Bacteria 2761
309 Ga0373934_0099540 3300035086 Bacteria 1175
310 Ga0373934_0113793 3300035086 Bacteria 1098
311 Ga0373940_0004399 3300035088 Bacteria 2973
312 Ga0373944_0038875 3300035089 Bacteria 1463
313 Ga0373944_0190785 3300035089 Bacteria 738
314 Ga0373949_0092032 3300035090 Bacteria 821
315 Ga0373923_0006532 3300035111 Bacteria 4039
316 Ga0373923_0027565 3300035111 Bacteria 2267
317 Ga0373923_0057518 3300035111 Bacteria 1644
318 Ga0373923_0111872 3300035111 Bacteria 1213
319 Ga0373923_0164654 3300035111 Bacteria 1013
320 Ga0373923_0459538 3300035111 Bacteria 618
321 Ga0373932_0040525 3300035112 Bacteria 1341
322 Ga0373936_0006261 3300035113 Bacteria 4488
323 Ga0373936_0145008 3300035113 Bacteria 1027
324 Ga0373936_0269091 3300035113 Bacteria 764
325 Ga0373936_0480550 3300035113 Bacteria 576
326 Ga0373945_0011759 3300035116 Bacteria 2898
327 Ga0373945_0104958 3300035116 Bacteria 1110
328 Ga0373945_0106313 3300035116 Bacteria 1104
329 Ga0373953_0015552 3300035117 Bacteria 2760
330 Ga0373953_0073428 3300035117 Bacteria 1414
331 Ga0373953_0211589 3300035117 Bacteria 839
332 Ga0373953_0213913 3300035117 Bacteria 834
333 Ga0373954_0006092 3300035118 Bacteria 5248
334 Ga0373954_0008686 3300035118 Bacteria 4467
335 Ga0373954_0169587 3300035118 Bacteria 1069
336 Ga0373954_0400496 3300035118 Bacteria 679
337 Ga0373954_0560703 3300035118 Bacteria 566
338 Ga0373956_0000498 3300035119 Bacteria 16085
339 Ga0373956_0017185 3300035119 Bacteria 3047
340 Ga0373956_0037527 3300035119 Bacteria 2141
341 Ga0373956_0037610 3300035119 Bacteria 2139
342 Ga0373956_0088020 3300035119 Bacteria 1430
343 Ga0373956_0092424 3300035119 Bacteria 1397
344 Ga0373957_0000210 3300035120 Bacteria 14807
345 Ga0373957_0002317 3300035120 Bacteria 5407
346 Ga0373957_0004962 3300035120 Bacteria 4096
347 Ga0373957_0163977 3300035120 Bacteria 916
348 Ga0373957_0234395 3300035120 Bacteria 770
349 Ga0373960_0010117 3300035121 Bacteria 2298
350 Ga0373943_0294958 3300035170 Bacteria 919
351 Ga0373943_0386406 3300035170 Bacteria 806
352 Ga0373943_0890718 3300035170 Bacteria 531
353 Ga0373946_0022333 3300035171 Bacteria 2462
354 Ga0373946_0176232 3300035171 Bacteria 1012
355 Ga0373946_0453146 3300035171 Bacteria 653
356 Ga0373955_0000034 3300035172 Bacteria 53524
357 Ga0373955_0006038 3300035172 Bacteria 5495
358 Ga0373955_0024386 3300035172 Bacteria 3093
359 Ga0373955_0042477 3300035172 Bacteria 2441
360 Ga0373955_0088303 3300035172 Bacteria 1763
361 Ga0373955_0440035 3300035172 Bacteria 794
362 Ga0373942_0225742 3300035207 Bacteria 629
363 Ga0373961_0162511 3300035241 Bacteria 768
364 Ga0373962_0187279 3300035242 Bacteria 695
365 Ga0373924_0000343 3300035410 Bacteria 14274
366 Ga0373924_0003982 3300035410 Bacteria 5127
367 Ga0373924_0014387 3300035410 Bacteria 2989
368 Ga0373924_0039093 3300035410 Bacteria 1937
369 Ga0373924_0199477 3300035410 Bacteria 882
370 Ga0373924_0507378 3300035410 Bacteria 542
371 Ga0373931_0051453 3300035691 Bacteria 2194
372 Ga0373931_0210179 3300035691 Bacteria 1166
373 Ga0373935_0021585 3300035692 Bacteria 3943
374 Ga0373935_0038249 3300035692 Bacteria 3003
375 Ga0373935_0074216 3300035692 Bacteria 2198
376 Ga0373935_0126976 3300035692 Bacteria 1710
377 Ga0373935_0334158 3300035692 Bacteria 1077
378 Ga0373935_0378279 3300035692 Bacteria 1013
379 Ga0373927_0216435 3300035695 Bacteria 1258
380 Ga0373933_0000161 3300035724 Bacteria 43422
381 Ga0373933_0001656 3300035724 Bacteria 12954
382 Ga0373933_0019627 3300035724 Bacteria 3821
383 Ga0373933_0033671 3300035724 Bacteria 2982
384 Ga0373933_0397174 3300035724 Bacteria 899
385 Ga0373933_0476249 3300035724 Bacteria 817
386 Ga0373933_0569257 3300035724 Bacteria 743
387 Ga0373947_0000002 3300035725 Bacteria 383924
388 Ga0373947_0055036 3300035725 Bacteria 2402
389 Ga0373947_0152211 3300035725 Bacteria 1490
390 Ga0373947_0282317 3300035725 Bacteria 1104
391 Ga0373947_0364616 3300035725 Bacteria 971
392 Ga0373947_0367160 3300035725 Bacteria 967
393 Ga0373937_0000126 3300036401 Bacteria 73508
394 Ga0373937_0074697 3300036401 Bacteria 3128
395 Ga0373937_0090176 3300036401 Bacteria 2839
396 Ga0373937_0127435 3300036401 Bacteria 2375
397 Ga0373937_0140947 3300036401 Bacteria 2255
398 Ga0373937_0174808 3300036401 Bacteria 2015
399 Ga0373937_0487825 3300036401 Bacteria 1170
400 Ga0373937_0867575 3300036401 Bacteria 851
401 Ga0373925_0001213 3300037068 Bacteria 22751
402 Ga0373925_0038055 3300037068 Bacteria 3554
403 Ga0373925_0048312 3300037068 Bacteria 3170
404 Ga0373925_0051316 3300037068 Bacteria 3079
405 Ga0373925_0175062 3300037068 Bacteria 1695
406 Ga0373925_0211319 3300037068 Bacteria 1545
407 Ga0373925_0241338 3300037068 Bacteria 1447
408 Ga0373925_0275352 3300037068 Bacteria 1354
409 Ga0373925_1649305 3300037068 Bacteria 524
410 Ga0436364_0398717 3300037853 Bacteria 1102
411 Ga0436364_1283416 3300037853 Bacteria 2506
412 Ga0436363_0426285 3300039450 Bacteria 3134
413 Ga0451804_0297374 3300041463 Bacteria 577
414 Ga0466969_0007516 3300044656 Bacteria 5793
415 Ga0466969_0172100 3300044656 Bacteria 992
416 Ga0466966_0081773 3300044684 Bacteria 2010
417 Ga0466961_0103358 3300044693 Bacteria 1794
418 Ga0466961_0148531 3300044693 Bacteria 1464
419 Ga0466961_0660174 3300044693 Bacteria 627
420 Ga0466963_0148482 3300044694 Bacteria 1627
421 Ga0466963_0784484 3300044694 Bacteria 672
422 Ga0466971_0050231 3300044719 Bacteria 1876
423 Ga0466960_0077523 3300044901 Bacteria 1667
424 Ga0466959_0032173 3300045049 Bacteria 3882
425 Ga0466958_0447267 3300045836 Bacteria 836
426 Ga0466967_1109237 3300045976 Bacteria 788
427 Ga0495592_0000030 3300046454 Bacteria 129103
428 Ga0495592_0002427 3300046454 Bacteria 13135
429 Ga0495592_0008472 3300046454 Bacteria 7716
430 Ga0495592_0064532 3300046454 Bacteria 2683
431 Ga0495592_0075825 3300046454 Bacteria 2441
432 Ga0495629_0001800 3300046459 Bacteria 16788
433 Ga0495629_0018263 3300046459 Bacteria 5022
434 Ga0495629_0150182 3300046459 Bacteria 1619
435 Ga0495629_0284677 3300046459 Bacteria 1134
436 Ga0495641_0025433 3300046461 Bacteria 2906
437 Ga0495641_0032006 3300046461 Bacteria 2507
438 Ga0495641_0088219 3300046461 Bacteria 1387
439 Ga0495651_0000221 3300046462 Bacteria 43412
440 Ga0495651_0008518 3300046462 Bacteria 7858
441 Ga0495651_0010326 3300046462 Bacteria 7174
442 Ga0495651_0096506 3300046462 Bacteria 2208
443 Ga0495651_0148920 3300046462 Bacteria 1689
444 Ga0495651_0474604 3300046462 Bacteria 804
445 Ga0495653_0000895 3300046463 Bacteria 23073
446 Ga0495653_0014521 3300046463 Bacteria 6426
447 Ga0495653_0051335 3300046463 Bacteria 3166
448 Ga0495653_0052881 3300046463 Bacteria 3110
449 Ga0495653_0111354 3300046463 Bacteria 1966
450 Ga0495653_0146733 3300046463 Bacteria 1652
451 Ga0495653_0313790 3300046463 Bacteria 1018
452 Ga0495653_0798770 3300046463 Bacteria 567
453 Ga0495580_0281028 3300046472 Bacteria 1135
454 Ga0495582_0012433 3300046473 Bacteria 4690
455 Ga0495582_0115806 3300046473 Bacteria 1507
456 Ga0495582_0320667 3300046473 Bacteria 891
457 Ga0495582_0367000 3300046473 Bacteria 829
458 Ga0495639_0119891 3300046475 Bacteria 1254
459 Ga0495639_0445845 3300046475 Bacteria 657
460 Ga0495639_0735357 3300046475 Bacteria 510
461 Ga0495662_0035385 3300046476 Bacteria 2409
462 Ga0495662_0054277 3300046476 Bacteria 1935
463 Ga0495662_0155992 3300046476 Bacteria 1124
464 Ga0495662_0277993 3300046476 Bacteria 824
465 Ga0495662_0351465 3300046476 Bacteria 725
466 Ga0495664_0002344 3300046477 Bacteria 10143
467 Ga0495664_0017095 3300046477 Bacteria 4143
468 Ga0495664_0037941 3300046477 Bacteria 2844
469 Ga0495664_0122797 3300046477 Bacteria 1570
470 Ga0495664_0909054 3300046477 Bacteria 514
471 Ga0495594_0070211 3300046499 Bacteria 1947
472 Ga0495594_0711103 3300046499 Bacteria 568
473 Ga0495596_0159804 3300046500 Bacteria 876
474 Ga0495608_0000191 3300046511 Bacteria 43426
475 Ga0495608_0014956 3300046511 Bacteria 5385
476 Ga0495608_0046647 3300046511 Bacteria 2882
477 Ga0495608_0102011 3300046511 Bacteria 1849
478 Ga0495608_0176632 3300046511 Bacteria 1352
479 Ga0495618_0010093 3300046514 Bacteria 5710
480 Ga0495618_0060083 3300046514 Bacteria 2409
481 Ga0495618_0065574 3300046514 Bacteria 2308
482 Ga0495628_0003830 3300046516 Bacteria 13409
483 Ga0495628_0034341 3300046516 Bacteria 4079
484 Ga0495628_0078885 3300046516 Bacteria 2560
