F477502
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 723 | 251 | 723 | 116 |
Family's Representative Sequence
| Representative Sequence | 3300035083|Ga0373926_0093766|Ga0373926_0093766_441_821 |
| Length | 126 |
| Sequence | MAPIKTGRTSVMAEYLILIYEDENGYATASPDVFQEVMEAHNRFAQQVGEKGGKLVAGNALQPTPTATTIRGDVVTDGPFTETKEALGGYYLIDARDLDHALDIAKLCPARFGGVEVRPIMVFSGG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 2 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 3 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 25 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 37 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 38 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 39 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 41 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 42 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 43 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 44 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 45 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 46 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 52 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 53 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 54 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 55 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 56 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 57 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 58 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 69 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 82 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 83 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 84 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 85 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 86 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 87 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 88 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 89 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 116 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 120 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 121 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 122 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 123 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 124 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 125 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 126 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 127 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 128 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 129 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 130 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 131 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 132 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 133 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 134 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 135 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 136 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 137 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 138 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 139 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 140 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 141 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 142 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 143 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 144 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 145 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 146 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 147 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 148 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 149 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 150 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 151 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 152 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 153 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 154 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 155 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 156 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 157 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 158 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 159 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 160 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 161 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 162 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 163 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 164 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 165 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 166 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 167 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 168 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 169 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 170 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 171 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 172 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 173 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 174 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 175 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 176 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 177 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 224 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 225 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 226 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 227 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 228 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 229 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 230 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 231 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 232 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 233 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 234 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 235 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 236 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 237 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 238 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 240 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 241 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 242 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 243 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 244 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 245 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 246 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 251 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.34 |
| Metatranscriptomes | 1.66 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 4.84 |
| Rhizosphere | 94.47 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.69 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10086014 | 3300003320 | Bacteria | 1173 |
| 2 | JGI25404J52841_10125491 | 3300003659 | Bacteria | 542 |
| 3 | JGI25405J52794_10055132 | 3300003911 | Bacteria | 855 |
| 4 | Ga0070658_11106343 | 3300005327 | Bacteria | 689 |
| 5 | Ga0070683_100245599 | 3300005329 | Bacteria | 1703 |
| 6 | Ga0070683_100707568 | 3300005329 | Bacteria | 965 |
| 7 | Ga0070683_102303702 | 3300005329 | Bacteria | 517 |
| 8 | Ga0070690_101571269 | 3300005330 | Bacteria | 533 |
| 9 | Ga0070680_101723863 | 3300005336 | Bacteria | 543 |
| 10 | Ga0070682_100019730 | 3300005337 | Bacteria | 3959 |
| 11 | Ga0070682_100236652 | 3300005337 | Bacteria | 1309 |
| 12 | Ga0070682_100962965 | 3300005337 | Bacteria | 706 |
| 13 | Ga0068868_100075382 | 3300005338 | Bacteria | 2696 |
| 14 | Ga0070691_10820756 | 3300005341 | Bacteria | 568 |
| 15 | Ga0070661_100528424 | 3300005344 | Bacteria | 947 |
| 16 | Ga0070661_101635115 | 3300005344 | Bacteria | 545 |
| 17 | Ga0070673_101145027 | 3300005364 | Bacteria | 728 |
| 18 | Ga0070709_10000823 | 3300005434 | Bacteria | 17323 |
| 19 | Ga0070709_10024826 | 3300005434 | Bacteria | 3533 |
| 20 | Ga0070709_10697497 | 3300005434 | Bacteria | 790 |
| 21 | Ga0070714_100007188 | 3300005435 | Bacteria | 8642 |
| 22 | Ga0070714_100014979 | 3300005435 | Bacteria | 6233 |
| 23 | Ga0070714_100024330 | 3300005435 | Bacteria | 4984 |
| 24 | Ga0070714_100109759 | 3300005435 | Bacteria | 2441 |
| 25 | Ga0070714_100172340 | 3300005435 | Bacteria | 1964 |
| 26 | Ga0070714_100182476 | 3300005435 | Bacteria | 1910 |
| 27 | Ga0070714_100387957 | 3300005435 | Bacteria | 1318 |
| 28 | Ga0070714_100837634 | 3300005435 | Bacteria | 892 |
| 29 | Ga0070713_100007037 | 3300005436 | Bacteria | 7856 |
| 30 | Ga0070713_100053922 | 3300005436 | Bacteria | 3333 |
| 31 | Ga0070713_100068078 | 3300005436 | Bacteria | 3000 |
| 32 | Ga0070713_100253649 | 3300005436 | Bacteria | 1605 |
| 33 | Ga0070713_100282000 | 3300005436 | Bacteria | 1524 |
| 34 | Ga0070713_100718572 | 3300005436 | Bacteria | 954 |
| 35 | Ga0070713_100931741 | 3300005436 | Bacteria | 836 |
| 36 | Ga0070710_10000868 | 3300005437 | Bacteria | 14460 |
| 37 | Ga0070710_10022871 | 3300005437 | Bacteria | 3277 |
| 38 | Ga0070710_10172496 | 3300005437 | Bacteria | 1348 |
| 39 | Ga0070710_10355030 | 3300005437 | Bacteria | 971 |
| 40 | Ga0070711_100011851 | 3300005439 | Bacteria | 5426 |
| 41 | Ga0070711_100229955 | 3300005439 | Bacteria | 1445 |
| 42 | Ga0070711_100309635 | 3300005439 | Bacteria | 1258 |
| 43 | Ga0070711_100313195 | 3300005439 | Bacteria | 1252 |
| 44 | Ga0070711_100626758 | 3300005439 | Bacteria | 899 |
| 45 | Ga0070705_100074927 | 3300005440 | Bacteria | 2059 |
| 46 | Ga0070694_100501618 | 3300005444 | Bacteria | 966 |
| 47 | Ga0070708_100005821 | 3300005445 | Bacteria | 9785 |
| 48 | Ga0070708_100117021 | 3300005445 | Bacteria | 2454 |
| 49 | Ga0070708_101077309 | 3300005445 | Bacteria | 753 |
| 50 | Ga0070663_100539351 | 3300005455 | Bacteria | 974 |
| 51 | Ga0070678_100374655 | 3300005456 | Bacteria | 1230 |
| 52 | Ga0070678_100489332 | 3300005456 | Bacteria | 1084 |
| 53 | Ga0070678_100832249 | 3300005456 | Bacteria | 840 |
| 54 | Ga0070681_10139426 | 3300005458 | Bacteria | 2355 |
| 55 | Ga0070681_10622424 | 3300005458 | Bacteria | 994 |
| 56 | Ga0070681_11977776 | 3300005458 | Bacteria | 511 |
| 57 | Ga0068867_101176139 | 3300005459 | Bacteria | 703 |
| 58 | Ga0070706_100002492 | 3300005467 | Bacteria | 18546 |
| 59 | Ga0070706_100008070 | 3300005467 | Bacteria | 9822 |
| 60 | Ga0070706_100011680 | 3300005467 | Bacteria | 8154 |
| 61 | Ga0070706_100264192 | 3300005467 | Bacteria | 1606 |
| 62 | Ga0070707_100000199 | 3300005468 | Bacteria | 60047 |
| 63 | Ga0070707_100005322 | 3300005468 | Bacteria | 12043 |
| 64 | Ga0070707_100069704 | 3300005468 | Bacteria | 3386 |
| 65 | Ga0070707_100147984 | 3300005468 | Bacteria | 2286 |
| 66 | Ga0070698_100000264 | 3300005471 | Bacteria | 52985 |
| 67 | Ga0070698_100009166 | 3300005471 | Bacteria | 10623 |
| 68 | Ga0070698_100124972 | 3300005471 | Bacteria | 2530 |
| 69 | Ga0070698_100501578 | 3300005471 | Bacteria | 1151 |
| 70 | Ga0070698_101064597 | 3300005471 | Bacteria | 757 |
| 71 | Ga0070699_100144100 | 3300005518 | Bacteria | 2105 |
| 72 | Ga0070699_101815849 | 3300005518 | Bacteria | 558 |
| 73 | Ga0070679_100989066 | 3300005530 | Bacteria | 785 |
| 74 | Ga0070679_101197011 | 3300005530 | Bacteria | 705 |
| 75 | Ga0070679_101972476 | 3300005530 | Bacteria | 533 |
| 76 | Ga0070684_100210725 | 3300005535 | Bacteria | 1771 |
| 77 | Ga0070684_100421866 | 3300005535 | Bacteria | 1231 |
| 78 | Ga0070697_100064922 | 3300005536 | Bacteria | 2982 |
| 79 | Ga0070697_101218939 | 3300005536 | Bacteria | 671 |
| 80 | Ga0070686_101022406 | 3300005544 | Bacteria | 679 |
| 81 | Ga0070695_100803350 | 3300005545 | Bacteria | 754 |
| 82 | Ga0070665_100020355 | 3300005548 | Bacteria | 6664 |
| 83 | Ga0070665_100391780 | 3300005548 | Bacteria | 1397 |
| 84 | Ga0070665_100643874 | 3300005548 | Bacteria | 1073 |
| 85 | Ga0070704_100724648 | 3300005549 | Bacteria | 884 |
| 86 | Ga0068855_100290727 | 3300005563 | Bacteria | 1812 |
| 87 | Ga0068857_100322602 | 3300005577 | Bacteria | 1427 |
| 88 | Ga0068856_100008925 | 3300005614 | Bacteria | 9751 |
| 89 | Ga0068856_100027025 | 3300005614 | Bacteria | 5598 |
| 90 | Ga0068856_100568478 | 3300005614 | Bacteria | 1155 |
| 91 | Ga0068856_101458274 | 3300005614 | Bacteria | 698 |
| 92 | Ga0070702_101434120 | 3300005615 | Bacteria | 566 |
| 93 | Ga0068864_100142029 | 3300005618 | Bacteria | 2167 |
| 94 | Ga0068863_100264671 | 3300005841 | Bacteria | 1663 |
| 95 | Ga0068863_101330103 | 3300005841 | Bacteria | 726 |
| 96 | Ga0068860_101830214 | 3300005843 | Bacteria | 629 |
| 97 | Ga0068862_100561491 | 3300005844 | Bacteria | 1091 |
| 98 | Ga0081455_10003996 | 3300005937 | Bacteria | 16742 |
| 99 | Ga0081455_10258179 | 3300005937 | Bacteria | 1270 |
| 100 | Ga0081540_1002480 | 3300005983 | Bacteria | 15030 |
| 101 | Ga0081540_1152629 | 3300005983 | Bacteria | 909 |
| 102 | Ga0070717_10016987 | 3300006028 | Bacteria | 5652 |
| 103 | Ga0070717_10038389 | 3300006028 | Bacteria | 3892 |
| 104 | Ga0070717_10084850 | 3300006028 | Bacteria | 2664 |
| 105 | Ga0070717_10161866 | 3300006028 | Bacteria | 1942 |
| 106 | Ga0070717_10174068 | 3300006028 | Bacteria | 1873 |
| 107 | Ga0070717_10216055 | 3300006028 | Bacteria | 1684 |
| 108 | Ga0070717_10707240 | 3300006028 | Bacteria | 915 |
| 109 | Ga0070717_11074894 | 3300006028 | Bacteria | 733 |
| 110 | Ga0070715_10001553 | 3300006163 | Bacteria | 6725 |
| 111 | Ga0070715_10085323 | 3300006163 | Bacteria | 1442 |
| 112 | Ga0070715_10277807 | 3300006163 | Bacteria | 887 |
| 113 | Ga0070716_100003243 | 3300006173 | Bacteria | 7639 |
| 114 | Ga0070716_100011703 | 3300006173 | Bacteria | 4422 |
| 115 | Ga0070716_100088472 | 3300006173 | Bacteria | 1868 |
| 116 | Ga0070716_100745331 | 3300006173 | Bacteria | 753 |
| 117 | Ga0070712_100017503 | 3300006175 | Bacteria | 4640 |
| 118 | Ga0070712_100024410 | 3300006175 | Bacteria | 4006 |
| 119 | Ga0070712_100095396 | 3300006175 | Bacteria | 2188 |
| 120 | Ga0097621_101367322 | 3300006237 | Bacteria | 670 |
| 121 | Ga0075428_100260354 | 3300006844 | Bacteria | 1868 |
| 122 | Ga0075431_100274473 | 3300006847 | Bacteria | 1708 |
| 123 | Ga0075433_10256953 | 3300006852 | Bacteria | 1549 |
| 124 | Ga0075434_100007491 | 3300006871 | Bacteria | 10099 |
| 125 | Ga0075429_100003605 | 3300006880 | Bacteria | 13196 |
| 126 | Ga0075436_100020302 | 3300006914 | Bacteria | 4560 |
| 127 | Ga0075436_100313677 | 3300006914 | Bacteria | 1126 |
| 128 | Ga0075436_100519349 | 3300006914 | Bacteria | 872 |
| 129 | Ga0075435_100041630 | 3300007076 | Bacteria | 3673 |
| 130 | Ga0075435_100163400 | 3300007076 | Bacteria | 1876 |
| 131 | Ga0075435_100712075 | 3300007076 | Bacteria | 873 |
| 132 | Ga0075435_101401104 | 3300007076 | Bacteria | 613 |
| 133 | Ga0105251_10287464 | 3300009011 | Bacteria | 744 |
| 134 | Ga0105240_11906369 | 3300009093 | Bacteria | 618 |
| 135 | Ga0111539_10026492 | 3300009094 | Bacteria | 7087 |
| 136 | Ga0105245_10016540 | 3300009098 | Bacteria | 6436 |
| 137 | Ga0105245_11401781 | 3300009098 | Bacteria | 749 |
| 138 | Ga0105245_12613750 | 3300009098 | Bacteria | 558 |
| 139 | Ga0105247_10417442 | 3300009101 | Bacteria | 960 |
| 140 | Ga0105247_10556569 | 3300009101 | Bacteria | 844 |
| 141 | Ga0114129_10010771 | 3300009147 | Bacteria | 13031 |
| 142 | Ga0114129_10018645 | 3300009147 | Bacteria | 9879 |
| 143 | Ga0105241_10356832 | 3300009174 | Bacteria | 1271 |
| 144 | Ga0105248_10119398 | 3300009177 | Bacteria | 2974 |
| 145 | Ga0105248_11845621 | 3300009177 | Bacteria | 686 |
| 146 | Ga0105237_10493119 | 3300009545 | Bacteria | 1231 |
| 147 | Ga0105249_10780429 | 3300009553 | Bacteria | 1019 |
| 148 | Ga0099796_10136017 | 3300010159 | Bacteria | 957 |
| 149 | Ga0105239_10197953 | 3300010375 | Bacteria | 2250 |
| 150 | Ga0105239_10258711 | 3300010375 | Bacteria | 1956 |
| 151 | Ga0105239_11010799 | 3300010375 | Bacteria | 956 |
| 152 | Ga0105239_12460734 | 3300010375 | Bacteria | 607 |
| 153 | Ga0157370_10032973 | 3300013104 | Bacteria | 5052 |
| 154 | Ga0157369_10039515 | 3300013105 | Bacteria | 5155 |
| 155 | Ga0157374_10231720 | 3300013296 | Bacteria | 1814 |
| 156 | Ga0157378_10207852 | 3300013297 | Bacteria | 1855 |
| 157 | Ga0157378_10264984 | 3300013297 | Bacteria | 1650 |
| 158 | Ga0157378_12573878 | 3300013297 | Bacteria | 561 |
| 159 | Ga0163162_10260785 | 3300013306 | Bacteria | 1865 |
| 160 | Ga0157372_11795945 | 3300013307 | Bacteria | 705 |
| 161 | Ga0157372_12948521 | 3300013307 | Bacteria | 544 |
| 162 | Ga0157375_10054315 | 3300013308 | Bacteria | 3945 |
| 163 | Ga0163163_10047123 | 3300014325 | Bacteria | 4236 |
| 164 | Ga0163163_10416366 | 3300014325 | Bacteria | 1402 |
| 165 | Ga0157379_10132107 | 3300014968 | Bacteria | 2247 |
| 166 | Ga0157376_10095146 | 3300014969 | Bacteria | 2590 |
| 167 | Ga0157376_11204371 | 3300014969 | Bacteria | 785 |
| 168 | Ga0163161_10188456 | 3300017792 | Bacteria | 1584 |
| 169 | Ga0197907_10771707 | 3300020069 | Bacteria | 3419 |
| 170 | Ga0206356_11619378 | 3300020070 | Bacteria | 1010 |
| 171 | Ga0206349_1809199 | 3300020075 | Bacteria | 545 |
| 172 | Ga0206355_1176711 | 3300020076 | Bacteria | 710 |
| 173 | Ga0206355_1286002 | 3300020076 | Bacteria | 787 |
| 174 | Ga0206350_11052987 | 3300020080 | Bacteria | 1061 |
| 175 | Ga0206354_10046509 | 3300020081 | Bacteria | 812 |
| 176 | Ga0206353_10146695 | 3300020082 | Bacteria | 1016 |
| 177 | Ga0224712_10039731 | 3300022467 | Bacteria | 1766 |
| 178 | Ga0224712_10410895 | 3300022467 | Bacteria | 646 |
| 179 | Ga0224712_10621598 | 3300022467 | Bacteria | 528 |
| 180 | Ga0207692_10002632 | 3300025898 | Bacteria | 6904 |
| 181 | Ga0207692_10026757 | 3300025898 | Bacteria | 2709 |
| 182 | Ga0207692_10071464 | 3300025898 | Bacteria | 1830 |
| 183 | Ga0207692_10122656 | 3300025898 | Bacteria | 1457 |
| 184 | Ga0207692_10548622 | 3300025898 | Bacteria | 738 |
| 185 | Ga0207710_10257972 | 3300025900 | Bacteria | 873 |
| 186 | Ga0207685_10003617 | 3300025905 | Bacteria | 3789 |
| 187 | Ga0207685_10004266 | 3300025905 | Bacteria | 3609 |
| 188 | Ga0207685_10017784 | 3300025905 | Bacteria | 2308 |
| 189 | Ga0207699_10000458 | 3300025906 | Bacteria | 20841 |
| 190 | Ga0207699_10001066 | 3300025906 | Bacteria | 12960 |
| 191 | Ga0207699_10021537 | 3300025906 | Bacteria | 3476 |
| 192 | Ga0207699_10253190 | 3300025906 | Bacteria | 1214 |
| 193 | Ga0207684_10001761 | 3300025910 | Bacteria | 22878 |
| 194 | Ga0207684_10008113 | 3300025910 | Bacteria | 9362 |
| 195 | Ga0207684_10093884 | 3300025910 | Bacteria | 2559 |
| 196 | Ga0207684_10235712 | 3300025910 | Bacteria | 1579 |
| 197 | Ga0207684_10366728 | 3300025910 | Bacteria | 1239 |
| 198 | Ga0207654_11095668 | 3300025911 | Bacteria | 580 |
| 199 | Ga0207707_10491159 | 3300025912 | Bacteria | 1048 |
| 200 | Ga0207671_10094985 | 3300025914 | Bacteria | 2251 |
| 201 | Ga0207693_10011453 | 3300025915 | Bacteria | 7176 |
| 202 | Ga0207693_10017652 | 3300025915 | Bacteria | 5690 |
| 203 | Ga0207693_10031669 | 3300025915 | Bacteria | 4178 |
| 204 | Ga0207693_10659718 | 3300025915 | Bacteria | 812 |
| 205 | Ga0207693_10832993 | 3300025915 | Bacteria | 710 |
| 206 | Ga0207663_10002072 | 3300025916 | Bacteria | 9557 |
| 207 | Ga0207663_10005894 | 3300025916 | Bacteria | 6217 |
| 208 | Ga0207663_10477708 | 3300025916 | Bacteria | 965 |
| 209 | Ga0207663_10892311 | 3300025916 | Bacteria | 711 |
| 210 | Ga0207660_10998748 | 3300025917 | Bacteria | 683 |
| 211 | Ga0207652_10334736 | 3300025921 | Bacteria | 1367 |
| 212 | Ga0207652_10625898 | 3300025921 | Bacteria | 964 |
| 213 | Ga0207646_10000278 | 3300025922 | Bacteria | 70066 |
| 214 | Ga0207646_10003994 | 3300025922 | Bacteria | 16334 |
| 215 | Ga0207646_10023928 | 3300025922 | Bacteria | 5603 |
| 216 | Ga0207646_10205035 | 3300025922 | Bacteria | 1781 |
| 217 | Ga0207687_10156617 | 3300025927 | Bacteria | 1744 |
| 218 | Ga0207700_10001366 | 3300025928 | Bacteria | 13833 |
| 219 | Ga0207700_10004397 | 3300025928 | Bacteria | 8301 |
| 220 | Ga0207700_10070074 | 3300025928 | Bacteria | 2694 |
| 221 | Ga0207700_10076350 | 3300025928 | Bacteria | 2599 |
| 222 | Ga0207700_10100254 | 3300025928 | Bacteria | 2308 |
| 223 | Ga0207700_10154117 | 3300025928 | Bacteria | 1902 |
| 224 | Ga0207700_10678419 | 3300025928 | Bacteria | 919 |
| 225 | Ga0207664_10001412 | 3300025929 | Bacteria | 15806 |
| 226 | Ga0207664_10015483 | 3300025929 | Bacteria | 5537 |
| 227 | Ga0207664_10028261 | 3300025929 | Bacteria | 4260 |
| 228 | Ga0207664_10159783 | 3300025929 | Bacteria | 1921 |
| 229 | Ga0207664_10213288 | 3300025929 | Bacteria | 1671 |
| 230 | Ga0207664_10918743 | 3300025929 | Bacteria | 786 |
| 231 | Ga0207664_11801921 | 3300025929 | Bacteria | 535 |
| 232 | Ga0207664_11821215 | 3300025929 | Bacteria | 531 |
| 233 | Ga0207665_10000215 | 3300025939 | Bacteria | 38950 |
| 234 | Ga0207665_10002825 | 3300025939 | Bacteria | 11643 |
| 235 | Ga0207665_10020664 | 3300025939 | Bacteria | 4328 |
| 236 | Ga0207665_10051109 | 3300025939 | Bacteria | 2781 |
| 237 | Ga0207711_10840299 | 3300025941 | Bacteria | 855 |
| 238 | Ga0207661_10470094 | 3300025944 | Bacteria | 1147 |
| 239 | Ga0207661_11136368 | 3300025944 | Bacteria | 719 |
| 240 | Ga0207667_10499843 | 3300025949 | Bacteria | 1233 |
| 241 | Ga0207677_10207255 | 3300026023 | Bacteria | 1563 |
| 242 | Ga0207703_10281218 | 3300026035 | Bacteria | 1511 |
| 243 | Ga0207702_11476938 | 3300026078 | Bacteria | 673 |
| 244 | Ga0207676_10017375 | 3300026095 | Bacteria | 5213 |
| 245 | Ga0207674_12051485 | 3300026116 | Bacteria | 536 |
| 246 | Ga0207683_10057274 | 3300026121 | Bacteria | 3421 |
| 247 | Ga0207683_10219179 | 3300026121 | Bacteria | 1733 |
| 248 | Ga0207683_10464597 | 3300026121 | Bacteria | 1167 |
| 249 | Ga0207683_12070779 | 3300026121 | Bacteria | 517 |
| 250 | Ga0207428_10018162 | 3300027907 | Bacteria | 6013 |
| 251 | Ga0268266_10017666 | 3300028379 | Bacteria | 6083 |
| 252 | Ga0268266_12116669 | 3300028379 | Bacteria | 535 |
| 253 | Ga0268265_11986792 | 3300028380 | Bacteria | 589 |
| 254 | Ga0268264_12132961 | 3300028381 | Bacteria | 569 |
| 255 | Ga0265336_10004336 | 3300028666 | Bacteria | 5376 |
| 256 | Ga0265338_10000827 | 3300028800 | Bacteria | 52237 |
| 257 | Ga0265338_10008774 | 3300028800 | Bacteria | 12219 |
| 258 | Ga0307408_100450980 | 3300031548 | Bacteria | 1116 |
| 259 | Ga0307408_101527736 | 3300031548 | Bacteria | 632 |
| 260 | Ga0307405_10140583 | 3300031731 | Bacteria | 1682 |
| 261 | Ga0307405_10446875 | 3300031731 | Bacteria | 1024 |
| 262 | Ga0307405_10725183 | 3300031731 | Bacteria | 826 |
| 263 | Ga0307413_10109837 | 3300031824 | Bacteria | 1844 |
| 264 | Ga0307413_10194829 | 3300031824 | Bacteria | 1458 |
| 265 | Ga0307413_11699630 | 3300031824 | Bacteria | 563 |
| 266 | Ga0307410_10845048 | 3300031852 | Bacteria | 781 |
| 267 | Ga0307410_11349582 | 3300031852 | Bacteria | 625 |
| 268 | Ga0307406_10070477 | 3300031901 | Bacteria | 2289 |
| 269 | Ga0307406_10159376 | 3300031901 | Bacteria | 1620 |