485 Ga0495628_0083824 3300046516 Bacteria 2474
486 Ga0495628_0131071 3300046516 Bacteria 1917
487 Ga0495628_0230854 3300046516 Bacteria 1387
488 Ga0495628_0708927 3300046516 Bacteria 710
489 Ga0495630_0112125 3300046517 Bacteria 2065
490 Ga0495630_0159618 3300046517 Bacteria 1717
491 Ga0495630_0205176 3300046517 Bacteria 1504
492 Ga0495630_0274243 3300046517 Bacteria 1288
493 Ga0495630_0389478 3300046517 Bacteria 1067
494 Ga0495630_0827172 3300046517 Bacteria 706
495 Ga0495630_0865701 3300046517 Bacteria 689
496 Ga0495630_1113755 3300046517 Bacteria 598
497 Ga0495666_0057348 3300046526 Bacteria 1864
498 Ga0495666_0246349 3300046526 Bacteria 815
499 Ga0495652_0000921 3300046529 Bacteria 33833
500 Ga0495652_0064235 3300046529 Bacteria 3088
501 Ga0495652_0112779 3300046529 Bacteria 2183
502 Ga0495652_0257925 3300046529 Bacteria 1288
503 Ga0495652_0265813 3300046529 Bacteria 1263
504 Ga0495652_0655383 3300046529 Bacteria 710
505 Ga0495665_0050462 3300046531 Bacteria 2205
506 Ga0495665_0092802 3300046531 Bacteria 1586
507 Ga0495665_0140283 3300046531 Bacteria 1263
508 Ga0495640_0011149 3300046533 Bacteria 6921
509 Ga0495640_0016433 3300046533 Bacteria 5534
510 Ga0495640_0020901 3300046533 Bacteria 4812
511 Ga0495640_0039834 3300046533 Bacteria 3294
512 Ga0495640_0140821 3300046533 Bacteria 1555
513 Ga0495640_0542890 3300046533 Bacteria 705
514 Ga0495586_0063578 3300046535 Bacteria 2011
515 Ga0495586_0073703 3300046535 Bacteria 1868
516 Ga0495586_0215439 3300046535 Bacteria 1090
517 Ga0495586_0651176 3300046535 Bacteria 609
518 Ga0495586_0854289 3300046535 Bacteria 525
519 Ga0495587_0000210 3300046536 Bacteria 43426
520 Ga0495587_0019889 3300046536 Bacteria 4148
521 Ga0495587_0020581 3300046536 Bacteria 4070
522 Ga0495587_0024332 3300046536 Bacteria 3712
523 Ga0495587_0032571 3300046536 Bacteria 3150
524 Ga0495645_0015471 3300046543 Bacteria 5426
525 Ga0495645_0056485 3300046543 Bacteria 2850
526 Ga0495645_0085457 3300046543 Bacteria 2258
527 Ga0495645_0135143 3300046543 Bacteria 1725
528 Ga0495645_0307343 3300046543 Bacteria 1034
529 Ga0495645_0341772 3300046543 Bacteria 966
530 Ga0495645_0518242 3300046543 Bacteria 743
531 Ga0495667_0000040 3300046559 Bacteria 129118
532 Ga0495667_0010717 3300046559 Bacteria 6198
533 Ga0495667_0013080 3300046559 Bacteria 5620
534 Ga0495667_0015850 3300046559 Bacteria 5096
535 Ga0495667_0060701 3300046559 Bacteria 2479
536 Ga0495667_0797754 3300046559 Bacteria 582
537 Ga0495668_0801198 3300046616 Bacteria 522
538 Ga0495634_0003736 3300046642 Bacteria 12125
539 Ga0495634_0017695 3300046642 Bacteria 5082
540 Ga0495634_0019945 3300046642 Bacteria 4757
541 Ga0495634_0076456 3300046642 Bacteria 2197
542 Ga0495634_0138953 3300046642 Bacteria 1544
543 Ga0495635_0017276 3300046663 Bacteria 5039
544 Ga0495635_0029863 3300046663 Bacteria 3790
545 Ga0495635_0036363 3300046663 Bacteria 3413
546 Ga0495635_0127562 3300046663 Bacteria 1734
547 Ga0495635_0134131 3300046663 Bacteria 1688
548 Ga0495635_0148435 3300046663 Bacteria 1596
549 Ga0495635_0148540 3300046663 Bacteria 1595
550 Ga0495635_0270301 3300046663 Bacteria 1143
551 Ga0495657_0000029 3300046675 Bacteria 129126
552 Ga0495657_0011357 3300046675 Bacteria 6663
553 Ga0495657_0013779 3300046675 Bacteria 5952
554 Ga0495657_0067790 3300046675 Bacteria 2340
555 Ga0495657_0071731 3300046675 Bacteria 2260
556 Ga0495657_0123526 3300046675 Bacteria 1628
557 Ga0495657_0247829 3300046675 Bacteria 1073
558 Ga0495599_0000238 3300046678 Bacteria 34651
559 Ga0495599_0006812 3300046678 Bacteria 6906
560 Ga0495599_0011065 3300046678 Bacteria 5535
561 Ga0495599_0020378 3300046678 Bacteria 4130
562 Ga0495599_0044594 3300046678 Bacteria 2781
563 Ga0495599_0079635 3300046678 Bacteria 2046
564 Ga0495599_0148446 3300046678 Bacteria 1453
565 Ga0495599_0160810 3300046678 Bacteria 1388
566 Ga0495599_0378450 3300046678 Bacteria 845
567 Ga0495599_0796816 3300046678 Bacteria 540
568 Ga0495599_0879568 3300046678 Unclassified 508
569 Ga0495623_0000652 3300046679 Bacteria 23015
570 Ga0495623_0021744 3300046679 Bacteria 4143
571 Ga0495623_0047553 3300046679 Bacteria 2723
572 Ga0495623_0048775 3300046679 Bacteria 2684
573 Ga0495623_0181919 3300046679 Bacteria 1220
574 Ga0495623_0205434 3300046679 Bacteria 1130
575 Ga0495646_0017835 3300046680 Bacteria 4498
576 Ga0495646_0055286 3300046680 Bacteria 2384
577 Ga0495646_0119361 3300046680 Bacteria 1493
578 Ga0495646_0130857 3300046680 Bacteria 1413
579 Ga0495647_0077274 3300046681 Bacteria 1344
580 Ga0495658_0010787 3300046683 Bacteria 4575
581 Ga0495658_0024208 3300046683 Bacteria 3231
582 Ga0495658_0286242 3300046683 Bacteria 1041
583 Ga0495613_0006014 3300046689 Bacteria 9080
584 Ga0495613_0286579 3300046689 Bacteria 1142
585 Ga0495613_0772280 3300046689 Bacteria 628
586 Ga0495624_0038221 3300046690 Bacteria 3084
587 Ga0495624_0047584 3300046690 Bacteria 2725
588 Ga0495624_0365578 3300046690 Bacteria 867
589 Ga0495600_0001122 3300046809 Bacteria 14592
590 Ga0495600_0012428 3300046809 Bacteria 5323
591 Ga0495600_0060393 3300046809 Bacteria 2475
592 Ga0495600_0112858 3300046809 Bacteria 1769
593 Ga0495600_0460500 3300046809 Bacteria 785
594 Ga0495600_0561882 3300046809 Bacteria 696
595 Ga0495581_0005470 3300047315 Bacteria 7350
596 Ga0495581_0016981 3300047315 Bacteria 4229
597 Ga0495581_0248528 3300047315 Bacteria 1040
598 Ga0495581_0294979 3300047315 Bacteria 948
599 Ga0495581_0295767 3300047315 Bacteria 946
600 Ga0495604_0000034 3300047317 Bacteria 129099
601 Ga0495604_0013791 3300047317 Bacteria 6443
602 Ga0495604_0031224 3300047317 Bacteria 4227
603 Ga0495604_0036970 3300047317 Bacteria 3847
604 Ga0495604_0076770 3300047317 Bacteria 2512
605 Ga0495604_0240711 3300047317 Bacteria 1237
606 Ga0495604_0985209 3300047317 Bacteria 522
607 Ga0495674_0025013 3300047319 Bacteria 5479
608 Ga0495674_0040569 3300047319 Bacteria 4163
609 Ga0495674_0131073 3300047319 Bacteria 2112
610 Ga0495674_0201789 3300047319 Bacteria 1649
611 Ga0495674_0379131 3300047319 Bacteria 1144
612 Ga0495674_0399541 3300047319 Bacteria 1109
613 Ga0495674_0483130 3300047319 Bacteria 992
614 Ga0495674_0901147 3300047319 Bacteria 682
615 Ga0495676_0176606 3300047321 Bacteria 1499
616 Ga0495676_0495223 3300047321 Bacteria 802
617 Ga0495680_0000522 3300047322 Bacteria 43426
618 Ga0495680_0002970 3300047322 Bacteria 16962
619 Ga0495680_0021482 3300047322 Bacteria 5402
620 Ga0495680_0023239 3300047322 Bacteria 5156
621 Ga0495680_0024387 3300047322 Bacteria 5017
622 Ga0495680_0024852 3300047322 Bacteria 4962
623 Ga0495680_0314242 3300047322 Bacteria 1097
624 Ga0495680_0973816 3300047322 Bacteria 543
625 Ga0495675_0007809 3300047444 Bacteria 6603
626 Ga0495675_0034946 3300047444 Bacteria 3210
627 Ga0495675_0135794 3300047444 Bacteria 1527
628 Ga0495675_0149659 3300047444 Bacteria 1442
629 Ga0495684_0011772 3300047471 Bacteria 6749
630 Ga0495684_0028184 3300047471 Bacteria 4312
631 Ga0495684_0054194 3300047471 Bacteria 3059
632 Ga0495684_0187972 3300047471 Bacteria 1528
633 Ga0495684_0387917 3300047471 Bacteria 983
634 Ga0495684_0671733 3300047471 Bacteria 690
635 Ga0495684_0735105 3300047471 Bacteria 651
636 Ga0495684_0840601 3300047471 Bacteria 596
637 Ga0495593_0001378 3300047673 Bacteria 14216
638 Ga0495593_0013402 3300047673 Bacteria 4678
639 Ga0495593_0029352 3300047673 Bacteria 3015
640 Ga0495593_0394632 3300047673 Bacteria 692
641 Ga0495593_0608838 3300047673 Bacteria 548
642 Ga0495602_0001101 3300048088 Bacteria 26520
643 Ga0495602_0027300 3300048088 Bacteria 5488
644 Ga0495602_0078601 3300048088 Bacteria 2786
645 Ga0495602_0208504 3300048088 Bacteria 1485
646 Ga0495602_0287897 3300048088 Bacteria 1207
647 Ga0495602_0496725 3300048088 Bacteria 853
648 Ga0495614_0073849 3300048089 Bacteria 1472
649 Ga0495614_0123982 3300048089 Bacteria 1141
650 Ga0495614_0167276 3300048089 Bacteria 985
651 Ga0496100_0007843 3300048903 Bacteria 5925
652 Ga0496100_0980306 3300048903 Bacteria 665
653 Ga0496100_1206893 3300048903 Bacteria 597
654 Ga0496101_0210138 3300048904 Bacteria 1507
655 Ga0496101_0495393 3300048904 Bacteria 965
656 Ga0496103_0275483 3300048906 Bacteria 1082
657 Ga0496103_0540728 3300048906 Bacteria 744
658 Ga0496104_0000398 3300048907 Bacteria 38090
659 Ga0496104_0080748 3300048907 Bacteria 3100
660 Ga0496104_0159296 3300048907 Bacteria 2165