| 270 | Ga0307406_10272646 | 3300031901 | Bacteria | 1286 |
| 271 | Ga0307406_10581931 | 3300031901 | Bacteria | 920 |
| 272 | Ga0307407_10140418 | 3300031903 | Bacteria | 1558 |
| 273 | Ga0307407_10312309 | 3300031903 | Bacteria | 1100 |
| 274 | Ga0307407_10509654 | 3300031903 | Bacteria | 883 |
| 275 | Ga0307407_11421859 | 3300031903 | Bacteria | 547 |
| 276 | Ga0307412_10753094 | 3300031911 | Bacteria | 841 |
| 277 | Ga0307409_100017384 | 3300031995 | Bacteria | 4791 |
| 278 | Ga0307409_100985556 | 3300031995 | Bacteria | 860 |
| 279 | Ga0307409_101493794 | 3300031995 | Bacteria | 703 |
| 280 | Ga0307409_102332438 | 3300031995 | Bacteria | 564 |
| 281 | Ga0307416_100170664 | 3300032002 | Bacteria | 2024 |
| 282 | Ga0307416_100257444 | 3300032002 | Bacteria | 1703 |
| 283 | Ga0307416_100753070 | 3300032002 | Bacteria | 1067 |
| 284 | Ga0307416_102440675 | 3300032002 | Bacteria | 622 |
| 285 | Ga0307416_102706554 | 3300032002 | Bacteria | 593 |
| 286 | Ga0307416_103133877 | 3300032002 | Bacteria | 553 |
| 287 | Ga0307416_103691138 | 3300032002 | Bacteria | 512 |
| 288 | Ga0307416_103815936 | 3300032002 | Bacteria | 505 |
| 289 | Ga0307414_10013607 | 3300032004 | Bacteria | 4850 |
| 290 | Ga0307414_10996961 | 3300032004 | Bacteria | 771 |
| 291 | Ga0307411_10284858 | 3300032005 | Bacteria | 1317 |
| 292 | Ga0307411_10860870 | 3300032005 | Bacteria | 803 |
| 293 | Ga0307411_11131526 | 3300032005 | Bacteria | 707 |
| 294 | Ga0307411_11942706 | 3300032005 | Bacteria | 548 |
| 295 | Ga0307415_100051097 | 3300032126 | Bacteria | 2804 |
| 296 | Ga0307415_100274201 | 3300032126 | Bacteria | 1383 |
| 297 | Ga0307415_100788873 | 3300032126 | Bacteria | 866 |
| 298 | Ga0307415_101148679 | 3300032126 | Bacteria | 729 |
| 299 | Ga0307415_101378515 | 3300032126 | Bacteria | 670 |
| 300 | Ga0307507_10000013 | 3300033179 | Bacteria | 242708 |
| 301 | Ga0373930_0133985 | 3300034816 | Bacteria | 612 |
| 302 | Ga0373948_0022910 | 3300034817 | Bacteria | 1207 |
| 303 | Ga0373958_0012635 | 3300034819 | Bacteria | 1448 |
| 304 | Ga0373926_0000330 | 3300035083 | Bacteria | 11877 |
| 305 | Ga0373926_0093766 | 3300035083 | Bacteria | 1118 |
| 306 | Ga0373926_0116451 | 3300035083 | Bacteria | 1006 |
| 307 | Ga0373934_0000006 | 3300035086 | Bacteria | 81073 |
| 308 | Ga0373934_0017152 | 3300035086 | Bacteria | 2761 |
| 309 | Ga0373934_0099540 | 3300035086 | Bacteria | 1175 |
| 310 | Ga0373934_0113793 | 3300035086 | Bacteria | 1098 |
| 311 | Ga0373940_0004399 | 3300035088 | Bacteria | 2973 |
| 312 | Ga0373944_0038875 | 3300035089 | Bacteria | 1463 |
| 313 | Ga0373944_0190785 | 3300035089 | Bacteria | 738 |
| 314 | Ga0373949_0092032 | 3300035090 | Bacteria | 821 |
| 315 | Ga0373923_0006532 | 3300035111 | Bacteria | 4039 |
| 316 | Ga0373923_0027565 | 3300035111 | Bacteria | 2267 |
| 317 | Ga0373923_0057518 | 3300035111 | Bacteria | 1644 |
| 318 | Ga0373923_0111872 | 3300035111 | Bacteria | 1213 |
| 319 | Ga0373923_0164654 | 3300035111 | Bacteria | 1013 |
| 320 | Ga0373923_0459538 | 3300035111 | Bacteria | 618 |
| 321 | Ga0373932_0040525 | 3300035112 | Bacteria | 1341 |
| 322 | Ga0373936_0006261 | 3300035113 | Bacteria | 4488 |
| 323 | Ga0373936_0145008 | 3300035113 | Bacteria | 1027 |
| 324 | Ga0373936_0269091 | 3300035113 | Bacteria | 764 |
| 325 | Ga0373936_0480550 | 3300035113 | Bacteria | 576 |
| 326 | Ga0373945_0011759 | 3300035116 | Bacteria | 2898 |
| 327 | Ga0373945_0104958 | 3300035116 | Bacteria | 1110 |
| 328 | Ga0373945_0106313 | 3300035116 | Bacteria | 1104 |
| 329 | Ga0373953_0015552 | 3300035117 | Bacteria | 2760 |
| 330 | Ga0373953_0073428 | 3300035117 | Bacteria | 1414 |
| 331 | Ga0373953_0211589 | 3300035117 | Bacteria | 839 |
| 332 | Ga0373953_0213913 | 3300035117 | Bacteria | 834 |
| 333 | Ga0373954_0006092 | 3300035118 | Bacteria | 5248 |
| 334 | Ga0373954_0008686 | 3300035118 | Bacteria | 4467 |
| 335 | Ga0373954_0169587 | 3300035118 | Bacteria | 1069 |
| 336 | Ga0373954_0400496 | 3300035118 | Bacteria | 679 |
| 337 | Ga0373954_0560703 | 3300035118 | Bacteria | 566 |
| 338 | Ga0373956_0000498 | 3300035119 | Bacteria | 16085 |
| 339 | Ga0373956_0017185 | 3300035119 | Bacteria | 3047 |
| 340 | Ga0373956_0037527 | 3300035119 | Bacteria | 2141 |
| 341 | Ga0373956_0037610 | 3300035119 | Bacteria | 2139 |
| 342 | Ga0373956_0088020 | 3300035119 | Bacteria | 1430 |
| 343 | Ga0373956_0092424 | 3300035119 | Bacteria | 1397 |
| 344 | Ga0373957_0000210 | 3300035120 | Bacteria | 14807 |
| 345 | Ga0373957_0002317 | 3300035120 | Bacteria | 5407 |
| 346 | Ga0373957_0004962 | 3300035120 | Bacteria | 4096 |
| 347 | Ga0373957_0163977 | 3300035120 | Bacteria | 916 |
| 348 | Ga0373957_0234395 | 3300035120 | Bacteria | 770 |
| 349 | Ga0373960_0010117 | 3300035121 | Bacteria | 2298 |
| 350 | Ga0373943_0294958 | 3300035170 | Bacteria | 919 |
| 351 | Ga0373943_0386406 | 3300035170 | Bacteria | 806 |
| 352 | Ga0373943_0890718 | 3300035170 | Bacteria | 531 |
| 353 | Ga0373946_0022333 | 3300035171 | Bacteria | 2462 |
| 354 | Ga0373946_0176232 | 3300035171 | Bacteria | 1012 |
| 355 | Ga0373946_0453146 | 3300035171 | Bacteria | 653 |
| 356 | Ga0373955_0000034 | 3300035172 | Bacteria | 53524 |
| 357 | Ga0373955_0006038 | 3300035172 | Bacteria | 5495 |
| 358 | Ga0373955_0024386 | 3300035172 | Bacteria | 3093 |
| 359 | Ga0373955_0042477 | 3300035172 | Bacteria | 2441 |
| 360 | Ga0373955_0088303 | 3300035172 | Bacteria | 1763 |
| 361 | Ga0373955_0440035 | 3300035172 | Bacteria | 794 |
| 362 | Ga0373942_0225742 | 3300035207 | Bacteria | 629 |
| 363 | Ga0373961_0162511 | 3300035241 | Bacteria | 768 |
| 364 | Ga0373962_0187279 | 3300035242 | Bacteria | 695 |
| 365 | Ga0373924_0000343 | 3300035410 | Bacteria | 14274 |
| 366 | Ga0373924_0003982 | 3300035410 | Bacteria | 5127 |
| 367 | Ga0373924_0014387 | 3300035410 | Bacteria | 2989 |
| 368 | Ga0373924_0039093 | 3300035410 | Bacteria | 1937 |
| 369 | Ga0373924_0199477 | 3300035410 | Bacteria | 882 |
| 370 | Ga0373924_0507378 | 3300035410 | Bacteria | 542 |
| 371 | Ga0373931_0051453 | 3300035691 | Bacteria | 2194 |
| 372 | Ga0373931_0210179 | 3300035691 | Bacteria | 1166 |
| 373 | Ga0373935_0021585 | 3300035692 | Bacteria | 3943 |
| 374 | Ga0373935_0038249 | 3300035692 | Bacteria | 3003 |
| 375 | Ga0373935_0074216 | 3300035692 | Bacteria | 2198 |
| 376 | Ga0373935_0126976 | 3300035692 | Bacteria | 1710 |
| 377 | Ga0373935_0334158 | 3300035692 | Bacteria | 1077 |
| 378 | Ga0373935_0378279 | 3300035692 | Bacteria | 1013 |
| 379 | Ga0373927_0216435 | 3300035695 | Bacteria | 1258 |
| 380 | Ga0373933_0000161 | 3300035724 | Bacteria | 43422 |
| 381 | Ga0373933_0001656 | 3300035724 | Bacteria | 12954 |
| 382 | Ga0373933_0019627 | 3300035724 | Bacteria | 3821 |
| 383 | Ga0373933_0033671 | 3300035724 | Bacteria | 2982 |
| 384 | Ga0373933_0397174 | 3300035724 | Bacteria | 899 |
| 385 | Ga0373933_0476249 | 3300035724 | Bacteria | 817 |
| 386 | Ga0373933_0569257 | 3300035724 | Bacteria | 743 |
| 387 | Ga0373947_0000002 | 3300035725 | Bacteria | 383924 |
| 388 | Ga0373947_0055036 | 3300035725 | Bacteria | 2402 |
| 389 | Ga0373947_0152211 | 3300035725 | Bacteria | 1490 |
| 390 | Ga0373947_0282317 | 3300035725 | Bacteria | 1104 |
| 391 | Ga0373947_0364616 | 3300035725 | Bacteria | 971 |
| 392 | Ga0373947_0367160 | 3300035725 | Bacteria | 967 |
| 393 | Ga0373937_0000126 | 3300036401 | Bacteria | 73508 |
| 394 | Ga0373937_0074697 | 3300036401 | Bacteria | 3128 |
| 395 | Ga0373937_0090176 | 3300036401 | Bacteria | 2839 |
| 396 | Ga0373937_0127435 | 3300036401 | Bacteria | 2375 |
| 397 | Ga0373937_0140947 | 3300036401 | Bacteria | 2255 |
| 398 | Ga0373937_0174808 | 3300036401 | Bacteria | 2015 |
| 399 | Ga0373937_0487825 | 3300036401 | Bacteria | 1170 |
| 400 | Ga0373937_0867575 | 3300036401 | Bacteria | 851 |
| 401 | Ga0373925_0001213 | 3300037068 | Bacteria | 22751 |
| 402 | Ga0373925_0038055 | 3300037068 | Bacteria | 3554 |
| 403 | Ga0373925_0048312 | 3300037068 | Bacteria | 3170 |
| 404 | Ga0373925_0051316 | 3300037068 | Bacteria | 3079 |
| 405 | Ga0373925_0175062 | 3300037068 | Bacteria | 1695 |
| 406 | Ga0373925_0211319 | 3300037068 | Bacteria | 1545 |
| 407 | Ga0373925_0241338 | 3300037068 | Bacteria | 1447 |
| 408 | Ga0373925_0275352 | 3300037068 | Bacteria | 1354 |
| 409 | Ga0373925_1649305 | 3300037068 | Bacteria | 524 |
| 410 | Ga0436364_0398717 | 3300037853 | Bacteria | 1102 |
| 411 | Ga0436364_1283416 | 3300037853 | Bacteria | 2506 |
| 412 | Ga0436363_0426285 | 3300039450 | Bacteria | 3134 |
| 413 | Ga0451804_0297374 | 3300041463 | Bacteria | 577 |
| 414 | Ga0466969_0007516 | 3300044656 | Bacteria | 5793 |
| 415 | Ga0466969_0172100 | 3300044656 | Bacteria | 992 |
| 416 | Ga0466966_0081773 | 3300044684 | Bacteria | 2010 |
| 417 | Ga0466961_0103358 | 3300044693 | Bacteria | 1794 |
| 418 | Ga0466961_0148531 | 3300044693 | Bacteria | 1464 |
| 419 | Ga0466961_0660174 | 3300044693 | Bacteria | 627 |
| 420 | Ga0466963_0148482 | 3300044694 | Bacteria | 1627 |
| 421 | Ga0466963_0784484 | 3300044694 | Bacteria | 672 |
| 422 | Ga0466971_0050231 | 3300044719 | Bacteria | 1876 |
| 423 | Ga0466960_0077523 | 3300044901 | Bacteria | 1667 |
| 424 | Ga0466959_0032173 | 3300045049 | Bacteria | 3882 |
| 425 | Ga0466958_0447267 | 3300045836 | Bacteria | 836 |
| 426 | Ga0466967_1109237 | 3300045976 | Bacteria | 788 |
| 427 | Ga0495592_0000030 | 3300046454 | Bacteria | 129103 |
| 428 | Ga0495592_0002427 | 3300046454 | Bacteria | 13135 |
| 429 | Ga0495592_0008472 | 3300046454 | Bacteria | 7716 |
| 430 | Ga0495592_0064532 | 3300046454 | Bacteria | 2683 |
| 431 | Ga0495592_0075825 | 3300046454 | Bacteria | 2441 |
| 432 | Ga0495629_0001800 | 3300046459 | Bacteria | 16788 |
| 433 | Ga0495629_0018263 | 3300046459 | Bacteria | 5022 |
| 434 | Ga0495629_0150182 | 3300046459 | Bacteria | 1619 |
| 435 | Ga0495629_0284677 | 3300046459 | Bacteria | 1134 |
| 436 | Ga0495641_0025433 | 3300046461 | Bacteria | 2906 |
| 437 | Ga0495641_0032006 | 3300046461 | Bacteria | 2507 |
| 438 | Ga0495641_0088219 | 3300046461 | Bacteria | 1387 |
| 439 | Ga0495651_0000221 | 3300046462 | Bacteria | 43412 |
| 440 | Ga0495651_0008518 | 3300046462 | Bacteria | 7858 |
| 441 | Ga0495651_0010326 | 3300046462 | Bacteria | 7174 |
| 442 | Ga0495651_0096506 | 3300046462 | Bacteria | 2208 |
| 443 | Ga0495651_0148920 | 3300046462 | Bacteria | 1689 |
| 444 | Ga0495651_0474604 | 3300046462 | Bacteria | 804 |
| 445 | Ga0495653_0000895 | 3300046463 | Bacteria | 23073 |
| 446 | Ga0495653_0014521 | 3300046463 | Bacteria | 6426 |
| 447 | Ga0495653_0051335 | 3300046463 | Bacteria | 3166 |
| 448 | Ga0495653_0052881 | 3300046463 | Bacteria | 3110 |
| 449 | Ga0495653_0111354 | 3300046463 | Bacteria | 1966 |
| 450 | Ga0495653_0146733 | 3300046463 | Bacteria | 1652 |
| 451 | Ga0495653_0313790 | 3300046463 | Bacteria | 1018 |
| 452 | Ga0495653_0798770 | 3300046463 | Bacteria | 567 |
| 453 | Ga0495580_0281028 | 3300046472 | Bacteria | 1135 |
| 454 | Ga0495582_0012433 | 3300046473 | Bacteria | 4690 |
| 455 | Ga0495582_0115806 | 3300046473 | Bacteria | 1507 |
| 456 | Ga0495582_0320667 | 3300046473 | Bacteria | 891 |
| 457 | Ga0495582_0367000 | 3300046473 | Bacteria | 829 |
| 458 | Ga0495639_0119891 | 3300046475 | Bacteria | 1254 |
| 459 | Ga0495639_0445845 | 3300046475 | Bacteria | 657 |
| 460 | Ga0495639_0735357 | 3300046475 | Bacteria | 510 |
| 461 | Ga0495662_0035385 | 3300046476 | Bacteria | 2409 |
| 462 | Ga0495662_0054277 | 3300046476 | Bacteria | 1935 |
| 463 | Ga0495662_0155992 | 3300046476 | Bacteria | 1124 |
| 464 | Ga0495662_0277993 | 3300046476 | Bacteria | 824 |
| 465 | Ga0495662_0351465 | 3300046476 | Bacteria | 725 |
| 466 | Ga0495664_0002344 | 3300046477 | Bacteria | 10143 |
| 467 | Ga0495664_0017095 | 3300046477 | Bacteria | 4143 |
| 468 | Ga0495664_0037941 | 3300046477 | Bacteria | 2844 |
| 469 | Ga0495664_0122797 | 3300046477 | Bacteria | 1570 |
| 470 | Ga0495664_0909054 | 3300046477 | Bacteria | 514 |
| 471 | Ga0495594_0070211 | 3300046499 | Bacteria | 1947 |
| 472 | Ga0495594_0711103 | 3300046499 | Bacteria | 568 |
| 473 | Ga0495596_0159804 | 3300046500 | Bacteria | 876 |
| 474 | Ga0495608_0000191 | 3300046511 | Bacteria | 43426 |
| 475 | Ga0495608_0014956 | 3300046511 | Bacteria | 5385 |
| 476 | Ga0495608_0046647 | 3300046511 | Bacteria | 2882 |
| 477 | Ga0495608_0102011 | 3300046511 | Bacteria | 1849 |
| 478 | Ga0495608_0176632 | 3300046511 | Bacteria | 1352 |
| 479 | Ga0495618_0010093 | 3300046514 | Bacteria | 5710 |
| 480 | Ga0495618_0060083 | 3300046514 | Bacteria | 2409 |
| 481 | Ga0495618_0065574 | 3300046514 | Bacteria | 2308 |
| 482 | Ga0495628_0003830 | 3300046516 | Bacteria | 13409 |
| 483 | Ga0495628_0034341 | 3300046516 | Bacteria | 4079 |
| 484 | Ga0495628_0078885 | 3300046516 | Bacteria | 2560 |
| 485 | Ga0495628_0083824 | 3300046516 | Bacteria | 2474 |
| 486 | Ga0495628_0131071 | 3300046516 | Bacteria | 1917 |
| 487 | Ga0495628_0230854 | 3300046516 | Bacteria | 1387 |
| 488 | Ga0495628_0708927 | 3300046516 | Bacteria | 710 |
| 489 | Ga0495630_0112125 | 3300046517 | Bacteria | 2065 |
| 490 | Ga0495630_0159618 | 3300046517 | Bacteria | 1717 |
| 491 | Ga0495630_0205176 | 3300046517 | Bacteria | 1504 |
| 492 | Ga0495630_0274243 | 3300046517 | Bacteria | 1288 |
| 493 | Ga0495630_0389478 | 3300046517 | Bacteria | 1067 |
| 494 | Ga0495630_0827172 | 3300046517 | Bacteria | 706 |
| 495 | Ga0495630_0865701 | 3300046517 | Bacteria | 689 |
| 496 | Ga0495630_1113755 | 3300046517 | Bacteria | 598 |
| 497 | Ga0495666_0057348 | 3300046526 | Bacteria | 1864 |
| 498 | Ga0495666_0246349 | 3300046526 | Bacteria | 815 |
| 499 | Ga0495652_0000921 | 3300046529 | Bacteria | 33833 |
| 500 | Ga0495652_0064235 | 3300046529 | Bacteria | 3088 |
| 501 | Ga0495652_0112779 | 3300046529 | Bacteria | 2183 |
| 502 | Ga0495652_0257925 | 3300046529 | Bacteria | 1288 |
| 503 | Ga0495652_0265813 | 3300046529 | Bacteria | 1263 |
| 504 | Ga0495652_0655383 | 3300046529 | Bacteria | 710 |
| 505 | Ga0495665_0050462 | 3300046531 | Bacteria | 2205 |
| 506 | Ga0495665_0092802 | 3300046531 | Bacteria | 1586 |
| 507 | Ga0495665_0140283 | 3300046531 | Bacteria | 1263 |
| 508 | Ga0495640_0011149 | 3300046533 | Bacteria | 6921 |
| 509 | Ga0495640_0016433 | 3300046533 | Bacteria | 5534 |
| 510 | Ga0495640_0020901 | 3300046533 | Bacteria | 4812 |
| 511 | Ga0495640_0039834 | 3300046533 | Bacteria | 3294 |
| 512 | Ga0495640_0140821 | 3300046533 | Bacteria | 1555 |
| 513 | Ga0495640_0542890 | 3300046533 | Bacteria | 705 |
| 514 | Ga0495586_0063578 | 3300046535 | Bacteria | 2011 |
| 515 | Ga0495586_0073703 | 3300046535 | Bacteria | 1868 |
| 516 | Ga0495586_0215439 | 3300046535 | Bacteria | 1090 |
| 517 | Ga0495586_0651176 | 3300046535 | Bacteria | 609 |
| 518 | Ga0495586_0854289 | 3300046535 | Bacteria | 525 |
| 519 | Ga0495587_0000210 | 3300046536 | Bacteria | 43426 |
| 520 | Ga0495587_0019889 | 3300046536 | Bacteria | 4148 |
| 521 | Ga0495587_0020581 | 3300046536 | Bacteria | 4070 |
| 522 | Ga0495587_0024332 | 3300046536 | Bacteria | 3712 |
| 523 | Ga0495587_0032571 | 3300046536 | Bacteria | 3150 |
| 524 | Ga0495645_0015471 | 3300046543 | Bacteria | 5426 |
| 525 | Ga0495645_0056485 | 3300046543 | Bacteria | 2850 |
| 526 | Ga0495645_0085457 | 3300046543 | Bacteria | 2258 |
| 527 | Ga0495645_0135143 | 3300046543 | Bacteria | 1725 |
| 528 | Ga0495645_0307343 | 3300046543 | Bacteria | 1034 |
| 529 | Ga0495645_0341772 | 3300046543 | Bacteria | 966 |
| 530 | Ga0495645_0518242 | 3300046543 | Bacteria | 743 |
| 531 | Ga0495667_0000040 | 3300046559 | Bacteria | 129118 |
| 532 | Ga0495667_0010717 | 3300046559 | Bacteria | 6198 |
| 533 | Ga0495667_0013080 | 3300046559 | Bacteria | 5620 |
| 534 | Ga0495667_0015850 | 3300046559 | Bacteria | 5096 |
| 535 | Ga0495667_0060701 | 3300046559 | Bacteria | 2479 |
| 536 | Ga0495667_0797754 | 3300046559 | Bacteria | 582 |
| 537 | Ga0495668_0801198 | 3300046616 | Bacteria | 522 |
| 538 | Ga0495634_0003736 | 3300046642 | Bacteria | 12125 |
| 539 | Ga0495634_0017695 | 3300046642 | Bacteria | 5082 |
| 540 | Ga0495634_0019945 | 3300046642 | Bacteria | 4757 |
| 541 | Ga0495634_0076456 | 3300046642 | Bacteria | 2197 |
| 542 | Ga0495634_0138953 | 3300046642 | Bacteria | 1544 |
| 543 | Ga0495635_0017276 | 3300046663 | Bacteria | 5039 |
| 544 | Ga0495635_0029863 | 3300046663 | Bacteria | 3790 |
| 545 | Ga0495635_0036363 | 3300046663 | Bacteria | 3413 |
| 546 | Ga0495635_0127562 | 3300046663 | Bacteria | 1734 |
| 547 | Ga0495635_0134131 | 3300046663 | Bacteria | 1688 |
| 548 | Ga0495635_0148435 | 3300046663 | Bacteria | 1596 |
| 549 | Ga0495635_0148540 | 3300046663 | Bacteria | 1595 |
| 550 | Ga0495635_0270301 | 3300046663 | Bacteria | 1143 |
| 551 | Ga0495657_0000029 | 3300046675 | Bacteria | 129126 |
| 552 | Ga0495657_0011357 | 3300046675 | Bacteria | 6663 |
| 553 | Ga0495657_0013779 | 3300046675 | Bacteria | 5952 |
| 554 | Ga0495657_0067790 | 3300046675 | Bacteria | 2340 |
| 555 | Ga0495657_0071731 | 3300046675 | Bacteria | 2260 |
| 556 | Ga0495657_0123526 | 3300046675 | Bacteria | 1628 |
| 557 | Ga0495657_0247829 | 3300046675 | Bacteria | 1073 |
| 558 | Ga0495599_0000238 | 3300046678 | Bacteria | 34651 |
| 559 | Ga0495599_0006812 | 3300046678 | Bacteria | 6906 |
| 560 | Ga0495599_0011065 | 3300046678 | Bacteria | 5535 |
| 561 | Ga0495599_0020378 | 3300046678 | Bacteria | 4130 |
| 562 | Ga0495599_0044594 | 3300046678 | Bacteria | 2781 |
| 563 | Ga0495599_0079635 | 3300046678 | Bacteria | 2046 |
| 564 | Ga0495599_0148446 | 3300046678 | Bacteria | 1453 |
| 565 | Ga0495599_0160810 | 3300046678 | Bacteria | 1388 |
| 566 | Ga0495599_0378450 | 3300046678 | Bacteria | 845 |
| 567 | Ga0495599_0796816 | 3300046678 | Bacteria | 540 |
| 568 | Ga0495599_0879568 | 3300046678 | Unclassified | 508 |
| 569 | Ga0495623_0000652 | 3300046679 | Bacteria | 23015 |
| 570 | Ga0495623_0021744 | 3300046679 | Bacteria | 4143 |
| 571 | Ga0495623_0047553 | 3300046679 | Bacteria | 2723 |
| 572 | Ga0495623_0048775 | 3300046679 | Bacteria | 2684 |
| 573 | Ga0495623_0181919 | 3300046679 | Bacteria | 1220 |
| 574 | Ga0495623_0205434 | 3300046679 | Bacteria | 1130 |
| 575 | Ga0495646_0017835 | 3300046680 | Bacteria | 4498 |
| 576 | Ga0495646_0055286 | 3300046680 | Bacteria | 2384 |
| 577 | Ga0495646_0119361 | 3300046680 | Bacteria | 1493 |
| 578 | Ga0495646_0130857 | 3300046680 | Bacteria | 1413 |
| 579 | Ga0495647_0077274 | 3300046681 | Bacteria | 1344 |
| 580 | Ga0495658_0010787 | 3300046683 | Bacteria | 4575 |
| 581 | Ga0495658_0024208 | 3300046683 | Bacteria | 3231 |
| 582 | Ga0495658_0286242 | 3300046683 | Bacteria | 1041 |
| 583 | Ga0495613_0006014 | 3300046689 | Bacteria | 9080 |
| 584 | Ga0495613_0286579 | 3300046689 | Bacteria | 1142 |
| 585 | Ga0495613_0772280 | 3300046689 | Bacteria | 628 |
| 586 | Ga0495624_0038221 | 3300046690 | Bacteria | 3084 |
| 587 | Ga0495624_0047584 | 3300046690 | Bacteria | 2725 |
| 588 | Ga0495624_0365578 | 3300046690 | Bacteria | 867 |
| 589 | Ga0495600_0001122 | 3300046809 | Bacteria | 14592 |
| 590 | Ga0495600_0012428 | 3300046809 | Bacteria | 5323 |
| 591 | Ga0495600_0060393 | 3300046809 | Bacteria | 2475 |
| 592 | Ga0495600_0112858 | 3300046809 | Bacteria | 1769 |
| 593 | Ga0495600_0460500 | 3300046809 | Bacteria | 785 |
| 594 | Ga0495600_0561882 | 3300046809 | Bacteria | 696 |
| 595 | Ga0495581_0005470 | 3300047315 | Bacteria | 7350 |
| 596 | Ga0495581_0016981 | 3300047315 | Bacteria | 4229 |
| 597 | Ga0495581_0248528 | 3300047315 | Bacteria | 1040 |
| 598 | Ga0495581_0294979 | 3300047315 | Bacteria | 948 |
| 599 | Ga0495581_0295767 | 3300047315 | Bacteria | 946 |
| 600 | Ga0495604_0000034 | 3300047317 | Bacteria | 129099 |
| 601 | Ga0495604_0013791 | 3300047317 | Bacteria | 6443 |
| 602 | Ga0495604_0031224 | 3300047317 | Bacteria | 4227 |
| 603 | Ga0495604_0036970 | 3300047317 | Bacteria | 3847 |
| 604 | Ga0495604_0076770 | 3300047317 | Bacteria | 2512 |
| 605 | Ga0495604_0240711 | 3300047317 | Bacteria | 1237 |
| 606 | Ga0495604_0985209 | 3300047317 | Bacteria | 522 |
| 607 | Ga0495674_0025013 | 3300047319 | Bacteria | 5479 |
| 608 | Ga0495674_0040569 | 3300047319 | Bacteria | 4163 |
| 609 | Ga0495674_0131073 | 3300047319 | Bacteria | 2112 |
| 610 | Ga0495674_0201789 | 3300047319 | Bacteria | 1649 |
| 611 | Ga0495674_0379131 | 3300047319 | Bacteria | 1144 |
| 612 | Ga0495674_0399541 | 3300047319 | Bacteria | 1109 |
| 613 | Ga0495674_0483130 | 3300047319 | Bacteria | 992 |
| 614 | Ga0495674_0901147 | 3300047319 | Bacteria | 682 |
| 615 | Ga0495676_0176606 | 3300047321 | Bacteria | 1499 |
| 616 | Ga0495676_0495223 | 3300047321 | Bacteria | 802 |
| 617 | Ga0495680_0000522 | 3300047322 | Bacteria | 43426 |
| 618 | Ga0495680_0002970 | 3300047322 | Bacteria | 16962 |
| 619 | Ga0495680_0021482 | 3300047322 | Bacteria | 5402 |
| 620 | Ga0495680_0023239 | 3300047322 | Bacteria | 5156 |
| 621 | Ga0495680_0024387 | 3300047322 | Bacteria | 5017 |
| 622 | Ga0495680_0024852 | 3300047322 | Bacteria | 4962 |
| 623 | Ga0495680_0314242 | 3300047322 | Bacteria | 1097 |
| 624 | Ga0495680_0973816 | 3300047322 | Bacteria | 543 |
| 625 | Ga0495675_0007809 | 3300047444 | Bacteria | 6603 |
| 626 | Ga0495675_0034946 | 3300047444 | Bacteria | 3210 |
| 627 | Ga0495675_0135794 | 3300047444 | Bacteria | 1527 |
| 628 | Ga0495675_0149659 | 3300047444 | Bacteria | 1442 |
| 629 | Ga0495684_0011772 | 3300047471 | Bacteria | 6749 |
| 630 | Ga0495684_0028184 | 3300047471 | Bacteria | 4312 |
| 631 | Ga0495684_0054194 | 3300047471 | Bacteria | 3059 |
| 632 | Ga0495684_0187972 | 3300047471 | Bacteria | 1528 |
| 633 | Ga0495684_0387917 | 3300047471 | Bacteria | 983 |
| 634 | Ga0495684_0671733 | 3300047471 | Bacteria | 690 |
| 635 | Ga0495684_0735105 | 3300047471 | Bacteria | 651 |
| 636 | Ga0495684_0840601 | 3300047471 | Bacteria | 596 |
| 637 | Ga0495593_0001378 | 3300047673 | Bacteria | 14216 |
| 638 | Ga0495593_0013402 | 3300047673 | Bacteria | 4678 |
| 639 | Ga0495593_0029352 | 3300047673 | Bacteria | 3015 |
| 640 | Ga0495593_0394632 | 3300047673 | Bacteria | 692 |
| 641 | Ga0495593_0608838 | 3300047673 | Bacteria | 548 |
| 642 | Ga0495602_0001101 | 3300048088 | Bacteria | 26520 |
| 643 | Ga0495602_0027300 | 3300048088 | Bacteria | 5488 |
| 644 | Ga0495602_0078601 | 3300048088 | Bacteria | 2786 |
| 645 | Ga0495602_0208504 | 3300048088 | Bacteria | 1485 |
| 646 | Ga0495602_0287897 | 3300048088 | Bacteria | 1207 |
| 647 | Ga0495602_0496725 | 3300048088 | Bacteria | 853 |
| 648 | Ga0495614_0073849 | 3300048089 | Bacteria | 1472 |
| 649 | Ga0495614_0123982 | 3300048089 | Bacteria | 1141 |
| 650 | Ga0495614_0167276 | 3300048089 | Bacteria | 985 |
| 651 | Ga0496100_0007843 | 3300048903 | Bacteria | 5925 |
| 652 | Ga0496100_0980306 | 3300048903 | Bacteria | 665 |
| 653 | Ga0496100_1206893 | 3300048903 | Bacteria | 597 |
| 654 | Ga0496101_0210138 | 3300048904 | Bacteria | 1507 |
| 655 | Ga0496101_0495393 | 3300048904 | Bacteria | 965 |
| 656 | Ga0496103_0275483 | 3300048906 | Bacteria | 1082 |
| 657 | Ga0496103_0540728 | 3300048906 | Bacteria | 744 |
| 658 | Ga0496104_0000398 | 3300048907 | Bacteria | 38090 |
| 659 | Ga0496104_0080748 | 3300048907 | Bacteria | 3100 |
| 660 | Ga0496104_0159296 | 3300048907 | Bacteria | 2165 |