661 Ga0496105_0002315 3300048908 Bacteria 13811
662 Ga0496105_0048728 3300048908 Bacteria 3497
663 Ga0496106_0152986 3300048909 Bacteria 1820
664 Ga0496106_0320558 3300048909 Bacteria 1244
665 Ga0496106_0449649 3300048909 Bacteria 1035
666 Ga0496107_0074893 3300048910 Bacteria 2463
667 Ga0496108_0003584 3300048911 Bacteria 12438
668 Ga0496108_0048697 3300048911 Bacteria 3543
669 Ga0496109_0016447 3300048912 Bacteria 6468
670 Ga0496109_0233952 3300048912 Bacteria 1729
671 Ga0496109_1226849 3300048912 Bacteria 686
672 Ga0496110_0056717 3300048913 Bacteria 3447
673 Ga0496110_0101351 3300048913 Bacteria 2581
674 Ga0496110_0535929 3300048913 Bacteria 1064
675 Ga0496111_0015587 3300048914 Bacteria 5223
676 Ga0496112_0000555 3300048915 Bacteria 25563
677 Ga0496112_0148757 3300048915 Bacteria 2309
678 Ga0496113_0007480 3300048916 Bacteria 7035
679 Ga0496113_0127075 3300048916 Bacteria 1997
680 Ga0496114_0139113 3300048917 Bacteria 2101
681 Ga0496114_0150228 3300048917 Bacteria 2020
682 Ga0496115_0095603 3300048918 Bacteria 2432
683 Ga0496115_0095718 3300048918 Bacteria 2430
684 Ga0496115_0456277 3300048918 Bacteria 1032
685 Ga0501040_1017797 3300049576 Bacteria 601
686 nmdc:mga05p37_55814_c1 3300050507 Bacteria 4863
687 nmdc:mga05p37_943223_c1 3300050507 Bacteria 925
688 nmdc:mga09592_1297538_c1 3300050508 Bacteria 599
689 nmdc:mga08y16_176108_c1 3300050511 Bacteria 2221
690 nmdc:mga0n895_483430_c1 3300050512 Bacteria 1249
691 nmdc:mga0n895_4834_c1 3300050512 Bacteria 11160
692 nmdc:mga0n895_592950_c1 3300050512 Bacteria 1111
693 nmdc:mga0rr50_129776_c1 3300050513 Bacteria 2017
694 nmdc:mga0rr50_160290_c1 3300050513 Bacteria 1825
695 nmdc:mga0rr50_33563_c1 3300050513 Bacteria 3667
696 nmdc:mga0rr50_39424_c1 3300050513 Bacteria 3426
697 nmdc:mga0rr50_5465_c1 3300050513 Bacteria 7582
698 nmdc:mga08x19_134520_c1 3300050514 Bacteria 1666
699 nmdc:mga08x19_20767_c1 3300050514 Bacteria 4047
700 nmdc:mga08x19_307987_c1 3300050514 Bacteria 1101
701 nmdc:mga0a205_71814_c1 3300050515 Bacteria 3343
702 Ga0495601_0003370 3300053077 Bacteria 9152
703 Ga0495601_0164091 3300053077 Bacteria 1452
704 Ga0495601_0249898 3300053077 Bacteria 1158
705 Ga0495601_0279924 3300053077 Bacteria 1087
706 Ga0495601_0304230 3300053077 Bacteria 1038
707 Ga0495601_0368083 3300053077 Bacteria 933
708 Ga0495601_0788079 3300053077 Bacteria 604
709 Ga0495612_0099800 3300053078 Bacteria 1235
710 Ga0495612_0223220 3300053078 Bacteria 834
711 Ga0495595_0004176 3300053084 Bacteria 5803
712 Ga0495595_0009675 3300053084 Bacteria 3992
713 Ga0495595_0042151 3300053084 Bacteria 2091
714 Ga0495595_0099818 3300053084 Bacteria 1400
715 Ga0495595_0333039 3300053084 Bacteria 765
716 Ga0495619_0001126 3300053085 Bacteria 17567
717 Ga0495619_0035907 3300053085 Bacteria 3226
718 Ga0495619_0058966 3300053085 Bacteria 2549
719 Ga0495619_0067041 3300053085 Bacteria 2396
720 Ga0495619_0167066 3300053085 Bacteria 1521
721 Ga0495619_0308259 3300053085 Bacteria 1096
722 Ga0587079_190935 3300059647 Bacteria 554
723 Ga0466962_0009250 3300061719 Bacteria 4720

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028666 Ga0265336_10004336 Ga0265336_100043362 95
2 3300028800 Ga0265338_10000827 Ga0265338_1000082710 95
3 3300003911 JGI25405J52794_10055132 JGI25405J52794_100551322 99
4 3300005937 Ga0081455_10003996 Ga0081455_100039968 99
5 3300044694 Ga0466963_0148482 Ga0466963_0148482_904_1242 100
6 3300005458 Ga0070681_11977776 Ga0070681_119777761 101
7 3300028380 Ga0268265_11986792 Ga0268265_119867921 101
8 3300053085 Ga0495619_0067041 Ga0495619_0067041_1444_1794 101
9 3300005614 Ga0068856_100568478 Ga0068856_1005684781 102
10 3300006847 Ga0075431_100274473 Ga0075431_1002744732 102
11 3300020075 Ga0206349_1809199 Ga0206349_18091991 102
12 3300020076 Ga0206355_1176711 Ga0206355_11767111 102
13 3300026078 Ga0207702_11476938 Ga0207702_114769382 102
14 3300033179 Ga0307507_10000013 Ga0307507_10000013142 102
15 3300044656 Ga0466969_0007516 Ga0466969_0007516_3939_4277 102
16 3300044656 Ga0466969_0172100 Ga0466969_0172100_567_905 102
17 3300044684 Ga0466966_0081773 Ga0466966_0081773_1194_1532 102
18 3300044693 Ga0466961_0148531 Ga0466961_0148531_866_1204 102
19 3300044694 Ga0466963_0784484 Ga0466963_0784484_220_558 102
20 3300044719 Ga0466971_0050231 Ga0466971_0050231_512_850 102
21 3300045049 Ga0466959_0032173 Ga0466959_0032173_120_458 102
22 3300045836 Ga0466958_0447267 Ga0466958_0447267_431_769 102
23 3300061719 Ga0466962_0009250 Ga0466962_0009250_2992_3330 102
24 3300003659 JGI25404J52841_10125491 JGI25404J52841_101254911 103
25 3300005327 Ga0070658_11106343 Ga0070658_111063432 103
26 3300005329 Ga0070683_100707568 Ga0070683_1007075682 103
27 3300005330 Ga0070690_101571269 Ga0070690_1015712692 103
28 3300005336 Ga0070680_101723863 Ga0070680_1017238631 103
29 3300005337 Ga0070682_100019730 Ga0070682_1000197302 103
30 3300005337 Ga0070682_100236652 Ga0070682_1002366522 103
31 3300005338 Ga0068868_100075382 Ga0068868_1000753822 103
32 3300005341 Ga0070691_10820756 Ga0070691_108207561 103
33 3300005344 Ga0070661_100528424 Ga0070661_1005284242 103
34 3300005344 Ga0070661_101635115 Ga0070661_1016351151 103
35 3300005364 Ga0070673_101145027 Ga0070673_1011450271 103
36 3300005434 Ga0070709_10000823 Ga0070709_100008234 103
37 3300005434 Ga0070709_10024826 Ga0070709_100248264 103
38 3300005434 Ga0070709_10697497 Ga0070709_106974971 103
39 3300005435 Ga0070714_100007188 Ga0070714_1000071882 103
40 3300005435 Ga0070714_100014979 Ga0070714_1000149792 103
41 3300005435 Ga0070714_100109759 Ga0070714_1001097592 103
42 3300005435 Ga0070714_100182476 Ga0070714_1001824762 103
43 3300005435 Ga0070714_100387957 Ga0070714_1003879571 103
44 3300005435 Ga0070714_100837634 Ga0070714_1008376341 103
45 3300005436 Ga0070713_100007037 Ga0070713_1000070378 103
46 3300005436 Ga0070713_100053922 Ga0070713_1000539224 103
47 3300005436 Ga0070713_100068078 Ga0070713_1000680784 103
48 3300005436 Ga0070713_100253649 Ga0070713_1002536493 103
49 3300005436 Ga0070713_100282000 Ga0070713_1002820002 103
50 3300005436 Ga0070713_100718572 Ga0070713_1007185722 103
51 3300005436 Ga0070713_100931741 Ga0070713_1009317412 103
52 3300005437 Ga0070710_10000868 Ga0070710_100008687 103
53 3300005437 Ga0070710_10022871 Ga0070710_100228712 103
54 3300005437 Ga0070710_10172496 Ga0070710_101724961 103
55 3300005437 Ga0070710_10355030 Ga0070710_103550301 103
56 3300005439 Ga0070711_100011851 Ga0070711_1000118513 103
57 3300005439 Ga0070711_100229955 Ga0070711_1002299552 103
58 3300005439 Ga0070711_100309635 Ga0070711_1003096352 103
59 3300005439 Ga0070711_100313195 Ga0070711_1003131952 103
60 3300005439 Ga0070711_100626758 Ga0070711_1006267582 103
61 3300005440 Ga0070705_100074927 Ga0070705_1000749272 103
62 3300005444 Ga0070694_100501618 Ga0070694_1005016182 103
63 3300005445 Ga0070708_100005821 Ga0070708_1000058211 103
64 3300005445 Ga0070708_100117021 Ga0070708_1001170212 103
65 3300005445 Ga0070708_101077309 Ga0070708_1010773091 103
66 3300005455 Ga0070663_100539351 Ga0070663_1005393512 103
67 3300005456 Ga0070678_100489332 Ga0070678_1004893321 103
68 3300005456 Ga0070678_100832249 Ga0070678_1008322492 103
69 3300005458 Ga0070681_10139426 Ga0070681_101394262 103
70 3300005458 Ga0070681_10622424 Ga0070681_106224241 103
71 3300005467 Ga0070706_100002492 Ga0070706_1000024926 103
72 3300005467 Ga0070706_100008070 Ga0070706_1000080707 103
73 3300005467 Ga0070706_100011680 Ga0070706_1000116804 103
74 3300005467 Ga0070706_100264192 Ga0070706_1002641922 103
75 3300005468 Ga0070707_100000199 Ga0070707_10000019919 103
76 3300005468 Ga0070707_100005322 Ga0070707_1000053229 103
77 3300005468 Ga0070707_100069704 Ga0070707_1000697043 103
78 3300005468 Ga0070707_100147984 Ga0070707_1001479843 103
79 3300005471 Ga0070698_100000264 Ga0070698_10000026439 103
80 3300005471 Ga0070698_100009166 Ga0070698_1000091663 103
81 3300005471 Ga0070698_100124972 Ga0070698_1001249722 103
82 3300005471 Ga0070698_100501578 Ga0070698_1005015782 103
83 3300005471 Ga0070698_101064597 Ga0070698_1010645972 103
84 3300005518 Ga0070699_100144100 Ga0070699_1001441002 103
85 3300005518 Ga0070699_101815849 Ga0070699_1018158491 103
86 3300005530 Ga0070679_100989066 Ga0070679_1009890661 103
87 3300005530 Ga0070679_101197011 Ga0070679_1011970112 103
88 3300005530 Ga0070679_101972476 Ga0070679_1019724761 103
89 3300005535 Ga0070684_100421866 Ga0070684_1004218662 103
90 3300005536 Ga0070697_100064922 Ga0070697_1000649222 103
91 3300005536 Ga0070697_101218939 Ga0070697_1012189392 103
92 3300005544 Ga0070686_101022406 Ga0070686_1010224062 103
93 3300005545 Ga0070695_100803350 Ga0070695_1008033502 103
94 3300005548 Ga0070665_100020355 Ga0070665_1000203553 103
95 3300005548 Ga0070665_100391780 Ga0070665_1003917802 103
96 3300005548 Ga0070665_100643874 Ga0070665_1006438742 103
97 3300005549 Ga0070704_100724648 Ga0070704_1007246482 103
98 3300005563 Ga0068855_100290727 Ga0068855_1002907272 103
99 3300005577 Ga0068857_100322602 Ga0068857_1003226022 103
100 3300005614 Ga0068856_100008925 Ga0068856_1000089258 103
101 3300005614 Ga0068856_100027025 Ga0068856_1000270254 103
102 3300005614 Ga0068856_101458274 Ga0068856_1014582741 103
103 3300005615 Ga0070702_101434120 Ga0070702_1014341201 103
104 3300005618 Ga0068864_100142029 Ga0068864_1001420292 103
105 3300005841 Ga0068863_100264671 Ga0068863_1002646712 103
106 3300005841 Ga0068863_101330103 Ga0068863_1013301031 103
107 3300005843 Ga0068860_101830214 Ga0068860_1018302142 103
108 3300005844 Ga0068862_100561491 Ga0068862_1005614912 103
109 3300005937 Ga0081455_10258179 Ga0081455_102581792 103
110 3300005983 Ga0081540_1002480 Ga0081540_100248012 103
111 3300005983 Ga0081540_1152629 Ga0081540_11526292 103
112 3300006028 Ga0070717_10016987 Ga0070717_100169872 103
113 3300006028 Ga0070717_10038389 Ga0070717_100383893 103
114 3300006028 Ga0070717_10084850 Ga0070717_100848503 103
115 3300006028 Ga0070717_10161866 Ga0070717_101618662 103
116 3300006028 Ga0070717_10174068 Ga0070717_101740682 103
117 3300006028 Ga0070717_10216055 Ga0070717_102160552 103
118 3300006028 Ga0070717_10707240 Ga0070717_107072401 103
119 3300006028 Ga0070717_11074894 Ga0070717_110748942 103
120 3300006163 Ga0070715_10001553 Ga0070715_100015536 103
121 3300006163 Ga0070715_10085323 Ga0070715_100853232 103
122 3300006163 Ga0070715_10277807 Ga0070715_102778072 103
123 3300006173 Ga0070716_100003243 Ga0070716_1000032437 103
124 3300006173 Ga0070716_100011703 Ga0070716_1000117034 103
125 3300006173 Ga0070716_100088472 Ga0070716_1000884722 103
126 3300006173 Ga0070716_100745331 Ga0070716_1007453311 103
127 3300006175 Ga0070712_100017503 Ga0070712_1000175034 103
128 3300006175 Ga0070712_100024410 Ga0070712_1000244104 103
129 3300006175 Ga0070712_100095396 Ga0070712_1000953963 103
130 3300006237 Ga0097621_101367322 Ga0097621_1013673221 103
131 3300006844 Ga0075428_100260354 Ga0075428_1002603543 103
132 3300006852 Ga0075433_10256953 Ga0075433_102569532 103
133 3300006871 Ga0075434_100007491 Ga0075434_1000074912 103
134 3300006880 Ga0075429_100003605 Ga0075429_1000036055 103
135 3300006914 Ga0075436_100020302 Ga0075436_1000203024 103
136 3300006914 Ga0075436_100313677 Ga0075436_1003136772 103
137 3300006914 Ga0075436_100519349 Ga0075436_1005193493 103
138 3300007076 Ga0075435_100041630 Ga0075435_1000416304 103
139 3300007076 Ga0075435_100163400 Ga0075435_1001634002 103
140 3300007076 Ga0075435_100712075 Ga0075435_1007120752 103
141 3300007076 Ga0075435_101401104 Ga0075435_1014011042 103
142 3300009011 Ga0105251_10287464 Ga0105251_102874642 103
143 3300009093 Ga0105240_11906369 Ga0105240_119063692 103
144 3300009094 Ga0111539_10026492 Ga0111539_100264924 103
145 3300009098 Ga0105245_10016540 Ga0105245_100165402 103
146 3300009098 Ga0105245_11401781 Ga0105245_114017812 103
147 3300009101 Ga0105247_10417442 Ga0105247_104174422 103
148 3300009101 Ga0105247_10556569 Ga0105247_105565691 103
149 3300009147 Ga0114129_10010771 Ga0114129_1001077112 103
150 3300009147 Ga0114129_10018645 Ga0114129_100186454 103
151 3300009174 Ga0105241_10356832 Ga0105241_103568321 103
152 3300009177 Ga0105248_10119398 Ga0105248_101193982 103
153 3300009545 Ga0105237_10493119 Ga0105237_104931192 103
154 3300009553 Ga0105249_10780429 Ga0105249_107804292 103
155 3300010159 Ga0099796_10136017 Ga0099796_101360172 103
156 3300010375 Ga0105239_10197953 Ga0105239_101979533 103
157 3300010375 Ga0105239_10258711 Ga0105239_102587112 103
158 3300010375 Ga0105239_11010799 Ga0105239_110107992 103
159 3300010375 Ga0105239_12460734 Ga0105239_124607342 103
160 3300013104 Ga0157370_10032973 Ga0157370_100329736 103
161 3300013105 Ga0157369_10039515 Ga0157369_100395156 103
162 3300013296 Ga0157374_10231720 Ga0157374_102317202 103
163 3300013297 Ga0157378_10207852 Ga0157378_102078523 103
164 3300013297 Ga0157378_10264984 Ga0157378_102649842 103
165 3300013297 Ga0157378_12573878 Ga0157378_125738781 103
166 3300013306 Ga0163162_10260785 Ga0163162_102607853 103
167 3300013307 Ga0157372_11795945 Ga0157372_117959451 103
168 3300013308 Ga0157375_10054315 Ga0157375_100543154 103
169 3300014325 Ga0163163_10047123 Ga0163163_100471235 103
170 3300014325 Ga0163163_10416366 Ga0163163_104163662 103
171 3300014968 Ga0157379_10132107 Ga0157379_101321073 103
172 3300014969 Ga0157376_10095146 Ga0157376_100951462 103
173 3300014969 Ga0157376_11204371 Ga0157376_112043711 103
174 3300017792 Ga0163161_10188456 Ga0163161_101884562 103
175 3300020069 Ga0197907_10771707 Ga0197907_107717074 103
176 3300020070 Ga0206356_11619378 Ga0206356_116193782 103
177 3300020076 Ga0206355_1286002 Ga0206355_12860022 103
178 3300020080 Ga0206350_11052987 Ga0206350_110529872 103
179 3300020081 Ga0206354_10046509 Ga0206354_100465091 103
180 3300020082 Ga0206353_10146695 Ga0206353_101466952 103
181 3300022467 Ga0224712_10039731 Ga0224712_100397312 103
182 3300022467 Ga0224712_10410895 Ga0224712_104108951 103
183 3300022467 Ga0224712_10621598 Ga0224712_106215981 103
184 3300025898 Ga0207692_10002632 Ga0207692_100026327 103
185 3300025898 Ga0207692_10026757 Ga0207692_100267572 103
186 3300025898 Ga0207692_10071464 Ga0207692_100714642 103
187 3300025898 Ga0207692_10122656 Ga0207692_101226562 103
188 3300025898 Ga0207692_10548622 Ga0207692_105486222 103
189 3300025900 Ga0207710_10257972 Ga0207710_102579722 103
190 3300025905 Ga0207685_10003617 Ga0207685_100036176 103
191 3300025905 Ga0207685_10004266 Ga0207685_100042664 103
192 3300025905 Ga0207685_10017784 Ga0207685_100177842 103
193 3300025906 Ga0207699_10000458 Ga0207699_100004589 103
194 3300025906 Ga0207699_10001066 Ga0207699_100010664 103
195 3300025906 Ga0207699_10021537 Ga0207699_100215374 103
196 3300025906 Ga0207699_10253190 Ga0207699_102531902 103
197 3300025910 Ga0207684_10001761 Ga0207684_1000176116 103
198 3300025910 Ga0207684_10008113 Ga0207684_100081132 103
199 3300025910 Ga0207684_10093884 Ga0207684_100938842 103
200 3300025910 Ga0207684_10235712 Ga0207684_102357121 103
201 3300025910 Ga0207684_10366728 Ga0207684_103667282 103
202 3300025912 Ga0207707_10491159 Ga0207707_104911592 103
203 3300025914 Ga0207671_10094985 Ga0207671_100949853 103
204 3300025915 Ga0207693_10011453 Ga0207693_100114532 103
205 3300025915 Ga0207693_10017652 Ga0207693_100176523 103
206 3300025915 Ga0207693_10031669 Ga0207693_100316692 103
207 3300025915 Ga0207693_10659718 Ga0207693_106597182 103
208 3300025915 Ga0207693_10832993 Ga0207693_108329932 103
209 3300025916 Ga0207663_10002072 Ga0207663_100020729 103
210 3300025916 Ga0207663_10005894 Ga0207663_100058944 103
211 3300025916 Ga0207663_10477708 Ga0207663_104777081 103
212 3300025916 Ga0207663_10892311 Ga0207663_108923112 103
213 3300025917 Ga0207660_10998748 Ga0207660_109987482 103
214 3300025921 Ga0207652_10334736 Ga0207652_103347361 103
215 3300025921 Ga0207652_10625898 Ga0207652_106258982 103
216 3300025922 Ga0207646_10000278 Ga0207646_1000027817 103
217 3300025922 Ga0207646_10003994 Ga0207646_100039949 103
218 3300025922 Ga0207646_10023928 Ga0207646_100239282 103
219 3300025922 Ga0207646_10205035 Ga0207646_102050353 103
220 3300025927 Ga0207687_10156617 Ga0207687_101566171 103
221 3300025928 Ga0207700_10001366 Ga0207700_1000136610 103
222 3300025928 Ga0207700_10004397 Ga0207700_100043973 103
223 3300025928 Ga0207700_10070074 Ga0207700_100700742 103
224 3300025928 Ga0207700_10076350 Ga0207700_100763503 103
225 3300025928 Ga0207700_10100254 Ga0207700_101002542 103
226 3300025928 Ga0207700_10154117 Ga0207700_101541172 103
227 3300025928 Ga0207700_10678419 Ga0207700_106784192 103
228 3300025929 Ga0207664_10001412 Ga0207664_100014129 103