| 661 | Ga0496105_0002315 | 3300048908 | Bacteria | 13811 |
| 662 | Ga0496105_0048728 | 3300048908 | Bacteria | 3497 |
| 663 | Ga0496106_0152986 | 3300048909 | Bacteria | 1820 |
| 664 | Ga0496106_0320558 | 3300048909 | Bacteria | 1244 |
| 665 | Ga0496106_0449649 | 3300048909 | Bacteria | 1035 |
| 666 | Ga0496107_0074893 | 3300048910 | Bacteria | 2463 |
| 667 | Ga0496108_0003584 | 3300048911 | Bacteria | 12438 |
| 668 | Ga0496108_0048697 | 3300048911 | Bacteria | 3543 |
| 669 | Ga0496109_0016447 | 3300048912 | Bacteria | 6468 |
| 670 | Ga0496109_0233952 | 3300048912 | Bacteria | 1729 |
| 671 | Ga0496109_1226849 | 3300048912 | Bacteria | 686 |
| 672 | Ga0496110_0056717 | 3300048913 | Bacteria | 3447 |
| 673 | Ga0496110_0101351 | 3300048913 | Bacteria | 2581 |
| 674 | Ga0496110_0535929 | 3300048913 | Bacteria | 1064 |
| 675 | Ga0496111_0015587 | 3300048914 | Bacteria | 5223 |
| 676 | Ga0496112_0000555 | 3300048915 | Bacteria | 25563 |
| 677 | Ga0496112_0148757 | 3300048915 | Bacteria | 2309 |
| 678 | Ga0496113_0007480 | 3300048916 | Bacteria | 7035 |
| 679 | Ga0496113_0127075 | 3300048916 | Bacteria | 1997 |
| 680 | Ga0496114_0139113 | 3300048917 | Bacteria | 2101 |
| 681 | Ga0496114_0150228 | 3300048917 | Bacteria | 2020 |
| 682 | Ga0496115_0095603 | 3300048918 | Bacteria | 2432 |
| 683 | Ga0496115_0095718 | 3300048918 | Bacteria | 2430 |
| 684 | Ga0496115_0456277 | 3300048918 | Bacteria | 1032 |
| 685 | Ga0501040_1017797 | 3300049576 | Bacteria | 601 |
| 686 | nmdc:mga05p37_55814_c1 | 3300050507 | Bacteria | 4863 |
| 687 | nmdc:mga05p37_943223_c1 | 3300050507 | Bacteria | 925 |
| 688 | nmdc:mga09592_1297538_c1 | 3300050508 | Bacteria | 599 |
| 689 | nmdc:mga08y16_176108_c1 | 3300050511 | Bacteria | 2221 |
| 690 | nmdc:mga0n895_483430_c1 | 3300050512 | Bacteria | 1249 |
| 691 | nmdc:mga0n895_4834_c1 | 3300050512 | Bacteria | 11160 |
| 692 | nmdc:mga0n895_592950_c1 | 3300050512 | Bacteria | 1111 |
| 693 | nmdc:mga0rr50_129776_c1 | 3300050513 | Bacteria | 2017 |
| 694 | nmdc:mga0rr50_160290_c1 | 3300050513 | Bacteria | 1825 |
| 695 | nmdc:mga0rr50_33563_c1 | 3300050513 | Bacteria | 3667 |
| 696 | nmdc:mga0rr50_39424_c1 | 3300050513 | Bacteria | 3426 |
| 697 | nmdc:mga0rr50_5465_c1 | 3300050513 | Bacteria | 7582 |
| 698 | nmdc:mga08x19_134520_c1 | 3300050514 | Bacteria | 1666 |
| 699 | nmdc:mga08x19_20767_c1 | 3300050514 | Bacteria | 4047 |
| 700 | nmdc:mga08x19_307987_c1 | 3300050514 | Bacteria | 1101 |
| 701 | nmdc:mga0a205_71814_c1 | 3300050515 | Bacteria | 3343 |
| 702 | Ga0495601_0003370 | 3300053077 | Bacteria | 9152 |
| 703 | Ga0495601_0164091 | 3300053077 | Bacteria | 1452 |
| 704 | Ga0495601_0249898 | 3300053077 | Bacteria | 1158 |
| 705 | Ga0495601_0279924 | 3300053077 | Bacteria | 1087 |
| 706 | Ga0495601_0304230 | 3300053077 | Bacteria | 1038 |
| 707 | Ga0495601_0368083 | 3300053077 | Bacteria | 933 |
| 708 | Ga0495601_0788079 | 3300053077 | Bacteria | 604 |
| 709 | Ga0495612_0099800 | 3300053078 | Bacteria | 1235 |
| 710 | Ga0495612_0223220 | 3300053078 | Bacteria | 834 |
| 711 | Ga0495595_0004176 | 3300053084 | Bacteria | 5803 |
| 712 | Ga0495595_0009675 | 3300053084 | Bacteria | 3992 |
| 713 | Ga0495595_0042151 | 3300053084 | Bacteria | 2091 |
| 714 | Ga0495595_0099818 | 3300053084 | Bacteria | 1400 |
| 715 | Ga0495595_0333039 | 3300053084 | Bacteria | 765 |
| 716 | Ga0495619_0001126 | 3300053085 | Bacteria | 17567 |
| 717 | Ga0495619_0035907 | 3300053085 | Bacteria | 3226 |
| 718 | Ga0495619_0058966 | 3300053085 | Bacteria | 2549 |
| 719 | Ga0495619_0067041 | 3300053085 | Bacteria | 2396 |
| 720 | Ga0495619_0167066 | 3300053085 | Bacteria | 1521 |
| 721 | Ga0495619_0308259 | 3300053085 | Bacteria | 1096 |
| 722 | Ga0587079_190935 | 3300059647 | Bacteria | 554 |
| 723 | Ga0466962_0009250 | 3300061719 | Bacteria | 4720 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300028666 | Ga0265336_10004336 | Ga0265336_100043362 | 95 |
| 2 | 3300028800 | Ga0265338_10000827 | Ga0265338_1000082710 | 95 |
| 3 | 3300003911 | JGI25405J52794_10055132 | JGI25405J52794_100551322 | 99 |
| 4 | 3300005937 | Ga0081455_10003996 | Ga0081455_100039968 | 99 |
| 5 | 3300044694 | Ga0466963_0148482 | Ga0466963_0148482_904_1242 | 100 |
| 6 | 3300005458 | Ga0070681_11977776 | Ga0070681_119777761 | 101 |
| 7 | 3300028380 | Ga0268265_11986792 | Ga0268265_119867921 | 101 |
| 8 | 3300053085 | Ga0495619_0067041 | Ga0495619_0067041_1444_1794 | 101 |
| 9 | 3300005614 | Ga0068856_100568478 | Ga0068856_1005684781 | 102 |
| 10 | 3300006847 | Ga0075431_100274473 | Ga0075431_1002744732 | 102 |
| 11 | 3300020075 | Ga0206349_1809199 | Ga0206349_18091991 | 102 |
| 12 | 3300020076 | Ga0206355_1176711 | Ga0206355_11767111 | 102 |
| 13 | 3300026078 | Ga0207702_11476938 | Ga0207702_114769382 | 102 |
| 14 | 3300033179 | Ga0307507_10000013 | Ga0307507_10000013142 | 102 |
| 15 | 3300044656 | Ga0466969_0007516 | Ga0466969_0007516_3939_4277 | 102 |
| 16 | 3300044656 | Ga0466969_0172100 | Ga0466969_0172100_567_905 | 102 |
| 17 | 3300044684 | Ga0466966_0081773 | Ga0466966_0081773_1194_1532 | 102 |
| 18 | 3300044693 | Ga0466961_0148531 | Ga0466961_0148531_866_1204 | 102 |
| 19 | 3300044694 | Ga0466963_0784484 | Ga0466963_0784484_220_558 | 102 |
| 20 | 3300044719 | Ga0466971_0050231 | Ga0466971_0050231_512_850 | 102 |
| 21 | 3300045049 | Ga0466959_0032173 | Ga0466959_0032173_120_458 | 102 |
| 22 | 3300045836 | Ga0466958_0447267 | Ga0466958_0447267_431_769 | 102 |
| 23 | 3300061719 | Ga0466962_0009250 | Ga0466962_0009250_2992_3330 | 102 |
| 24 | 3300003659 | JGI25404J52841_10125491 | JGI25404J52841_101254911 | 103 |
| 25 | 3300005327 | Ga0070658_11106343 | Ga0070658_111063432 | 103 |
| 26 | 3300005329 | Ga0070683_100707568 | Ga0070683_1007075682 | 103 |
| 27 | 3300005330 | Ga0070690_101571269 | Ga0070690_1015712692 | 103 |
| 28 | 3300005336 | Ga0070680_101723863 | Ga0070680_1017238631 | 103 |
| 29 | 3300005337 | Ga0070682_100019730 | Ga0070682_1000197302 | 103 |
| 30 | 3300005337 | Ga0070682_100236652 | Ga0070682_1002366522 | 103 |
| 31 | 3300005338 | Ga0068868_100075382 | Ga0068868_1000753822 | 103 |
| 32 | 3300005341 | Ga0070691_10820756 | Ga0070691_108207561 | 103 |
| 33 | 3300005344 | Ga0070661_100528424 | Ga0070661_1005284242 | 103 |
| 34 | 3300005344 | Ga0070661_101635115 | Ga0070661_1016351151 | 103 |
| 35 | 3300005364 | Ga0070673_101145027 | Ga0070673_1011450271 | 103 |
| 36 | 3300005434 | Ga0070709_10000823 | Ga0070709_100008234 | 103 |
| 37 | 3300005434 | Ga0070709_10024826 | Ga0070709_100248264 | 103 |
| 38 | 3300005434 | Ga0070709_10697497 | Ga0070709_106974971 | 103 |
| 39 | 3300005435 | Ga0070714_100007188 | Ga0070714_1000071882 | 103 |
| 40 | 3300005435 | Ga0070714_100014979 | Ga0070714_1000149792 | 103 |
| 41 | 3300005435 | Ga0070714_100109759 | Ga0070714_1001097592 | 103 |
| 42 | 3300005435 | Ga0070714_100182476 | Ga0070714_1001824762 | 103 |
| 43 | 3300005435 | Ga0070714_100387957 | Ga0070714_1003879571 | 103 |
| 44 | 3300005435 | Ga0070714_100837634 | Ga0070714_1008376341 | 103 |
| 45 | 3300005436 | Ga0070713_100007037 | Ga0070713_1000070378 | 103 |
| 46 | 3300005436 | Ga0070713_100053922 | Ga0070713_1000539224 | 103 |
| 47 | 3300005436 | Ga0070713_100068078 | Ga0070713_1000680784 | 103 |
| 48 | 3300005436 | Ga0070713_100253649 | Ga0070713_1002536493 | 103 |
| 49 | 3300005436 | Ga0070713_100282000 | Ga0070713_1002820002 | 103 |
| 50 | 3300005436 | Ga0070713_100718572 | Ga0070713_1007185722 | 103 |
| 51 | 3300005436 | Ga0070713_100931741 | Ga0070713_1009317412 | 103 |
| 52 | 3300005437 | Ga0070710_10000868 | Ga0070710_100008687 | 103 |
| 53 | 3300005437 | Ga0070710_10022871 | Ga0070710_100228712 | 103 |
| 54 | 3300005437 | Ga0070710_10172496 | Ga0070710_101724961 | 103 |
| 55 | 3300005437 | Ga0070710_10355030 | Ga0070710_103550301 | 103 |
| 56 | 3300005439 | Ga0070711_100011851 | Ga0070711_1000118513 | 103 |
| 57 | 3300005439 | Ga0070711_100229955 | Ga0070711_1002299552 | 103 |
| 58 | 3300005439 | Ga0070711_100309635 | Ga0070711_1003096352 | 103 |
| 59 | 3300005439 | Ga0070711_100313195 | Ga0070711_1003131952 | 103 |
| 60 | 3300005439 | Ga0070711_100626758 | Ga0070711_1006267582 | 103 |
| 61 | 3300005440 | Ga0070705_100074927 | Ga0070705_1000749272 | 103 |
| 62 | 3300005444 | Ga0070694_100501618 | Ga0070694_1005016182 | 103 |
| 63 | 3300005445 | Ga0070708_100005821 | Ga0070708_1000058211 | 103 |
| 64 | 3300005445 | Ga0070708_100117021 | Ga0070708_1001170212 | 103 |
| 65 | 3300005445 | Ga0070708_101077309 | Ga0070708_1010773091 | 103 |
| 66 | 3300005455 | Ga0070663_100539351 | Ga0070663_1005393512 | 103 |
| 67 | 3300005456 | Ga0070678_100489332 | Ga0070678_1004893321 | 103 |
| 68 | 3300005456 | Ga0070678_100832249 | Ga0070678_1008322492 | 103 |
| 69 | 3300005458 | Ga0070681_10139426 | Ga0070681_101394262 | 103 |
| 70 | 3300005458 | Ga0070681_10622424 | Ga0070681_106224241 | 103 |
| 71 | 3300005467 | Ga0070706_100002492 | Ga0070706_1000024926 | 103 |
| 72 | 3300005467 | Ga0070706_100008070 | Ga0070706_1000080707 | 103 |
| 73 | 3300005467 | Ga0070706_100011680 | Ga0070706_1000116804 | 103 |
| 74 | 3300005467 | Ga0070706_100264192 | Ga0070706_1002641922 | 103 |
| 75 | 3300005468 | Ga0070707_100000199 | Ga0070707_10000019919 | 103 |
| 76 | 3300005468 | Ga0070707_100005322 | Ga0070707_1000053229 | 103 |
| 77 | 3300005468 | Ga0070707_100069704 | Ga0070707_1000697043 | 103 |
| 78 | 3300005468 | Ga0070707_100147984 | Ga0070707_1001479843 | 103 |
| 79 | 3300005471 | Ga0070698_100000264 | Ga0070698_10000026439 | 103 |
| 80 | 3300005471 | Ga0070698_100009166 | Ga0070698_1000091663 | 103 |
| 81 | 3300005471 | Ga0070698_100124972 | Ga0070698_1001249722 | 103 |
| 82 | 3300005471 | Ga0070698_100501578 | Ga0070698_1005015782 | 103 |
| 83 | 3300005471 | Ga0070698_101064597 | Ga0070698_1010645972 | 103 |
| 84 | 3300005518 | Ga0070699_100144100 | Ga0070699_1001441002 | 103 |
| 85 | 3300005518 | Ga0070699_101815849 | Ga0070699_1018158491 | 103 |
| 86 | 3300005530 | Ga0070679_100989066 | Ga0070679_1009890661 | 103 |
| 87 | 3300005530 | Ga0070679_101197011 | Ga0070679_1011970112 | 103 |
| 88 | 3300005530 | Ga0070679_101972476 | Ga0070679_1019724761 | 103 |
| 89 | 3300005535 | Ga0070684_100421866 | Ga0070684_1004218662 | 103 |
| 90 | 3300005536 | Ga0070697_100064922 | Ga0070697_1000649222 | 103 |
| 91 | 3300005536 | Ga0070697_101218939 | Ga0070697_1012189392 | 103 |
| 92 | 3300005544 | Ga0070686_101022406 | Ga0070686_1010224062 | 103 |
| 93 | 3300005545 | Ga0070695_100803350 | Ga0070695_1008033502 | 103 |
| 94 | 3300005548 | Ga0070665_100020355 | Ga0070665_1000203553 | 103 |
| 95 | 3300005548 | Ga0070665_100391780 | Ga0070665_1003917802 | 103 |
| 96 | 3300005548 | Ga0070665_100643874 | Ga0070665_1006438742 | 103 |
| 97 | 3300005549 | Ga0070704_100724648 | Ga0070704_1007246482 | 103 |
| 98 | 3300005563 | Ga0068855_100290727 | Ga0068855_1002907272 | 103 |
| 99 | 3300005577 | Ga0068857_100322602 | Ga0068857_1003226022 | 103 |
| 100 | 3300005614 | Ga0068856_100008925 | Ga0068856_1000089258 | 103 |
| 101 | 3300005614 | Ga0068856_100027025 | Ga0068856_1000270254 | 103 |
| 102 | 3300005614 | Ga0068856_101458274 | Ga0068856_1014582741 | 103 |
| 103 | 3300005615 | Ga0070702_101434120 | Ga0070702_1014341201 | 103 |
| 104 | 3300005618 | Ga0068864_100142029 | Ga0068864_1001420292 | 103 |
| 105 | 3300005841 | Ga0068863_100264671 | Ga0068863_1002646712 | 103 |
| 106 | 3300005841 | Ga0068863_101330103 | Ga0068863_1013301031 | 103 |
| 107 | 3300005843 | Ga0068860_101830214 | Ga0068860_1018302142 | 103 |
| 108 | 3300005844 | Ga0068862_100561491 | Ga0068862_1005614912 | 103 |