229 3300025929 Ga0207664_10015483 Ga0207664_100154832 103
230 3300025929 Ga0207664_10028261 Ga0207664_100282613 103
231 3300025929 Ga0207664_10159783 Ga0207664_101597831 103
232 3300025929 Ga0207664_10213288 Ga0207664_102132882 103
233 3300025929 Ga0207664_10918743 Ga0207664_109187432 103
234 3300025929 Ga0207664_11801921 Ga0207664_118019211 103
235 3300025929 Ga0207664_11821215 Ga0207664_118212151 103
236 3300025939 Ga0207665_10000215 Ga0207665_1000021518 103
237 3300025939 Ga0207665_10002825 Ga0207665_1000282510 103
238 3300025939 Ga0207665_10020664 Ga0207665_100206642 103
239 3300025939 Ga0207665_10051109 Ga0207665_100511092 103
240 3300025941 Ga0207711_10840299 Ga0207711_108402992 103
241 3300025944 Ga0207661_10470094 Ga0207661_104700942 103
242 3300025949 Ga0207667_10499843 Ga0207667_104998432 103
243 3300026023 Ga0207677_10207255 Ga0207677_102072552 103
244 3300026035 Ga0207703_10281218 Ga0207703_102812182 103
245 3300026095 Ga0207676_10017375 Ga0207676_100173753 103
246 3300026116 Ga0207674_12051485 Ga0207674_120514852 103
247 3300026121 Ga0207683_10057274 Ga0207683_100572742 103
248 3300026121 Ga0207683_10464597 Ga0207683_104645972 103
249 3300026121 Ga0207683_12070779 Ga0207683_120707791 103
250 3300027907 Ga0207428_10018162 Ga0207428_100181623 103
251 3300028379 Ga0268266_10017666 Ga0268266_100176662 103
252 3300028379 Ga0268266_12116669 Ga0268266_121166691 103
253 3300028381 Ga0268264_12132961 Ga0268264_121329611 103
254 3300031903 Ga0307407_10140418 Ga0307407_101404182 103
255 3300032002 Ga0307416_102440675 Ga0307416_1024406751 103
256 3300032002 Ga0307416_102706554 Ga0307416_1027065542 103
257 3300032002 Ga0307416_103691138 Ga0307416_1036911382 103
258 3300032005 Ga0307411_10284858 Ga0307411_102848582 103
259 3300032005 Ga0307411_11131526 Ga0307411_111315261 103
260 3300032126 Ga0307415_100788873 Ga0307415_1007888732 103
261 3300034816 Ga0373930_0133985 Ga0373930_0133985_87_434 103
262 3300034817 Ga0373948_0022910 Ga0373948_0022910_367_714 103
263 3300034819 Ga0373958_0012635 Ga0373958_0012635_452_799 103
264 3300035083 Ga0373926_0000330 Ga0373926_0000330_8328_8675 103
265 3300035083 Ga0373926_0093766 Ga0373926_0093766_441_821 103
266 3300035083 Ga0373926_0116451 Ga0373926_0116451_96_455 103
267 3300035086 Ga0373934_0000006 Ga0373934_0000006_75002_75349 103
268 3300035086 Ga0373934_0017152 Ga0373934_0017152_1910_2257 103
269 3300035086 Ga0373934_0099540 Ga0373934_0099540_128_469 103
270 3300035086 Ga0373934_0113793 Ga0373934_0113793_171_518 103
271 3300035088 Ga0373940_0004399 Ga0373940_0004399_1959_2306 103
272 3300035089 Ga0373944_0038875 Ga0373944_0038875_496_855 103
273 3300035089 Ga0373944_0190785 Ga0373944_0190785_222_602 103
274 3300035090 Ga0373949_0092032 Ga0373949_0092032_61_402 103
275 3300035111 Ga0373923_0006532 Ga0373923_0006532_1497_1847 103
276 3300035111 Ga0373923_0027565 Ga0373923_0027565_305_664 103
277 3300035111 Ga0373923_0057518 Ga0373923_0057518_682_1023 103
278 3300035111 Ga0373923_0111872 Ga0373923_0111872_321_668 103
279 3300035111 Ga0373923_0164654 Ga0373923_0164654_93_440 103
280 3300035111 Ga0373923_0459538 Ga0373923_0459538_69_416 103
281 3300035112 Ga0373932_0040525 Ga0373932_0040525_584_925 103
282 3300035113 Ga0373936_0006261 Ga0373936_0006261_4040_4381 103
283 3300035113 Ga0373936_0145008 Ga0373936_0145008_366_713 103
284 3300035113 Ga0373936_0269091 Ga0373936_0269091_133_483 103
285 3300035113 Ga0373936_0480550 Ga0373936_0480550_30_389 103
286 3300035116 Ga0373945_0011759 Ga0373945_0011759_923_1270 103
287 3300035116 Ga0373945_0104958 Ga0373945_0104958_93_443 103
288 3300035116 Ga0373945_0106313 Ga0373945_0106313_165_512 103
289 3300035117 Ga0373953_0015552 Ga0373953_0015552_2195_2545 103
290 3300035117 Ga0373953_0073428 Ga0373953_0073428_886_1233 103
291 3300035117 Ga0373953_0211589 Ga0373953_0211589_447_806 103
292 3300035117 Ga0373953_0213913 Ga0373953_0213913_293_640 103
293 3300035118 Ga0373954_0006092 Ga0373954_0006092_4193_4540 103
294 3300035118 Ga0373954_0008686 Ga0373954_0008686_1797_2147 103
295 3300035118 Ga0373954_0169587 Ga0373954_0169587_460_819 103
296 3300035118 Ga0373954_0560703 Ga0373954_0560703_199_546 103
297 3300035119 Ga0373956_0000498 Ga0373956_0000498_9297_9644 103
298 3300035119 Ga0373956_0017185 Ga0373956_0017185_1252_1593 103
299 3300035119 Ga0373956_0037527 Ga0373956_0037527_1056_1406 103
300 3300035119 Ga0373956_0037610 Ga0373956_0037610_290_637 103
301 3300035119 Ga0373956_0088020 Ga0373956_0088020_889_1236 103
302 3300035119 Ga0373956_0092424 Ga0373956_0092424_927_1274 103
303 3300035120 Ga0373957_0000210 Ga0373957_0000210_13081_13428 103
304 3300035120 Ga0373957_0002317 Ga0373957_0002317_2066_2407 103
305 3300035120 Ga0373957_0004962 Ga0373957_0004962_1950_2300 103
306 3300035120 Ga0373957_0163977 Ga0373957_0163977_386_733 103
307 3300035120 Ga0373957_0234395 Ga0373957_0234395_46_405 103
308 3300035121 Ga0373960_0010117 Ga0373960_0010117_231_578 103
309 3300035170 Ga0373943_0294958 Ga0373943_0294958_189_548 103
310 3300035170 Ga0373943_0386406 Ga0373943_0386406_179_559 103
311 3300035170 Ga0373943_0890718 Ga0373943_0890718_145_504 103
312 3300035171 Ga0373946_0022333 Ga0373946_0022333_534_881 103
313 3300035171 Ga0373946_0176232 Ga0373946_0176232_220_561 103
314 3300035171 Ga0373946_0453146 Ga0373946_0453146_87_434 103
315 3300035172 Ga0373955_0000034 Ga0373955_0000034_28036_28383 103
316 3300035172 Ga0373955_0006038 Ga0373955_0006038_289_630 103
317 3300035172 Ga0373955_0024386 Ga0373955_0024386_1688_2038 103
318 3300035172 Ga0373955_0042477 Ga0373955_0042477_1704_2051 103
319 3300035172 Ga0373955_0088303 Ga0373955_0088303_602_949 103
320 3300035172 Ga0373955_0440035 Ga0373955_0440035_65_412 103
321 3300035207 Ga0373942_0225742 Ga0373942_0225742_78_437 103
322 3300035241 Ga0373961_0162511 Ga0373961_0162511_132_473 103
323 3300035242 Ga0373962_0187279 Ga0373962_0187279_76_423 103
324 3300035410 Ga0373924_0000343 Ga0373924_0000343_4884_5231 103
325 3300035410 Ga0373924_0003982 Ga0373924_0003982_354_704 103
326 3300035410 Ga0373924_0014387 Ga0373924_0014387_1607_1966 103
327 3300035410 Ga0373924_0039093 Ga0373924_0039093_295_636 103
328 3300035410 Ga0373924_0199477 Ga0373924_0199477_201_548 103
329 3300035410 Ga0373924_0507378 Ga0373924_0507378_39_386 103
330 3300035691 Ga0373931_0210179 Ga0373931_0210179_587_934 103
331 3300035692 Ga0373935_0021585 Ga0373935_0021585_959_1309 103
332 3300035692 Ga0373935_0038249 Ga0373935_0038249_408_755 103
333 3300035692 Ga0373935_0074216 Ga0373935_0074216_1112_1471 103
334 3300035692 Ga0373935_0126976 Ga0373935_0126976_533_883 103
335 3300035692 Ga0373935_0334158 Ga0373935_0334158_635_976 103
336 3300035692 Ga0373935_0378279 Ga0373935_0378279_466_813 103
337 3300035695 Ga0373927_0216435 Ga0373927_0216435_854_1213 103
338 3300035724 Ga0373933_0000161 Ga0373933_0000161_25153_25500 103
339 3300035724 Ga0373933_0001656 Ga0373933_0001656_4468_4809 103
340 3300035724 Ga0373933_0019627 Ga0373933_0019627_1326_1673 103
341 3300035724 Ga0373933_0033671 Ga0373933_0033671_734_1081 103
342 3300035724 Ga0373933_0397174 Ga0373933_0397174_382_729 103
343 3300035724 Ga0373933_0476249 Ga0373933_0476249_55_396 103
344 3300035724 Ga0373933_0569257 Ga0373933_0569257_123_473 103
345 3300035725 Ga0373947_0000002 Ga0373947_0000002_271562_271909 103
346 3300035725 Ga0373947_0055036 Ga0373947_0055036_186_545 103
347 3300035725 Ga0373947_0152211 Ga0373947_0152211_635_982 103
348 3300035725 Ga0373947_0282317 Ga0373947_0282317_541_888 103
349 3300035725 Ga0373947_0364616 Ga0373947_0364616_440_790 103
350 3300035725 Ga0373947_0367160 Ga0373947_0367160_414_755 103
351 3300036401 Ga0373937_0000126 Ga0373937_0000126_25153_25500 103
352 3300036401 Ga0373937_0074697 Ga0373937_0074697_124_471 103
353 3300036401 Ga0373937_0090176 Ga0373937_0090176_840_1187 103
354 3300036401 Ga0373937_0127435 Ga0373937_0127435_349_690 103
355 3300036401 Ga0373937_0140947 Ga0373937_0140947_1074_1424 103
356 3300036401 Ga0373937_0174808 Ga0373937_0174808_338_685 103
357 3300036401 Ga0373937_0487825 Ga0373937_0487825_193_552 103
358 3300036401 Ga0373937_0867575 Ga0373937_0867575_327_674 103
359 3300037068 Ga0373925_0001213 Ga0373925_0001213_21051_21398 103
360 3300037068 Ga0373925_0038055 Ga0373925_0038055_1707_2057 103
361 3300037068 Ga0373925_0048312 Ga0373925_0048312_2575_2955 103
362 3300037068 Ga0373925_0051316 Ga0373925_0051316_264_614 103
363 3300037068 Ga0373925_0175062 Ga0373925_0175062_1205_1564 103
364 3300037068 Ga0373925_0211319 Ga0373925_0211319_333_680 103
365 3300037068 Ga0373925_0241338 Ga0373925_0241338_969_1316 103
366 3300037068 Ga0373925_0275352 Ga0373925_0275352_173_520 103
367 3300037068 Ga0373925_1649305 Ga0373925_1649305_149_496 103
368 3300037853 Ga0436364_0398717 Ga0436364_0398717_285_650 103
369 3300037853 Ga0436364_1283416 Ga0436364_1283416_1688_2038 103
370 3300039450 Ga0436363_0426285 Ga0436363_0426285_2174_2524 103
371 3300044693 Ga0466961_0660174 Ga0466961_0660174_253_603 103
372 3300044901 Ga0466960_0077523 Ga0466960_0077523_1316_1657 103
373 3300046454 Ga0495592_0000030 Ga0495592_0000030_103604_103951 103
374 3300046454 Ga0495592_0002427 Ga0495592_0002427_10437_10778 103
375 3300046454 Ga0495592_0008472 Ga0495592_0008472_5046_5396 103
376 3300046454 Ga0495592_0064532 Ga0495592_0064532_1514_1861 103
377 3300046454 Ga0495592_0075825 Ga0495592_0075825_247_606 103
378 3300046459 Ga0495629_0001800 Ga0495629_0001800_9046_9396 103
379 3300046459 Ga0495629_0018263 Ga0495629_0018263_4017_4358 103
380 3300046459 Ga0495629_0150182 Ga0495629_0150182_1072_1419 103
381 3300046461 Ga0495641_0025433 Ga0495641_0025433_240_581 103
382 3300046461 Ga0495641_0032006 Ga0495641_0032006_1566_1946 103
383 3300046461 Ga0495641_0088219 Ga0495641_0088219_850_1191 103
384 3300046462 Ga0495651_0000221 Ga0495651_0000221_25153_25500 103
385 3300046462 Ga0495651_0008518 Ga0495651_0008518_3771_4118 103
386 3300046462 Ga0495651_0010326 Ga0495651_0010326_2657_3004 103
387 3300046462 Ga0495651_0096506 Ga0495651_0096506_1234_1575 103
388 3300046462 Ga0495651_0148920 Ga0495651_0148920_1233_1583 103
389 3300046462 Ga0495651_0474604 Ga0495651_0474604_404_751 103
390 3300046463 Ga0495653_0000895 Ga0495653_0000895_16703_17050 103
391 3300046463 Ga0495653_0014521 Ga0495653_0014521_3967_4308 103
392 3300046463 Ga0495653_0051335 Ga0495653_0051335_1861_2220 103
393 3300046463 Ga0495653_0052881 Ga0495653_0052881_801_1148 103
394 3300046463 Ga0495653_0111354 Ga0495653_0111354_1342_1692 103
395 3300046463 Ga0495653_0146733 Ga0495653_0146733_382_729 103
396 3300046463 Ga0495653_0313790 Ga0495653_0313790_218_565 103
397 3300046463 Ga0495653_0798770 Ga0495653_0798770_50_397 103
398 3300046472 Ga0495580_0281028 Ga0495580_0281028_48_395 103
399 3300046473 Ga0495582_0012433 Ga0495582_0012433_1342_1692 103
400 3300046473 Ga0495582_0115806 Ga0495582_0115806_581_922 103
401 3300046473 Ga0495582_0320667 Ga0495582_0320667_175_555 103
402 3300046473 Ga0495582_0367000 Ga0495582_0367000_198_557 103
403 3300046475 Ga0495639_0119891 Ga0495639_0119891_851_1192 103
404 3300046475 Ga0495639_0445845 Ga0495639_0445845_46_405 103
405 3300046475 Ga0495639_0735357 Ga0495639_0735357_92_439 103
406 3300046476 Ga0495662_0035385 Ga0495662_0035385_1082_1423 103
407 3300046476 Ga0495662_0054277 Ga0495662_0054277_1375_1716 103
408 3300046476 Ga0495662_0155992 Ga0495662_0155992_673_1020 103
409 3300046476 Ga0495662_0277993 Ga0495662_0277993_151_510 103
410 3300046476 Ga0495662_0351465 Ga0495662_0351465_282_632 103
411 3300046477 Ga0495664_0002344 Ga0495664_0002344_9560_9910 103
412 3300046477 Ga0495664_0017095 Ga0495664_0017095_1931_2272 103
413 3300046477 Ga0495664_0037941 Ga0495664_0037941_1656_2003 103
414 3300046477 Ga0495664_0122797 Ga0495664_0122797_182_541 103
415 3300046477 Ga0495664_0909054 Ga0495664_0909054_103_453 103
416 3300046499 Ga0495594_0070211 Ga0495594_0070211_375_728 103
417 3300046499 Ga0495594_0711103 Ga0495594_0711103_51_410 103
418 3300046511 Ga0495608_0000191 Ga0495608_0000191_17927_18274 103
419 3300046511 Ga0495608_0014956 Ga0495608_0014956_4469_4810 103
420 3300046511 Ga0495608_0046647 Ga0495608_0046647_736_1086 103
421 3300046511 Ga0495608_0102011 Ga0495608_0102011_1233_1580 103
422 3300046511 Ga0495608_0176632 Ga0495608_0176632_47_406 103
423 3300046514 Ga0495618_0010093 Ga0495618_0010093_1172_1513 103
424 3300046514 Ga0495618_0060083 Ga0495618_0060083_1233_1583 103
425 3300046514 Ga0495618_0065574 Ga0495618_0065574_1160_1540 103
426 3300046516 Ga0495628_0003830 Ga0495628_0003830_8687_9034 103
427 3300046516 Ga0495628_0034341 Ga0495628_0034341_2054_2395 103
428 3300046516 Ga0495628_0078885 Ga0495628_0078885_2013_2372 103
429 3300046516 Ga0495628_0083824 Ga0495628_0083824_866_1213 103
430 3300046516 Ga0495628_0131071 Ga0495628_0131071_832_1182 103
431 3300046516 Ga0495628_0230854 Ga0495628_0230854_205_555 103
432 3300046516 Ga0495628_0708927 Ga0495628_0708927_84_434 103
433 3300046517 Ga0495630_0112125 Ga0495630_0112125_1071_1430 103
434 3300046517 Ga0495630_0159618 Ga0495630_0159618_872_1222 103
435 3300046517 Ga0495630_0205176 Ga0495630_0205176_721_1062 103
436 3300046517 Ga0495630_0274243 Ga0495630_0274243_832_1182 103
437 3300046517 Ga0495630_0389478 Ga0495630_0389478_322_669 103
438 3300046517 Ga0495630_0827172 Ga0495630_0827172_126_506 103
439 3300046517 Ga0495630_0865701 Ga0495630_0865701_309_656 103
440 3300046517 Ga0495630_1113755 Ga0495630_1113755_95_454 103
441 3300046526 Ga0495666_0057348 Ga0495666_0057348_1390_1770 103
442 3300046526 Ga0495666_0246349 Ga0495666_0246349_132_473 103
443 3300046529 Ga0495652_0000921 Ga0495652_0000921_8334_8681 103
444 3300046529 Ga0495652_0064235 Ga0495652_0064235_612_971 103
445 3300046529 Ga0495652_0112779 Ga0495652_0112779_1122_1463 103
446 3300046529 Ga0495652_0257925 Ga0495652_0257925_832_1182 103
447 3300046529 Ga0495652_0265813 Ga0495652_0265813_182_529 103
448 3300046529 Ga0495652_0655383 Ga0495652_0655383_271_630 103
449 3300046531 Ga0495665_0050462 Ga0495665_0050462_422_763 103
450 3300046531 Ga0495665_0092802 Ga0495665_0092802_188_538 103
451 3300046531 Ga0495665_0140283 Ga0495665_0140283_112_492 103
452 3300046533 Ga0495640_0011149 Ga0495640_0011149_4410_4757 103
453 3300046533 Ga0495640_0016433 Ga0495640_0016433_832_1182 103
454 3300046533 Ga0495640_0020901 Ga0495640_0020901_4404_4763 103
455 3300046533 Ga0495640_0039834 Ga0495640_0039834_2605_2946 103
456 3300046533 Ga0495640_0140821 Ga0495640_0140821_323_670 103
457 3300046533 Ga0495640_0542890 Ga0495640_0542890_288_638 103
458 3300046535 Ga0495586_0063578 Ga0495586_0063578_184_543 103
459 3300046535 Ga0495586_0073703 Ga0495586_0073703_1360_1710 103
460 3300046535 Ga0495586_0215439 Ga0495586_0215439_59_400 103
461 3300046535 Ga0495586_0651176 Ga0495586_0651176_54_401 103
462 3300046535 Ga0495586_0854289 Ga0495586_0854289_143_493 103
463 3300046536 Ga0495587_0000210 Ga0495587_0000210_17927_18274 103
464 3300046536 Ga0495587_0019889 Ga0495587_0019889_1820_2161 103
465 3300046536 Ga0495587_0020581 Ga0495587_0020581_2252_2599 103
466 3300046536 Ga0495587_0024332 Ga0495587_0024332_318_659 103
467 3300046536 Ga0495587_0032571 Ga0495587_0032571_2590_2949 103
468 3300046543 Ga0495645_0015471 Ga0495645_0015471_978_1328 103
469 3300046543 Ga0495645_0056485 Ga0495645_0056485_129_476 103
470 3300046543 Ga0495645_0085457 Ga0495645_0085457_166_516 103
471 3300046543 Ga0495645_0135143 Ga0495645_0135143_1161_1520 103
472 3300046543 Ga0495645_0307343 Ga0495645_0307343_147_494 103
473 3300046543 Ga0495645_0341772 Ga0495645_0341772_565_906 103
474 3300046543 Ga0495645_0518242 Ga0495645_0518242_312_659 103
475 3300046559 Ga0495667_0000040 Ga0495667_0000040_25153_25500 103
476 3300046559 Ga0495667_0010717 Ga0495667_0010717_2207_2554 103
477 3300046559 Ga0495667_0013080 Ga0495667_0013080_4659_5018 103
478 3300046559 Ga0495667_0015850 Ga0495667_0015850_2807_3154 103
479 3300046559 Ga0495667_0060701 Ga0495667_0060701_721_1062 103
480 3300046559 Ga0495667_0797754 Ga0495667_0797754_140_487 103
481 3300046642 Ga0495634_0003736 Ga0495634_0003736_6169_6519 103
482 3300046642 Ga0495634_0017695 Ga0495634_0017695_3954_4313 103
483 3300046642 Ga0495634_0019945 Ga0495634_0019945_495_842 103
484 3300046642 Ga0495634_0076456 Ga0495634_0076456_448_789 103
485 3300046642 Ga0495634_0138953 Ga0495634_0138953_219_566 103
486 3300046663 Ga0495635_0017276 Ga0495635_0017276_1361_1711 103
487 3300046663 Ga0495635_0029863 Ga0495635_0029863_3367_3708 103
488 3300046663 Ga0495635_0036363 Ga0495635_0036363_3009_3368 103
489 3300046663 Ga0495635_0127562 Ga0495635_0127562_107_466 103