| 109 | 3300005937 | Ga0081455_10258179 | Ga0081455_102581792 | 103 |
| 110 | 3300005983 | Ga0081540_1002480 | Ga0081540_100248012 | 103 |
| 111 | 3300005983 | Ga0081540_1152629 | Ga0081540_11526292 | 103 |
| 112 | 3300006028 | Ga0070717_10016987 | Ga0070717_100169872 | 103 |
| 113 | 3300006028 | Ga0070717_10038389 | Ga0070717_100383893 | 103 |
| 114 | 3300006028 | Ga0070717_10084850 | Ga0070717_100848503 | 103 |
| 115 | 3300006028 | Ga0070717_10161866 | Ga0070717_101618662 | 103 |
| 116 | 3300006028 | Ga0070717_10174068 | Ga0070717_101740682 | 103 |
| 117 | 3300006028 | Ga0070717_10216055 | Ga0070717_102160552 | 103 |
| 118 | 3300006028 | Ga0070717_10707240 | Ga0070717_107072401 | 103 |
| 119 | 3300006028 | Ga0070717_11074894 | Ga0070717_110748942 | 103 |
| 120 | 3300006163 | Ga0070715_10001553 | Ga0070715_100015536 | 103 |
| 121 | 3300006163 | Ga0070715_10085323 | Ga0070715_100853232 | 103 |
| 122 | 3300006163 | Ga0070715_10277807 | Ga0070715_102778072 | 103 |
| 123 | 3300006173 | Ga0070716_100003243 | Ga0070716_1000032437 | 103 |
| 124 | 3300006173 | Ga0070716_100011703 | Ga0070716_1000117034 | 103 |
| 125 | 3300006173 | Ga0070716_100088472 | Ga0070716_1000884722 | 103 |
| 126 | 3300006173 | Ga0070716_100745331 | Ga0070716_1007453311 | 103 |
| 127 | 3300006175 | Ga0070712_100017503 | Ga0070712_1000175034 | 103 |
| 128 | 3300006175 | Ga0070712_100024410 | Ga0070712_1000244104 | 103 |
| 129 | 3300006175 | Ga0070712_100095396 | Ga0070712_1000953963 | 103 |
| 130 | 3300006237 | Ga0097621_101367322 | Ga0097621_1013673221 | 103 |
| 131 | 3300006844 | Ga0075428_100260354 | Ga0075428_1002603543 | 103 |
| 132 | 3300006852 | Ga0075433_10256953 | Ga0075433_102569532 | 103 |
| 133 | 3300006871 | Ga0075434_100007491 | Ga0075434_1000074912 | 103 |
| 134 | 3300006880 | Ga0075429_100003605 | Ga0075429_1000036055 | 103 |
| 135 | 3300006914 | Ga0075436_100020302 | Ga0075436_1000203024 | 103 |
| 136 | 3300006914 | Ga0075436_100313677 | Ga0075436_1003136772 | 103 |
| 137 | 3300006914 | Ga0075436_100519349 | Ga0075436_1005193493 | 103 |
| 138 | 3300007076 | Ga0075435_100041630 | Ga0075435_1000416304 | 103 |
| 139 | 3300007076 | Ga0075435_100163400 | Ga0075435_1001634002 | 103 |
| 140 | 3300007076 | Ga0075435_100712075 | Ga0075435_1007120752 | 103 |
| 141 | 3300007076 | Ga0075435_101401104 | Ga0075435_1014011042 | 103 |
| 142 | 3300009011 | Ga0105251_10287464 | Ga0105251_102874642 | 103 |
| 143 | 3300009093 | Ga0105240_11906369 | Ga0105240_119063692 | 103 |
| 144 | 3300009094 | Ga0111539_10026492 | Ga0111539_100264924 | 103 |
| 145 | 3300009098 | Ga0105245_10016540 | Ga0105245_100165402 | 103 |
| 146 | 3300009098 | Ga0105245_11401781 | Ga0105245_114017812 | 103 |
| 147 | 3300009101 | Ga0105247_10417442 | Ga0105247_104174422 | 103 |
| 148 | 3300009101 | Ga0105247_10556569 | Ga0105247_105565691 | 103 |
| 149 | 3300009147 | Ga0114129_10010771 | Ga0114129_1001077112 | 103 |
| 150 | 3300009147 | Ga0114129_10018645 | Ga0114129_100186454 | 103 |
| 151 | 3300009174 | Ga0105241_10356832 | Ga0105241_103568321 | 103 |
| 152 | 3300009177 | Ga0105248_10119398 | Ga0105248_101193982 | 103 |
| 153 | 3300009545 | Ga0105237_10493119 | Ga0105237_104931192 | 103 |
| 154 | 3300009553 | Ga0105249_10780429 | Ga0105249_107804292 | 103 |
| 155 | 3300010159 | Ga0099796_10136017 | Ga0099796_101360172 | 103 |
| 156 | 3300010375 | Ga0105239_10197953 | Ga0105239_101979533 | 103 |
| 157 | 3300010375 | Ga0105239_10258711 | Ga0105239_102587112 | 103 |
| 158 | 3300010375 | Ga0105239_11010799 | Ga0105239_110107992 | 103 |
| 159 | 3300010375 | Ga0105239_12460734 | Ga0105239_124607342 | 103 |
| 160 | 3300013104 | Ga0157370_10032973 | Ga0157370_100329736 | 103 |
| 161 | 3300013105 | Ga0157369_10039515 | Ga0157369_100395156 | 103 |
| 162 | 3300013296 | Ga0157374_10231720 | Ga0157374_102317202 | 103 |
| 163 | 3300013297 | Ga0157378_10207852 | Ga0157378_102078523 | 103 |
| 164 | 3300013297 | Ga0157378_10264984 | Ga0157378_102649842 | 103 |
| 165 | 3300013297 | Ga0157378_12573878 | Ga0157378_125738781 | 103 |
| 166 | 3300013306 | Ga0163162_10260785 | Ga0163162_102607853 | 103 |
| 167 | 3300013307 | Ga0157372_11795945 | Ga0157372_117959451 | 103 |
| 168 | 3300013308 | Ga0157375_10054315 | Ga0157375_100543154 | 103 |
| 169 | 3300014325 | Ga0163163_10047123 | Ga0163163_100471235 | 103 |
| 170 | 3300014325 | Ga0163163_10416366 | Ga0163163_104163662 | 103 |
| 171 | 3300014968 | Ga0157379_10132107 | Ga0157379_101321073 | 103 |
| 172 | 3300014969 | Ga0157376_10095146 | Ga0157376_100951462 | 103 |
| 173 | 3300014969 | Ga0157376_11204371 | Ga0157376_112043711 | 103 |
| 174 | 3300017792 | Ga0163161_10188456 | Ga0163161_101884562 | 103 |
| 175 | 3300020069 | Ga0197907_10771707 | Ga0197907_107717074 | 103 |
| 176 | 3300020070 | Ga0206356_11619378 | Ga0206356_116193782 | 103 |
| 177 | 3300020076 | Ga0206355_1286002 | Ga0206355_12860022 | 103 |
| 178 | 3300020080 | Ga0206350_11052987 | Ga0206350_110529872 | 103 |
| 179 | 3300020081 | Ga0206354_10046509 | Ga0206354_100465091 | 103 |
| 180 | 3300020082 | Ga0206353_10146695 | Ga0206353_101466952 | 103 |
| 181 | 3300022467 | Ga0224712_10039731 | Ga0224712_100397312 | 103 |
| 182 | 3300022467 | Ga0224712_10410895 | Ga0224712_104108951 | 103 |
| 183 | 3300022467 | Ga0224712_10621598 | Ga0224712_106215981 | 103 |
| 184 | 3300025898 | Ga0207692_10002632 | Ga0207692_100026327 | 103 |
| 185 | 3300025898 | Ga0207692_10026757 | Ga0207692_100267572 | 103 |
| 186 | 3300025898 | Ga0207692_10071464 | Ga0207692_100714642 | 103 |
| 187 | 3300025898 | Ga0207692_10122656 | Ga0207692_101226562 | 103 |
| 188 | 3300025898 | Ga0207692_10548622 | Ga0207692_105486222 | 103 |
| 189 | 3300025900 | Ga0207710_10257972 | Ga0207710_102579722 | 103 |
| 190 | 3300025905 | Ga0207685_10003617 | Ga0207685_100036176 | 103 |
| 191 | 3300025905 | Ga0207685_10004266 | Ga0207685_100042664 | 103 |
| 192 | 3300025905 | Ga0207685_10017784 | Ga0207685_100177842 | 103 |
| 193 | 3300025906 | Ga0207699_10000458 | Ga0207699_100004589 | 103 |
| 194 | 3300025906 | Ga0207699_10001066 | Ga0207699_100010664 | 103 |
| 195 | 3300025906 | Ga0207699_10021537 | Ga0207699_100215374 | 103 |
| 196 | 3300025906 | Ga0207699_10253190 | Ga0207699_102531902 | 103 |
| 197 | 3300025910 | Ga0207684_10001761 | Ga0207684_1000176116 | 103 |
| 198 | 3300025910 | Ga0207684_10008113 | Ga0207684_100081132 | 103 |
| 199 | 3300025910 | Ga0207684_10093884 | Ga0207684_100938842 | 103 |
| 200 | 3300025910 | Ga0207684_10235712 | Ga0207684_102357121 | 103 |
| 201 | 3300025910 | Ga0207684_10366728 | Ga0207684_103667282 | 103 |
| 202 | 3300025912 | Ga0207707_10491159 | Ga0207707_104911592 | 103 |
| 203 | 3300025914 | Ga0207671_10094985 | Ga0207671_100949853 | 103 |
| 204 | 3300025915 | Ga0207693_10011453 | Ga0207693_100114532 | 103 |
| 205 | 3300025915 | Ga0207693_10017652 | Ga0207693_100176523 | 103 |
| 206 | 3300025915 | Ga0207693_10031669 | Ga0207693_100316692 | 103 |
| 207 | 3300025915 | Ga0207693_10659718 | Ga0207693_106597182 | 103 |
| 208 | 3300025915 | Ga0207693_10832993 | Ga0207693_108329932 | 103 |
| 209 | 3300025916 | Ga0207663_10002072 | Ga0207663_100020729 | 103 |
| 210 | 3300025916 | Ga0207663_10005894 | Ga0207663_100058944 | 103 |
| 211 | 3300025916 | Ga0207663_10477708 | Ga0207663_104777081 | 103 |
| 212 | 3300025916 | Ga0207663_10892311 | Ga0207663_108923112 | 103 |
| 213 | 3300025917 | Ga0207660_10998748 | Ga0207660_109987482 | 103 |
| 214 | 3300025921 | Ga0207652_10334736 | Ga0207652_103347361 | 103 |
| 215 | 3300025921 | Ga0207652_10625898 | Ga0207652_106258982 | 103 |
| 216 | 3300025922 | Ga0207646_10000278 | Ga0207646_1000027817 | 103 |
| 217 | 3300025922 | Ga0207646_10003994 | Ga0207646_100039949 | 103 |
| 218 | 3300025922 | Ga0207646_10023928 | Ga0207646_100239282 | 103 |
| 219 | 3300025922 | Ga0207646_10205035 | Ga0207646_102050353 | 103 |
| 220 | 3300025927 | Ga0207687_10156617 | Ga0207687_101566171 | 103 |
| 221 | 3300025928 | Ga0207700_10001366 | Ga0207700_1000136610 | 103 |
| 222 | 3300025928 | Ga0207700_10004397 | Ga0207700_100043973 | 103 |
| 223 | 3300025928 | Ga0207700_10070074 | Ga0207700_100700742 | 103 |
| 224 | 3300025928 | Ga0207700_10076350 | Ga0207700_100763503 | 103 |
| 225 | 3300025928 | Ga0207700_10100254 | Ga0207700_101002542 | 103 |
| 226 | 3300025928 | Ga0207700_10154117 | Ga0207700_101541172 | 103 |
| 227 | 3300025928 | Ga0207700_10678419 | Ga0207700_106784192 | 103 |
| 228 | 3300025929 | Ga0207664_10001412 | Ga0207664_100014129 | 103 |
| 229 | 3300025929 | Ga0207664_10015483 | Ga0207664_100154832 | 103 |
| 230 | 3300025929 | Ga0207664_10028261 | Ga0207664_100282613 | 103 |
| 231 | 3300025929 | Ga0207664_10159783 | Ga0207664_101597831 | 103 |
| 232 | 3300025929 | Ga0207664_10213288 | Ga0207664_102132882 | 103 |
| 233 | 3300025929 | Ga0207664_10918743 | Ga0207664_109187432 | 103 |
| 234 | 3300025929 | Ga0207664_11801921 | Ga0207664_118019211 | 103 |
| 235 | 3300025929 | Ga0207664_11821215 | Ga0207664_118212151 | 103 |
| 236 | 3300025939 | Ga0207665_10000215 | Ga0207665_1000021518 | 103 |
| 237 | 3300025939 | Ga0207665_10002825 | Ga0207665_1000282510 | 103 |
| 238 | 3300025939 | Ga0207665_10020664 | Ga0207665_100206642 | 103 |
| 239 | 3300025939 | Ga0207665_10051109 | Ga0207665_100511092 | 103 |
| 240 | 3300025941 | Ga0207711_10840299 | Ga0207711_108402992 | 103 |
| 241 | 3300025944 | Ga0207661_10470094 | Ga0207661_104700942 | 103 |
| 242 | 3300025949 | Ga0207667_10499843 | Ga0207667_104998432 | 103 |
| 243 | 3300026023 | Ga0207677_10207255 | Ga0207677_102072552 | 103 |
| 244 | 3300026035 | Ga0207703_10281218 | Ga0207703_102812182 | 103 |
| 245 | 3300026095 | Ga0207676_10017375 | Ga0207676_100173753 | 103 |
| 246 | 3300026116 | Ga0207674_12051485 | Ga0207674_120514852 | 103 |
| 247 | 3300026121 | Ga0207683_10057274 | Ga0207683_100572742 | 103 |
| 248 | 3300026121 | Ga0207683_10464597 | Ga0207683_104645972 | 103 |
| 249 | 3300026121 | Ga0207683_12070779 | Ga0207683_120707791 | 103 |
| 250 | 3300027907 | Ga0207428_10018162 | Ga0207428_100181623 | 103 |
| 251 | 3300028379 | Ga0268266_10017666 | Ga0268266_100176662 | 103 |
| 252 | 3300028379 | Ga0268266_12116669 | Ga0268266_121166691 | 103 |
| 253 | 3300028381 | Ga0268264_12132961 | Ga0268264_121329611 | 103 |
| 254 | 3300031903 | Ga0307407_10140418 | Ga0307407_101404182 | 103 |
| 255 | 3300032002 | Ga0307416_102440675 | Ga0307416_1024406751 | 103 |
| 256 | 3300032002 | Ga0307416_102706554 | Ga0307416_1027065542 | 103 |
| 257 | 3300032002 | Ga0307416_103691138 | Ga0307416_1036911382 | 103 |
| 258 | 3300032005 | Ga0307411_10284858 | Ga0307411_102848582 | 103 |
| 259 | 3300032005 | Ga0307411_11131526 | Ga0307411_111315261 | 103 |
| 260 | 3300032126 | Ga0307415_100788873 | Ga0307415_1007888732 | 103 |
| 261 | 3300034816 | Ga0373930_0133985 | Ga0373930_0133985_87_434 | 103 |
| 262 | 3300034817 | Ga0373948_0022910 | Ga0373948_0022910_367_714 | 103 |
| 263 | 3300034819 | Ga0373958_0012635 | Ga0373958_0012635_452_799 | 103 |
| 264 | 3300035083 | Ga0373926_0000330 | Ga0373926_0000330_8328_8675 | 103 |
| 265 | 3300035083 | Ga0373926_0093766 | Ga0373926_0093766_441_821 | 103 |
| 266 | 3300035083 | Ga0373926_0116451 | Ga0373926_0116451_96_455 | 103 |
| 267 | 3300035086 | Ga0373934_0000006 | Ga0373934_0000006_75002_75349 | 103 |
| 268 | 3300035086 | Ga0373934_0017152 | Ga0373934_0017152_1910_2257 | 103 |
| 269 | 3300035086 | Ga0373934_0099540 | Ga0373934_0099540_128_469 | 103 |
| 270 | 3300035086 | Ga0373934_0113793 | Ga0373934_0113793_171_518 | 103 |
| 271 | 3300035088 | Ga0373940_0004399 | Ga0373940_0004399_1959_2306 | 103 |
| 272 | 3300035089 | Ga0373944_0038875 | Ga0373944_0038875_496_855 | 103 |
| 273 | 3300035089 | Ga0373944_0190785 | Ga0373944_0190785_222_602 | 103 |
| 274 | 3300035090 | Ga0373949_0092032 | Ga0373949_0092032_61_402 | 103 |
| 275 | 3300035111 | Ga0373923_0006532 | Ga0373923_0006532_1497_1847 | 103 |
| 276 | 3300035111 | Ga0373923_0027565 | Ga0373923_0027565_305_664 | 103 |
| 277 | 3300035111 | Ga0373923_0057518 | Ga0373923_0057518_682_1023 | 103 |
| 278 | 3300035111 | Ga0373923_0111872 | Ga0373923_0111872_321_668 | 103 |
| 279 | 3300035111 | Ga0373923_0164654 | Ga0373923_0164654_93_440 | 103 |
| 280 | 3300035111 | Ga0373923_0459538 | Ga0373923_0459538_69_416 | 103 |
| 281 | 3300035112 | Ga0373932_0040525 | Ga0373932_0040525_584_925 | 103 |
| 282 | 3300035113 | Ga0373936_0006261 | Ga0373936_0006261_4040_4381 | 103 |
| 283 | 3300035113 | Ga0373936_0145008 | Ga0373936_0145008_366_713 | 103 |
| 284 | 3300035113 | Ga0373936_0269091 | Ga0373936_0269091_133_483 | 103 |
| 285 | 3300035113 | Ga0373936_0480550 | Ga0373936_0480550_30_389 | 103 |
| 286 | 3300035116 | Ga0373945_0011759 | Ga0373945_0011759_923_1270 | 103 |
| 287 | 3300035116 | Ga0373945_0104958 | Ga0373945_0104958_93_443 | 103 |
| 288 | 3300035116 | Ga0373945_0106313 | Ga0373945_0106313_165_512 | 103 |
| 289 | 3300035117 | Ga0373953_0015552 | Ga0373953_0015552_2195_2545 | 103 |
| 290 | 3300035117 | Ga0373953_0073428 | Ga0373953_0073428_886_1233 | 103 |
| 291 | 3300035117 | Ga0373953_0211589 | Ga0373953_0211589_447_806 | 103 |
| 292 | 3300035117 | Ga0373953_0213913 | Ga0373953_0213913_293_640 | 103 |
| 293 | 3300035118 | Ga0373954_0006092 | Ga0373954_0006092_4193_4540 | 103 |
| 294 | 3300035118 | Ga0373954_0008686 | Ga0373954_0008686_1797_2147 | 103 |
| 295 | 3300035118 | Ga0373954_0169587 | Ga0373954_0169587_460_819 | 103 |
| 296 | 3300035118 | Ga0373954_0560703 | Ga0373954_0560703_199_546 | 103 |
| 297 | 3300035119 | Ga0373956_0000498 | Ga0373956_0000498_9297_9644 | 103 |
| 298 | 3300035119 | Ga0373956_0017185 | Ga0373956_0017185_1252_1593 | 103 |
| 299 | 3300035119 | Ga0373956_0037527 | Ga0373956_0037527_1056_1406 | 103 |
| 300 | 3300035119 | Ga0373956_0037610 | Ga0373956_0037610_290_637 | 103 |
| 301 | 3300035119 | Ga0373956_0088020 | Ga0373956_0088020_889_1236 | 103 |
| 302 | 3300035119 | Ga0373956_0092424 | Ga0373956_0092424_927_1274 | 103 |
| 303 | 3300035120 | Ga0373957_0000210 | Ga0373957_0000210_13081_13428 | 103 |
| 304 | 3300035120 | Ga0373957_0002317 | Ga0373957_0002317_2066_2407 | 103 |
| 305 | 3300035120 | Ga0373957_0004962 | Ga0373957_0004962_1950_2300 | 103 |
| 306 | 3300035120 | Ga0373957_0163977 | Ga0373957_0163977_386_733 | 103 |
| 307 | 3300035120 | Ga0373957_0234395 | Ga0373957_0234395_46_405 | 103 |
| 308 | 3300035121 | Ga0373960_0010117 | Ga0373960_0010117_231_578 | 103 |
| 309 | 3300035170 | Ga0373943_0294958 | Ga0373943_0294958_189_548 | 103 |
| 310 | 3300035170 | Ga0373943_0386406 | Ga0373943_0386406_179_559 | 103 |
| 311 | 3300035170 | Ga0373943_0890718 | Ga0373943_0890718_145_504 | 103 |
| 312 | 3300035171 | Ga0373946_0022333 | Ga0373946_0022333_534_881 | 103 |
| 313 | 3300035171 | Ga0373946_0176232 | Ga0373946_0176232_220_561 | 103 |
| 314 | 3300035171 | Ga0373946_0453146 | Ga0373946_0453146_87_434 | 103 |
| 315 | 3300035172 | Ga0373955_0000034 | Ga0373955_0000034_28036_28383 | 103 |
| 316 | 3300035172 | Ga0373955_0006038 | Ga0373955_0006038_289_630 | 103 |
| 317 | 3300035172 | Ga0373955_0024386 | Ga0373955_0024386_1688_2038 | 103 |
| 318 | 3300035172 | Ga0373955_0042477 | Ga0373955_0042477_1704_2051 | 103 |
| 319 | 3300035172 | Ga0373955_0088303 | Ga0373955_0088303_602_949 | 103 |
| 320 | 3300035172 | Ga0373955_0440035 | Ga0373955_0440035_65_412 | 103 |
| 321 | 3300035207 | Ga0373942_0225742 | Ga0373942_0225742_78_437 | 103 |
| 322 | 3300035241 | Ga0373961_0162511 | Ga0373961_0162511_132_473 | 103 |
| 323 | 3300035242 | Ga0373962_0187279 | Ga0373962_0187279_76_423 | 103 |
| 324 | 3300035410 | Ga0373924_0000343 | Ga0373924_0000343_4884_5231 | 103 |
| 325 | 3300035410 | Ga0373924_0003982 | Ga0373924_0003982_354_704 | 103 |
| 326 | 3300035410 | Ga0373924_0014387 | Ga0373924_0014387_1607_1966 | 103 |
| 327 | 3300035410 | Ga0373924_0039093 | Ga0373924_0039093_295_636 | 103 |
| 328 | 3300035410 | Ga0373924_0199477 | Ga0373924_0199477_201_548 | 103 |
| 329 | 3300035410 | Ga0373924_0507378 | Ga0373924_0507378_39_386 | 103 |
| 330 | 3300035691 | Ga0373931_0210179 | Ga0373931_0210179_587_934 | 103 |
| 331 | 3300035692 | Ga0373935_0021585 | Ga0373935_0021585_959_1309 | 103 |
| 332 | 3300035692 | Ga0373935_0038249 | Ga0373935_0038249_408_755 | 103 |
| 333 | 3300035692 | Ga0373935_0074216 | Ga0373935_0074216_1112_1471 | 103 |
| 334 | 3300035692 | Ga0373935_0126976 | Ga0373935_0126976_533_883 | 103 |
| 335 | 3300035692 | Ga0373935_0334158 | Ga0373935_0334158_635_976 | 103 |
| 336 | 3300035692 | Ga0373935_0378279 | Ga0373935_0378279_466_813 | 103 |
| 337 | 3300035695 | Ga0373927_0216435 | Ga0373927_0216435_854_1213 | 103 |
| 338 | 3300035724 | Ga0373933_0000161 | Ga0373933_0000161_25153_25500 | 103 |
| 339 | 3300035724 | Ga0373933_0001656 | Ga0373933_0001656_4468_4809 | 103 |
| 340 | 3300035724 | Ga0373933_0019627 | Ga0373933_0019627_1326_1673 | 103 |
| 341 | 3300035724 | Ga0373933_0033671 | Ga0373933_0033671_734_1081 | 103 |
| 342 | 3300035724 | Ga0373933_0397174 | Ga0373933_0397174_382_729 | 103 |
| 343 | 3300035724 | Ga0373933_0476249 | Ga0373933_0476249_55_396 | 103 |
| 344 | 3300035724 | Ga0373933_0569257 | Ga0373933_0569257_123_473 | 103 |
| 345 | 3300035725 | Ga0373947_0000002 | Ga0373947_0000002_271562_271909 | 103 |
| 346 | 3300035725 | Ga0373947_0055036 | Ga0373947_0055036_186_545 | 103 |
| 347 | 3300035725 | Ga0373947_0152211 | Ga0373947_0152211_635_982 | 103 |
| 348 | 3300035725 | Ga0373947_0282317 | Ga0373947_0282317_541_888 | 103 |
| 349 | 3300035725 | Ga0373947_0364616 | Ga0373947_0364616_440_790 | 103 |
| 350 | 3300035725 | Ga0373947_0367160 | Ga0373947_0367160_414_755 | 103 |
| 351 | 3300036401 | Ga0373937_0000126 | Ga0373937_0000126_25153_25500 | 103 |
| 352 | 3300036401 | Ga0373937_0074697 | Ga0373937_0074697_124_471 | 103 |
| 353 | 3300036401 | Ga0373937_0090176 | Ga0373937_0090176_840_1187 | 103 |
| 354 | 3300036401 | Ga0373937_0127435 | Ga0373937_0127435_349_690 | 103 |
| 355 | 3300036401 | Ga0373937_0140947 | Ga0373937_0140947_1074_1424 | 103 |
| 356 | 3300036401 | Ga0373937_0174808 | Ga0373937_0174808_338_685 | 103 |
| 357 | 3300036401 | Ga0373937_0487825 | Ga0373937_0487825_193_552 | 103 |
| 358 | 3300036401 | Ga0373937_0867575 | Ga0373937_0867575_327_674 | 103 |
| 359 | 3300037068 | Ga0373925_0001213 | Ga0373925_0001213_21051_21398 | 103 |
| 360 | 3300037068 | Ga0373925_0038055 | Ga0373925_0038055_1707_2057 | 103 |
| 361 | 3300037068 | Ga0373925_0048312 | Ga0373925_0048312_2575_2955 | 103 |
| 362 | 3300037068 | Ga0373925_0051316 | Ga0373925_0051316_264_614 | 103 |
| 363 | 3300037068 | Ga0373925_0175062 | Ga0373925_0175062_1205_1564 | 103 |
| 364 | 3300037068 | Ga0373925_0211319 | Ga0373925_0211319_333_680 | 103 |
| 365 | 3300037068 | Ga0373925_0241338 | Ga0373925_0241338_969_1316 | 103 |
| 366 | 3300037068 | Ga0373925_0275352 | Ga0373925_0275352_173_520 | 103 |
| 367 | 3300037068 | Ga0373925_1649305 | Ga0373925_1649305_149_496 | 103 |
| 368 | 3300037853 | Ga0436364_0398717 | Ga0436364_0398717_285_650 | 103 |
| 369 | 3300037853 | Ga0436364_1283416 | Ga0436364_1283416_1688_2038 | 103 |
| 370 | 3300039450 | Ga0436363_0426285 | Ga0436363_0426285_2174_2524 | 103 |
| 371 | 3300044693 | Ga0466961_0660174 | Ga0466961_0660174_253_603 | 103 |
| 372 | 3300044901 | Ga0466960_0077523 | Ga0466960_0077523_1316_1657 | 103 |
| 373 | 3300046454 | Ga0495592_0000030 | Ga0495592_0000030_103604_103951 | 103 |
| 374 | 3300046454 | Ga0495592_0002427 | Ga0495592_0002427_10437_10778 | 103 |
| 375 | 3300046454 | Ga0495592_0008472 | Ga0495592_0008472_5046_5396 | 103 |
| 376 | 3300046454 | Ga0495592_0064532 | Ga0495592_0064532_1514_1861 | 103 |
| 377 | 3300046454 | Ga0495592_0075825 | Ga0495592_0075825_247_606 | 103 |
| 378 | 3300046459 | Ga0495629_0001800 | Ga0495629_0001800_9046_9396 | 103 |
| 379 | 3300046459 | Ga0495629_0018263 | Ga0495629_0018263_4017_4358 | 103 |
| 380 | 3300046459 | Ga0495629_0150182 | Ga0495629_0150182_1072_1419 | 103 |
| 381 | 3300046461 | Ga0495641_0025433 | Ga0495641_0025433_240_581 | 103 |
| 382 | 3300046461 | Ga0495641_0032006 | Ga0495641_0032006_1566_1946 | 103 |
| 383 | 3300046461 | Ga0495641_0088219 | Ga0495641_0088219_850_1191 | 103 |
| 384 | 3300046462 | Ga0495651_0000221 | Ga0495651_0000221_25153_25500 | 103 |
| 385 | 3300046462 | Ga0495651_0008518 | Ga0495651_0008518_3771_4118 | 103 |
| 386 | 3300046462 | Ga0495651_0010326 | Ga0495651_0010326_2657_3004 | 103 |
| 387 | 3300046462 | Ga0495651_0096506 | Ga0495651_0096506_1234_1575 | 103 |
| 388 | 3300046462 | Ga0495651_0148920 | Ga0495651_0148920_1233_1583 | 103 |
| 389 | 3300046462 | Ga0495651_0474604 | Ga0495651_0474604_404_751 | 103 |
| 390 | 3300046463 | Ga0495653_0000895 | Ga0495653_0000895_16703_17050 | 103 |
| 391 | 3300046463 | Ga0495653_0014521 | Ga0495653_0014521_3967_4308 | 103 |
| 392 | 3300046463 | Ga0495653_0051335 | Ga0495653_0051335_1861_2220 | 103 |
| 393 | 3300046463 | Ga0495653_0052881 | Ga0495653_0052881_801_1148 | 103 |
| 394 | 3300046463 | Ga0495653_0111354 | Ga0495653_0111354_1342_1692 | 103 |
| 395 | 3300046463 | Ga0495653_0146733 | Ga0495653_0146733_382_729 | 103 |
| 396 | 3300046463 | Ga0495653_0313790 | Ga0495653_0313790_218_565 | 103 |
| 397 | 3300046463 | Ga0495653_0798770 | Ga0495653_0798770_50_397 | 103 |
| 398 | 3300046472 | Ga0495580_0281028 | Ga0495580_0281028_48_395 | 103 |
| 399 | 3300046473 | Ga0495582_0012433 | Ga0495582_0012433_1342_1692 | 103 |
| 400 | 3300046473 | Ga0495582_0115806 | Ga0495582_0115806_581_922 | 103 |
| 401 | 3300046473 | Ga0495582_0320667 | Ga0495582_0320667_175_555 | 103 |
| 402 | 3300046473 | Ga0495582_0367000 | Ga0495582_0367000_198_557 | 103 |
| 403 | 3300046475 | Ga0495639_0119891 | Ga0495639_0119891_851_1192 | 103 |
| 404 | 3300046475 | Ga0495639_0445845 | Ga0495639_0445845_46_405 | 103 |
| 405 | 3300046475 | Ga0495639_0735357 | Ga0495639_0735357_92_439 | 103 |
| 406 | 3300046476 | Ga0495662_0035385 | Ga0495662_0035385_1082_1423 | 103 |
| 407 | 3300046476 | Ga0495662_0054277 | Ga0495662_0054277_1375_1716 | 103 |
| 408 | 3300046476 | Ga0495662_0155992 | Ga0495662_0155992_673_1020 | 103 |
| 409 | 3300046476 | Ga0495662_0277993 | Ga0495662_0277993_151_510 | 103 |
| 410 | 3300046476 | Ga0495662_0351465 | Ga0495662_0351465_282_632 | 103 |
| 411 | 3300046477 | Ga0495664_0002344 | Ga0495664_0002344_9560_9910 | 103 |
| 412 | 3300046477 | Ga0495664_0017095 | Ga0495664_0017095_1931_2272 | 103 |
| 413 | 3300046477 | Ga0495664_0037941 | Ga0495664_0037941_1656_2003 | 103 |
| 414 | 3300046477 | Ga0495664_0122797 | Ga0495664_0122797_182_541 | 103 |
| 415 | 3300046477 | Ga0495664_0909054 | Ga0495664_0909054_103_453 | 103 |
| 416 | 3300046499 | Ga0495594_0070211 | Ga0495594_0070211_375_728 | 103 |
| 417 | 3300046499 | Ga0495594_0711103 | Ga0495594_0711103_51_410 | 103 |
| 418 | 3300046511 | Ga0495608_0000191 | Ga0495608_0000191_17927_18274 | 103 |
| 419 | 3300046511 | Ga0495608_0014956 | Ga0495608_0014956_4469_4810 | 103 |
| 420 | 3300046511 | Ga0495608_0046647 | Ga0495608_0046647_736_1086 | 103 |
| 421 | 3300046511 | Ga0495608_0102011 | Ga0495608_0102011_1233_1580 | 103 |
| 422 | 3300046511 | Ga0495608_0176632 | Ga0495608_0176632_47_406 | 103 |
| 423 | 3300046514 | Ga0495618_0010093 | Ga0495618_0010093_1172_1513 | 103 |