490 3300046663 Ga0495635_0134131 Ga0495635_0134131_612_959 103
491 3300046663 Ga0495635_0148435 Ga0495635_0148435_298_645 103
492 3300046663 Ga0495635_0148540 Ga0495635_0148540_900_1247 103
493 3300046663 Ga0495635_0270301 Ga0495635_0270301_756_1103 103
494 3300046675 Ga0495657_0000029 Ga0495657_0000029_25153_25500 103
495 3300046675 Ga0495657_0011357 Ga0495657_0011357_3678_4037 103
496 3300046675 Ga0495657_0013779 Ga0495657_0013779_375_725 103
497 3300046675 Ga0495657_0067790 Ga0495657_0067790_315_656 103
498 3300046675 Ga0495657_0071731 Ga0495657_0071731_520_867 103
499 3300046675 Ga0495657_0123526 Ga0495657_0123526_1135_1482 103
500 3300046675 Ga0495657_0247829 Ga0495657_0247829_657_1004 103
501 3300046678 Ga0495599_0000238 Ga0495599_0000238_5986_6333 103
502 3300046678 Ga0495599_0006812 Ga0495599_0006812_1870_2229 103
503 3300046678 Ga0495599_0011065 Ga0495599_0011065_832_1182 103
504 3300046678 Ga0495599_0020378 Ga0495599_0020378_3042_3389 103
505 3300046678 Ga0495599_0044594 Ga0495599_0044594_2054_2395 103
506 3300046678 Ga0495599_0079635 Ga0495599_0079635_1020_1367 103
507 3300046678 Ga0495599_0148446 Ga0495599_0148446_563_910 103
508 3300046678 Ga0495599_0160810 Ga0495599_0160810_930_1277 103
509 3300046678 Ga0495599_0378450 Ga0495599_0378450_35_382 103
510 3300046678 Ga0495599_0796816 Ga0495599_0796816_13_363 103
511 3300046679 Ga0495623_0000652 Ga0495623_0000652_14218_14565 103
512 3300046679 Ga0495623_0021744 Ga0495623_0021744_3449_3796 103
513 3300046679 Ga0495623_0047553 Ga0495623_0047553_1353_1700 103
514 3300046679 Ga0495623_0048775 Ga0495623_0048775_2257_2598 103
515 3300046679 Ga0495623_0181919 Ga0495623_0181919_123_473 103
516 3300046679 Ga0495623_0205434 Ga0495623_0205434_45_404 103
517 3300046680 Ga0495646_0017835 Ga0495646_0017835_3456_3797 103
518 3300046680 Ga0495646_0055286 Ga0495646_0055286_738_1085 103
519 3300046680 Ga0495646_0119361 Ga0495646_0119361_189_539 103
520 3300046680 Ga0495646_0130857 Ga0495646_0130857_508_855 103
521 3300046681 Ga0495647_0077274 Ga0495647_0077274_853_1212 103
522 3300046683 Ga0495658_0010787 Ga0495658_0010787_3001_3342 103
523 3300046683 Ga0495658_0024208 Ga0495658_0024208_1175_1525 103
524 3300046683 Ga0495658_0286242 Ga0495658_0286242_479_826 103
525 3300046689 Ga0495613_0006014 Ga0495613_0006014_4235_4576 103
526 3300046689 Ga0495613_0286579 Ga0495613_0286579_213_554 103
527 3300046689 Ga0495613_0772280 Ga0495613_0772280_126_506 103
528 3300046690 Ga0495624_0038221 Ga0495624_0038221_356_697 103
529 3300046690 Ga0495624_0047584 Ga0495624_0047584_2304_2654 103
530 3300046690 Ga0495624_0365578 Ga0495624_0365578_289_648 103
531 3300046809 Ga0495600_0001122 Ga0495600_0001122_12706_13053 103
532 3300046809 Ga0495600_0012428 Ga0495600_0012428_3585_3926 103
533 3300046809 Ga0495600_0060393 Ga0495600_0060393_1970_2317 103
534 3300046809 Ga0495600_0112858 Ga0495600_0112858_928_1269 103
535 3300046809 Ga0495600_0460500 Ga0495600_0460500_183_563 103
536 3300046809 Ga0495600_0561882 Ga0495600_0561882_207_554 103
537 3300047315 Ga0495581_0005470 Ga0495581_0005470_5228_5578 103
538 3300047315 Ga0495581_0016981 Ga0495581_0016981_368_748 103
539 3300047315 Ga0495581_0248528 Ga0495581_0248528_549_908 103
540 3300047315 Ga0495581_0294979 Ga0495581_0294979_42_389 103
541 3300047315 Ga0495581_0295767 Ga0495581_0295767_384_725 103
542 3300047317 Ga0495604_0000034 Ga0495604_0000034_25153_25500 103
543 3300047317 Ga0495604_0013791 Ga0495604_0013791_5358_5708 103
544 3300047317 Ga0495604_0031224 Ga0495604_0031224_1371_1718 103
545 3300047317 Ga0495604_0036970 Ga0495604_0036970_3269_3628 103
546 3300047317 Ga0495604_0076770 Ga0495604_0076770_357_698 103
547 3300047317 Ga0495604_0240711 Ga0495604_0240711_367_714 103
548 3300047317 Ga0495604_0985209 Ga0495604_0985209_138_497 103
549 3300047319 Ga0495674_0025013 Ga0495674_0025013_405_752 103
550 3300047319 Ga0495674_0040569 Ga0495674_0040569_429_809 103
551 3300047319 Ga0495674_0131073 Ga0495674_0131073_1688_2038 103
552 3300047319 Ga0495674_0201789 Ga0495674_0201789_956_1303 103
553 3300047319 Ga0495674_0379131 Ga0495674_0379131_721_1062 103
554 3300047319 Ga0495674_0399541 Ga0495674_0399541_443_802 103
555 3300047319 Ga0495674_0483130 Ga0495674_0483130_14_373 103
556 3300047319 Ga0495674_0901147 Ga0495674_0901147_283_642 103
557 3300047321 Ga0495676_0176606 Ga0495676_0176606_392_733 103
558 3300047321 Ga0495676_0495223 Ga0495676_0495223_281_628 103
559 3300047322 Ga0495680_0000522 Ga0495680_0000522_25153_25500 103
560 3300047322 Ga0495680_0002970 Ga0495680_0002970_13801_14148 103
561 3300047322 Ga0495680_0021482 Ga0495680_0021482_4274_4621 103
562 3300047322 Ga0495680_0023239 Ga0495680_0023239_3272_3619 103
563 3300047322 Ga0495680_0024387 Ga0495680_0024387_1797_2147 103
564 3300047322 Ga0495680_0024852 Ga0495680_0024852_3657_4016 103
565 3300047322 Ga0495680_0314242 Ga0495680_0314242_349_690 103
566 3300047322 Ga0495680_0973816 Ga0495680_0973816_47_394 103
567 3300047444 Ga0495675_0007809 Ga0495675_0007809_169_510 103
568 3300047444 Ga0495675_0034946 Ga0495675_0034946_130_489 103
569 3300047444 Ga0495675_0135794 Ga0495675_0135794_524_871 103
570 3300047444 Ga0495675_0149659 Ga0495675_0149659_832_1182 103
571 3300047471 Ga0495684_0011772 Ga0495684_0011772_2970_3329 103
572 3300047471 Ga0495684_0028184 Ga0495684_0028184_1537_1878 103
573 3300047471 Ga0495684_0054194 Ga0495684_0054194_1029_1376 103
574 3300047471 Ga0495684_0187972 Ga0495684_0187972_1056_1406 103
575 3300047471 Ga0495684_0387917 Ga0495684_0387917_413_793 103
576 3300047471 Ga0495684_0671733 Ga0495684_0671733_48_395 103
577 3300047471 Ga0495684_0735105 Ga0495684_0735105_181_528 103
578 3300047471 Ga0495684_0840601 Ga0495684_0840601_158_505 103
579 3300047673 Ga0495593_0001378 Ga0495593_0001378_5563_5913 103
580 3300047673 Ga0495593_0013402 Ga0495593_0013402_3879_4220 103
581 3300047673 Ga0495593_0029352 Ga0495593_0029352_2327_2707 103
582 3300047673 Ga0495593_0394632 Ga0495593_0394632_194_553 103
583 3300047673 Ga0495593_0608838 Ga0495593_0608838_164_514 103
584 3300048088 Ga0495602_0001101 Ga0495602_0001101_8254_8601 103
585 3300048088 Ga0495602_0027300 Ga0495602_0027300_3208_3555 103
586 3300048088 Ga0495602_0078601 Ga0495602_0078601_1076_1423 103
587 3300048088 Ga0495602_0208504 Ga0495602_0208504_304_654 103
588 3300048088 Ga0495602_0287897 Ga0495602_0287897_150_497 103
589 3300048088 Ga0495602_0496725 Ga0495602_0496725_105_446 103
590 3300048089 Ga0495614_0073849 Ga0495614_0073849_995_1336 103
591 3300048089 Ga0495614_0123982 Ga0495614_0123982_622_981 103
592 3300048089 Ga0495614_0167276 Ga0495614_0167276_152_532 103
593 3300048903 Ga0496100_0007843 Ga0496100_0007843_5451_5798 103
594 3300048903 Ga0496100_0980306 Ga0496100_0980306_266_625 103
595 3300048904 Ga0496101_0210138 Ga0496101_0210138_673_1020 103
596 3300048904 Ga0496101_0495393 Ga0496101_0495393_449_796 103
597 3300048906 Ga0496103_0275483 Ga0496103_0275483_172_513 103
598 3300048906 Ga0496103_0540728 Ga0496103_0540728_176_523 103
599 3300048907 Ga0496104_0000398 Ga0496104_0000398_18637_18984 103
600 3300048907 Ga0496104_0080748 Ga0496104_0080748_1713_2060 103
601 3300048907 Ga0496104_0159296 Ga0496104_0159296_1181_1522 103
602 3300048908 Ga0496105_0002315 Ga0496105_0002315_7899_8246 103
603 3300048908 Ga0496105_0048728 Ga0496105_0048728_142_501 103
604 3300048909 Ga0496106_0152986 Ga0496106_0152986_909_1256 103
605 3300048909 Ga0496106_0320558 Ga0496106_0320558_749_1096 103
606 3300048909 Ga0496106_0449649 Ga0496106_0449649_616_975 103
607 3300048910 Ga0496107_0074893 Ga0496107_0074893_339_686 103
608 3300048911 Ga0496108_0003584 Ga0496108_0003584_6598_6945 103
609 3300048911 Ga0496108_0048697 Ga0496108_0048697_2258_2605 103
610 3300048912 Ga0496109_0016447 Ga0496109_0016447_5908_6255 103
611 3300048912 Ga0496109_0233952 Ga0496109_0233952_934_1293 103
612 3300048912 Ga0496109_1226849 Ga0496109_1226849_100_441 103
613 3300048913 Ga0496110_0056717 Ga0496110_0056717_2717_3076 103
614 3300048913 Ga0496110_0101351 Ga0496110_0101351_1665_2012 103
615 3300048913 Ga0496110_0535929 Ga0496110_0535929_597_938 103
616 3300048914 Ga0496111_0015587 Ga0496111_0015587_2883_3224 103
617 3300048915 Ga0496112_0000555 Ga0496112_0000555_20879_21226 103
618 3300048915 Ga0496112_0148757 Ga0496112_0148757_922_1269 103
619 3300048916 Ga0496113_0007480 Ga0496113_0007480_2620_2967 103
620 3300048916 Ga0496113_0127075 Ga0496113_0127075_1250_1597 103
621 3300048917 Ga0496114_0139113 Ga0496114_0139113_1056_1403 103
622 3300048917 Ga0496114_0150228 Ga0496114_0150228_767_1114 103
623 3300048918 Ga0496115_0095603 Ga0496115_0095603_1701_2048 103
624 3300048918 Ga0496115_0095718 Ga0496115_0095718_1134_1481 103
625 3300048918 Ga0496115_0456277 Ga0496115_0456277_144_503 103
626 3300049576 Ga0501040_1017797 Ga0501040_1017797_102_443 103
627 3300050507 nmdc:mga05p37_55814_c1 nmdc:mga05p37_55814_c1_3949_4290 103
628 3300050507 nmdc:mga05p37_943223_c1 nmdc:mga05p37_943223_c1_370_717 103
629 3300050508 nmdc:mga09592_1297538_c1 nmdc:mga09592_1297538_c1_54_395 103
630 3300050511 nmdc:mga08y16_176108_c1 nmdc:mga08y16_176108_c1_758_1105 103
631 3300050512 nmdc:mga0n895_483430_c1 nmdc:mga0n895_483430_c1_541_888 103
632 3300050512 nmdc:mga0n895_4834_c1 nmdc:mga0n895_4834_c1_811_1161 103
633 3300050513 nmdc:mga0rr50_129776_c1 nmdc:mga0rr50_129776_c1_448_795 103
634 3300050513 nmdc:mga0rr50_160290_c1 nmdc:mga0rr50_160290_c1_190_531 103
635 3300050513 nmdc:mga0rr50_33563_c1 nmdc:mga0rr50_33563_c1_1802_2149 103
636 3300050513 nmdc:mga0rr50_39424_c1 nmdc:mga0rr50_39424_c1_1244_1603 103
637 3300050513 nmdc:mga0rr50_5465_c1 nmdc:mga0rr50_5465_c1_5060_5410 103
638 3300050514 nmdc:mga08x19_134520_c1 nmdc:mga08x19_134520_c1_311_658 103
639 3300050514 nmdc:mga08x19_20767_c1 nmdc:mga08x19_20767_c1_690_1040 103
640 3300050514 nmdc:mga08x19_307987_c1 nmdc:mga08x19_307987_c1_465_806 103
641 3300050515 nmdc:mga0a205_71814_c1 nmdc:mga0a205_71814_c1_1924_2274 103
642 3300053077 Ga0495601_0003370 Ga0495601_0003370_8542_8892 103
643 3300053077 Ga0495601_0164091 Ga0495601_0164091_949_1296 103
644 3300053077 Ga0495601_0249898 Ga0495601_0249898_412_771 103
645 3300053077 Ga0495601_0279924 Ga0495601_0279924_422_763 103
646 3300053077 Ga0495601_0304230 Ga0495601_0304230_437_817 103
647 3300053077 Ga0495601_0368083 Ga0495601_0368083_133_492 103
648 3300053077 Ga0495601_0788079 Ga0495601_0788079_61_411 103
649 3300053078 Ga0495612_0099800 Ga0495612_0099800_150_500 103
650 3300053078 Ga0495612_0223220 Ga0495612_0223220_396_737 103
651 3300053084 Ga0495595_0004176 Ga0495595_0004176_3611_3958 103
652 3300053084 Ga0495595_0009675 Ga0495595_0009675_103_453 103
653 3300053084 Ga0495595_0042151 Ga0495595_0042151_449_790 103
654 3300053084 Ga0495595_0099818 Ga0495595_0099818_634_993 103
655 3300053084 Ga0495595_0333039 Ga0495595_0333039_304_654 103
656 3300053085 Ga0495619_0001126 Ga0495619_0001126_4425_4775 103
657 3300053085 Ga0495619_0035907 Ga0495619_0035907_1356_1703 103
658 3300053085 Ga0495619_0058966 Ga0495619_0058966_1474_1815 103
659 3300053085 Ga0495619_0167066 Ga0495619_0167066_384_734 103
660 3300053085 Ga0495619_0308259 Ga0495619_0308259_221_601 103
661 3300059647 Ga0587079_190935 Ga0587079_190935_15_359 103
662 3300005329 Ga0070683_100245599 Ga0070683_1002455991 104
663 3300005329 Ga0070683_102303702 Ga0070683_1023037021 104
664 3300005337 Ga0070682_100962965 Ga0070682_1009629651 104
665 3300005456 Ga0070678_100374655 Ga0070678_1003746552 104
666 3300005459 Ga0068867_101176139 Ga0068867_1011761391 104
667 3300005535 Ga0070684_100210725 Ga0070684_1002107252 104
668 3300009098 Ga0105245_12613750 Ga0105245_126137501 104
669 3300009177 Ga0105248_11845621 Ga0105248_118456212 104
670 3300013307 Ga0157372_12948521 Ga0157372_129485211 104
671 3300025911 Ga0207654_11095668 Ga0207654_110956681 104
672 3300025944 Ga0207661_11136368 Ga0207661_111363682 104
673 3300026121 Ga0207683_10219179 Ga0207683_102191792 104
674 3300031548 Ga0307408_100450980 Ga0307408_1004509802 104
675 3300031548 Ga0307408_101527736 Ga0307408_1015277361 104
676 3300031731 Ga0307405_10140583 Ga0307405_101405832 104
677 3300031731 Ga0307405_10446875 Ga0307405_104468752 104
678 3300031731 Ga0307405_10725183 Ga0307405_107251832 104
679 3300031824 Ga0307413_10109837 Ga0307413_101098372 104
680 3300031824 Ga0307413_10194829 Ga0307413_101948292 104
681 3300031824 Ga0307413_11699630 Ga0307413_116996301 104
682 3300031852 Ga0307410_10845048 Ga0307410_108450481 104
683 3300031852 Ga0307410_11349582 Ga0307410_113495821 104
684 3300031901 Ga0307406_10070477 Ga0307406_100704772 104
685 3300031901 Ga0307406_10159376 Ga0307406_101593762 104
686 3300031901 Ga0307406_10272646 Ga0307406_102726462 104
687 3300031901 Ga0307406_10581931 Ga0307406_105819311 104
688 3300031903 Ga0307407_10312309 Ga0307407_103123092 104
689 3300031903 Ga0307407_10509654 Ga0307407_105096541 104
690 3300031903 Ga0307407_11421859 Ga0307407_114218591 104
691 3300031911 Ga0307412_10753094 Ga0307412_107530941 104
692 3300031995 Ga0307409_100017384 Ga0307409_1000173842 104
693 3300031995 Ga0307409_100985556 Ga0307409_1009855562 104
694 3300031995 Ga0307409_101493794 Ga0307409_1014937941 104
695 3300031995 Ga0307409_102332438 Ga0307409_1023324381 104
696 3300032002 Ga0307416_100170664 Ga0307416_1001706642 104
697 3300032002 Ga0307416_100257444 Ga0307416_1002574441 104
698 3300032002 Ga0307416_100753070 Ga0307416_1007530702 104
699 3300032002 Ga0307416_103133877 Ga0307416_1031338771 104
700 3300032002 Ga0307416_103815936 Ga0307416_1038159361 104
701 3300032004 Ga0307414_10013607 Ga0307414_100136073 104
702 3300032004 Ga0307414_10996961 Ga0307414_109969612 104
703 3300032005 Ga0307411_10860870 Ga0307411_108608701 104
704 3300032005 Ga0307411_11942706 Ga0307411_119427061 104
705 3300032126 Ga0307415_100051097 Ga0307415_1000510972 104
706 3300032126 Ga0307415_100274201 Ga0307415_1002742012 104
707 3300032126 Ga0307415_101148679 Ga0307415_1011486792 104
708 3300032126 Ga0307415_101378515 Ga0307415_1013785151 104
709 3300041463 Ga0451804_0297374 Ga0451804_0297374_188_532 104
710 3300046500 Ga0495596_0159804 Ga0495596_0159804_435_794 104
711 3300046616 Ga0495668_0801198 Ga0495668_0801198_138_497 104
712 3300048903 Ga0496100_1206893 Ga0496100_1206893_61_405 104
713 3300035118 Ga0373954_0400496 Ga0373954_0400496_18_365 105
714 3300035691 Ga0373931_0051453 Ga0373931_0051453_1804_2163 106
715 3300005435 Ga0070714_100024330 Ga0070714_1000243306 107
716 3300005435 Ga0070714_100172340 Ga0070714_1001723403 107
717 3300028800 Ga0265338_10008774 Ga0265338_100087743 107
718 3300044693 Ga0466961_0103358 Ga0466961_0103358_117_479 107
719 3300045976 Ga0466967_1109237 Ga0466967_1109237_359_721 107
720 3300046459 Ga0495629_0284677 Ga0495629_0284677_622_972 107
721 3300046678 Ga0495599_0879568 Ga0495599_0879568_101_463 107
722 3300050512 nmdc:mga0n895_592950_c1 nmdc:mga0n895_592950_c1_381_752 107
723 3300003320 rootH2_10086014 rootH2_100860142 118

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03795

YCII

YCII-related domain

13

124

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3zo7-assembly1.cif.gz_E crystal structure of clcfe27a with substrate 0.7072 1 117
3znj-assembly1.cif.gz_3 crystal structure of unliganded clcf from r.opacus 1cp in crystal form 1. 0.6917 1 117
4fpi-assembly1.cif.gz_E crystal structure of 5-chloromuconolactone isomerase from rhodococcus opacus 1cp 0.6865 1 117
3znj-assembly3.cif.gz_9 crystal structure of unliganded clcf from r.opacus 1cp in crystal form 1. 0.6812 1 117
3zo7-assembly1.cif.gz_F crystal structure of clcfe27a with substrate 0.6806 1 117
ID Description Score Start End Superfamily
3znj100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.688 1 117 3.30.70.1060
af_O07243_1_96_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6633 1 117 3.30.70.1060
3znj100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6408 1 117 3.30.70.1060
af_O07243_1_96_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6212 1 117 3.30.70.1060
af_O07243_108_202_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6201 1 117 3.30.70.1060
ID Description Score Start End GO Terms
AF-A0A1Q7WJB4-F1-model_v4 YCII-related domain-containing protein 0.642 1 118
AF-A0A1Q7WJB4-F1-model_v4 YCII-related domain-containing protein 0.6369 1 118
AF-A0A3T1B3Q3-F1-model_v4 YCII-related domain-containing protein 0.6302 1 114
AF-A0A2V5SXJ2-F1-model_v4 Dehydrogenase 0.6283 1 118
AF-A0A402CUE9-F1-model_v4 Uncharacterized protein 0.6276 1 118

Feature Viewer

pLDDT pTM Quality
71.64 0.65 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map