| 424 | 3300046514 | Ga0495618_0060083 | Ga0495618_0060083_1233_1583 | 103 |
| 425 | 3300046514 | Ga0495618_0065574 | Ga0495618_0065574_1160_1540 | 103 |
| 426 | 3300046516 | Ga0495628_0003830 | Ga0495628_0003830_8687_9034 | 103 |
| 427 | 3300046516 | Ga0495628_0034341 | Ga0495628_0034341_2054_2395 | 103 |
| 428 | 3300046516 | Ga0495628_0078885 | Ga0495628_0078885_2013_2372 | 103 |
| 429 | 3300046516 | Ga0495628_0083824 | Ga0495628_0083824_866_1213 | 103 |
| 430 | 3300046516 | Ga0495628_0131071 | Ga0495628_0131071_832_1182 | 103 |
| 431 | 3300046516 | Ga0495628_0230854 | Ga0495628_0230854_205_555 | 103 |
| 432 | 3300046516 | Ga0495628_0708927 | Ga0495628_0708927_84_434 | 103 |
| 433 | 3300046517 | Ga0495630_0112125 | Ga0495630_0112125_1071_1430 | 103 |
| 434 | 3300046517 | Ga0495630_0159618 | Ga0495630_0159618_872_1222 | 103 |
| 435 | 3300046517 | Ga0495630_0205176 | Ga0495630_0205176_721_1062 | 103 |
| 436 | 3300046517 | Ga0495630_0274243 | Ga0495630_0274243_832_1182 | 103 |
| 437 | 3300046517 | Ga0495630_0389478 | Ga0495630_0389478_322_669 | 103 |
| 438 | 3300046517 | Ga0495630_0827172 | Ga0495630_0827172_126_506 | 103 |
| 439 | 3300046517 | Ga0495630_0865701 | Ga0495630_0865701_309_656 | 103 |
| 440 | 3300046517 | Ga0495630_1113755 | Ga0495630_1113755_95_454 | 103 |
| 441 | 3300046526 | Ga0495666_0057348 | Ga0495666_0057348_1390_1770 | 103 |
| 442 | 3300046526 | Ga0495666_0246349 | Ga0495666_0246349_132_473 | 103 |
| 443 | 3300046529 | Ga0495652_0000921 | Ga0495652_0000921_8334_8681 | 103 |
| 444 | 3300046529 | Ga0495652_0064235 | Ga0495652_0064235_612_971 | 103 |
| 445 | 3300046529 | Ga0495652_0112779 | Ga0495652_0112779_1122_1463 | 103 |
| 446 | 3300046529 | Ga0495652_0257925 | Ga0495652_0257925_832_1182 | 103 |
| 447 | 3300046529 | Ga0495652_0265813 | Ga0495652_0265813_182_529 | 103 |
| 448 | 3300046529 | Ga0495652_0655383 | Ga0495652_0655383_271_630 | 103 |
| 449 | 3300046531 | Ga0495665_0050462 | Ga0495665_0050462_422_763 | 103 |
| 450 | 3300046531 | Ga0495665_0092802 | Ga0495665_0092802_188_538 | 103 |
| 451 | 3300046531 | Ga0495665_0140283 | Ga0495665_0140283_112_492 | 103 |
| 452 | 3300046533 | Ga0495640_0011149 | Ga0495640_0011149_4410_4757 | 103 |
| 453 | 3300046533 | Ga0495640_0016433 | Ga0495640_0016433_832_1182 | 103 |
| 454 | 3300046533 | Ga0495640_0020901 | Ga0495640_0020901_4404_4763 | 103 |
| 455 | 3300046533 | Ga0495640_0039834 | Ga0495640_0039834_2605_2946 | 103 |
| 456 | 3300046533 | Ga0495640_0140821 | Ga0495640_0140821_323_670 | 103 |
| 457 | 3300046533 | Ga0495640_0542890 | Ga0495640_0542890_288_638 | 103 |
| 458 | 3300046535 | Ga0495586_0063578 | Ga0495586_0063578_184_543 | 103 |
| 459 | 3300046535 | Ga0495586_0073703 | Ga0495586_0073703_1360_1710 | 103 |
| 460 | 3300046535 | Ga0495586_0215439 | Ga0495586_0215439_59_400 | 103 |
| 461 | 3300046535 | Ga0495586_0651176 | Ga0495586_0651176_54_401 | 103 |
| 462 | 3300046535 | Ga0495586_0854289 | Ga0495586_0854289_143_493 | 103 |
| 463 | 3300046536 | Ga0495587_0000210 | Ga0495587_0000210_17927_18274 | 103 |
| 464 | 3300046536 | Ga0495587_0019889 | Ga0495587_0019889_1820_2161 | 103 |
| 465 | 3300046536 | Ga0495587_0020581 | Ga0495587_0020581_2252_2599 | 103 |
| 466 | 3300046536 | Ga0495587_0024332 | Ga0495587_0024332_318_659 | 103 |
| 467 | 3300046536 | Ga0495587_0032571 | Ga0495587_0032571_2590_2949 | 103 |
| 468 | 3300046543 | Ga0495645_0015471 | Ga0495645_0015471_978_1328 | 103 |
| 469 | 3300046543 | Ga0495645_0056485 | Ga0495645_0056485_129_476 | 103 |
| 470 | 3300046543 | Ga0495645_0085457 | Ga0495645_0085457_166_516 | 103 |
| 471 | 3300046543 | Ga0495645_0135143 | Ga0495645_0135143_1161_1520 | 103 |
| 472 | 3300046543 | Ga0495645_0307343 | Ga0495645_0307343_147_494 | 103 |
| 473 | 3300046543 | Ga0495645_0341772 | Ga0495645_0341772_565_906 | 103 |
| 474 | 3300046543 | Ga0495645_0518242 | Ga0495645_0518242_312_659 | 103 |
| 475 | 3300046559 | Ga0495667_0000040 | Ga0495667_0000040_25153_25500 | 103 |
| 476 | 3300046559 | Ga0495667_0010717 | Ga0495667_0010717_2207_2554 | 103 |
| 477 | 3300046559 | Ga0495667_0013080 | Ga0495667_0013080_4659_5018 | 103 |
| 478 | 3300046559 | Ga0495667_0015850 | Ga0495667_0015850_2807_3154 | 103 |
| 479 | 3300046559 | Ga0495667_0060701 | Ga0495667_0060701_721_1062 | 103 |
| 480 | 3300046559 | Ga0495667_0797754 | Ga0495667_0797754_140_487 | 103 |
| 481 | 3300046642 | Ga0495634_0003736 | Ga0495634_0003736_6169_6519 | 103 |
| 482 | 3300046642 | Ga0495634_0017695 | Ga0495634_0017695_3954_4313 | 103 |
| 483 | 3300046642 | Ga0495634_0019945 | Ga0495634_0019945_495_842 | 103 |
| 484 | 3300046642 | Ga0495634_0076456 | Ga0495634_0076456_448_789 | 103 |
| 485 | 3300046642 | Ga0495634_0138953 | Ga0495634_0138953_219_566 | 103 |
| 486 | 3300046663 | Ga0495635_0017276 | Ga0495635_0017276_1361_1711 | 103 |
| 487 | 3300046663 | Ga0495635_0029863 | Ga0495635_0029863_3367_3708 | 103 |
| 488 | 3300046663 | Ga0495635_0036363 | Ga0495635_0036363_3009_3368 | 103 |
| 489 | 3300046663 | Ga0495635_0127562 | Ga0495635_0127562_107_466 | 103 |
| 490 | 3300046663 | Ga0495635_0134131 | Ga0495635_0134131_612_959 | 103 |
| 491 | 3300046663 | Ga0495635_0148435 | Ga0495635_0148435_298_645 | 103 |
| 492 | 3300046663 | Ga0495635_0148540 | Ga0495635_0148540_900_1247 | 103 |
| 493 | 3300046663 | Ga0495635_0270301 | Ga0495635_0270301_756_1103 | 103 |
| 494 | 3300046675 | Ga0495657_0000029 | Ga0495657_0000029_25153_25500 | 103 |
| 495 | 3300046675 | Ga0495657_0011357 | Ga0495657_0011357_3678_4037 | 103 |
| 496 | 3300046675 | Ga0495657_0013779 | Ga0495657_0013779_375_725 | 103 |
| 497 | 3300046675 | Ga0495657_0067790 | Ga0495657_0067790_315_656 | 103 |
| 498 | 3300046675 | Ga0495657_0071731 | Ga0495657_0071731_520_867 | 103 |
| 499 | 3300046675 | Ga0495657_0123526 | Ga0495657_0123526_1135_1482 | 103 |
| 500 | 3300046675 | Ga0495657_0247829 | Ga0495657_0247829_657_1004 | 103 |
| 501 | 3300046678 | Ga0495599_0000238 | Ga0495599_0000238_5986_6333 | 103 |
| 502 | 3300046678 | Ga0495599_0006812 | Ga0495599_0006812_1870_2229 | 103 |
| 503 | 3300046678 | Ga0495599_0011065 | Ga0495599_0011065_832_1182 | 103 |
| 504 | 3300046678 | Ga0495599_0020378 | Ga0495599_0020378_3042_3389 | 103 |
| 505 | 3300046678 | Ga0495599_0044594 | Ga0495599_0044594_2054_2395 | 103 |
| 506 | 3300046678 | Ga0495599_0079635 | Ga0495599_0079635_1020_1367 | 103 |
| 507 | 3300046678 | Ga0495599_0148446 | Ga0495599_0148446_563_910 | 103 |
| 508 | 3300046678 | Ga0495599_0160810 | Ga0495599_0160810_930_1277 | 103 |
| 509 | 3300046678 | Ga0495599_0378450 | Ga0495599_0378450_35_382 | 103 |
| 510 | 3300046678 | Ga0495599_0796816 | Ga0495599_0796816_13_363 | 103 |
| 511 | 3300046679 | Ga0495623_0000652 | Ga0495623_0000652_14218_14565 | 103 |
| 512 | 3300046679 | Ga0495623_0021744 | Ga0495623_0021744_3449_3796 | 103 |
| 513 | 3300046679 | Ga0495623_0047553 | Ga0495623_0047553_1353_1700 | 103 |
| 514 | 3300046679 | Ga0495623_0048775 | Ga0495623_0048775_2257_2598 | 103 |
| 515 | 3300046679 | Ga0495623_0181919 | Ga0495623_0181919_123_473 | 103 |
| 516 | 3300046679 | Ga0495623_0205434 | Ga0495623_0205434_45_404 | 103 |
| 517 | 3300046680 | Ga0495646_0017835 | Ga0495646_0017835_3456_3797 | 103 |
| 518 | 3300046680 | Ga0495646_0055286 | Ga0495646_0055286_738_1085 | 103 |
| 519 | 3300046680 | Ga0495646_0119361 | Ga0495646_0119361_189_539 | 103 |
| 520 | 3300046680 | Ga0495646_0130857 | Ga0495646_0130857_508_855 | 103 |
| 521 | 3300046681 | Ga0495647_0077274 | Ga0495647_0077274_853_1212 | 103 |
| 522 | 3300046683 | Ga0495658_0010787 | Ga0495658_0010787_3001_3342 | 103 |
| 523 | 3300046683 | Ga0495658_0024208 | Ga0495658_0024208_1175_1525 | 103 |
| 524 | 3300046683 | Ga0495658_0286242 | Ga0495658_0286242_479_826 | 103 |
| 525 | 3300046689 | Ga0495613_0006014 | Ga0495613_0006014_4235_4576 | 103 |
| 526 | 3300046689 | Ga0495613_0286579 | Ga0495613_0286579_213_554 | 103 |
| 527 | 3300046689 | Ga0495613_0772280 | Ga0495613_0772280_126_506 | 103 |
| 528 | 3300046690 | Ga0495624_0038221 | Ga0495624_0038221_356_697 | 103 |
| 529 | 3300046690 | Ga0495624_0047584 | Ga0495624_0047584_2304_2654 | 103 |
| 530 | 3300046690 | Ga0495624_0365578 | Ga0495624_0365578_289_648 | 103 |
| 531 | 3300046809 | Ga0495600_0001122 | Ga0495600_0001122_12706_13053 | 103 |
| 532 | 3300046809 | Ga0495600_0012428 | Ga0495600_0012428_3585_3926 | 103 |
| 533 | 3300046809 | Ga0495600_0060393 | Ga0495600_0060393_1970_2317 | 103 |
| 534 | 3300046809 | Ga0495600_0112858 | Ga0495600_0112858_928_1269 | 103 |
| 535 | 3300046809 | Ga0495600_0460500 | Ga0495600_0460500_183_563 | 103 |
| 536 | 3300046809 | Ga0495600_0561882 | Ga0495600_0561882_207_554 | 103 |
| 537 | 3300047315 | Ga0495581_0005470 | Ga0495581_0005470_5228_5578 | 103 |
| 538 | 3300047315 | Ga0495581_0016981 | Ga0495581_0016981_368_748 | 103 |
| 539 | 3300047315 | Ga0495581_0248528 | Ga0495581_0248528_549_908 | 103 |
| 540 | 3300047315 | Ga0495581_0294979 | Ga0495581_0294979_42_389 | 103 |
| 541 | 3300047315 | Ga0495581_0295767 | Ga0495581_0295767_384_725 | 103 |
| 542 | 3300047317 | Ga0495604_0000034 | Ga0495604_0000034_25153_25500 | 103 |
| 543 | 3300047317 | Ga0495604_0013791 | Ga0495604_0013791_5358_5708 | 103 |
| 544 | 3300047317 | Ga0495604_0031224 | Ga0495604_0031224_1371_1718 | 103 |
| 545 | 3300047317 | Ga0495604_0036970 | Ga0495604_0036970_3269_3628 | 103 |
| 546 | 3300047317 | Ga0495604_0076770 | Ga0495604_0076770_357_698 | 103 |
| 547 | 3300047317 | Ga0495604_0240711 | Ga0495604_0240711_367_714 | 103 |
| 548 | 3300047317 | Ga0495604_0985209 | Ga0495604_0985209_138_497 | 103 |
| 549 | 3300047319 | Ga0495674_0025013 | Ga0495674_0025013_405_752 | 103 |
| 550 | 3300047319 | Ga0495674_0040569 | Ga0495674_0040569_429_809 | 103 |
| 551 | 3300047319 | Ga0495674_0131073 | Ga0495674_0131073_1688_2038 | 103 |
| 552 | 3300047319 | Ga0495674_0201789 | Ga0495674_0201789_956_1303 | 103 |
| 553 | 3300047319 | Ga0495674_0379131 | Ga0495674_0379131_721_1062 | 103 |
| 554 | 3300047319 | Ga0495674_0399541 | Ga0495674_0399541_443_802 | 103 |
| 555 | 3300047319 | Ga0495674_0483130 | Ga0495674_0483130_14_373 | 103 |
| 556 | 3300047319 | Ga0495674_0901147 | Ga0495674_0901147_283_642 | 103 |
| 557 | 3300047321 | Ga0495676_0176606 | Ga0495676_0176606_392_733 | 103 |
| 558 | 3300047321 | Ga0495676_0495223 | Ga0495676_0495223_281_628 | 103 |
| 559 | 3300047322 | Ga0495680_0000522 | Ga0495680_0000522_25153_25500 | 103 |
| 560 | 3300047322 | Ga0495680_0002970 | Ga0495680_0002970_13801_14148 | 103 |
| 561 | 3300047322 | Ga0495680_0021482 | Ga0495680_0021482_4274_4621 | 103 |
| 562 | 3300047322 | Ga0495680_0023239 | Ga0495680_0023239_3272_3619 | 103 |
| 563 | 3300047322 | Ga0495680_0024387 | Ga0495680_0024387_1797_2147 | 103 |
| 564 | 3300047322 | Ga0495680_0024852 | Ga0495680_0024852_3657_4016 | 103 |
| 565 | 3300047322 | Ga0495680_0314242 | Ga0495680_0314242_349_690 | 103 |
| 566 | 3300047322 | Ga0495680_0973816 | Ga0495680_0973816_47_394 | 103 |
| 567 | 3300047444 | Ga0495675_0007809 | Ga0495675_0007809_169_510 | 103 |
| 568 | 3300047444 | Ga0495675_0034946 | Ga0495675_0034946_130_489 | 103 |
| 569 | 3300047444 | Ga0495675_0135794 | Ga0495675_0135794_524_871 | 103 |
| 570 | 3300047444 | Ga0495675_0149659 | Ga0495675_0149659_832_1182 | 103 |
| 571 | 3300047471 | Ga0495684_0011772 | Ga0495684_0011772_2970_3329 | 103 |
| 572 | 3300047471 | Ga0495684_0028184 | Ga0495684_0028184_1537_1878 | 103 |
| 573 | 3300047471 | Ga0495684_0054194 | Ga0495684_0054194_1029_1376 | 103 |
| 574 | 3300047471 | Ga0495684_0187972 | Ga0495684_0187972_1056_1406 | 103 |
| 575 | 3300047471 | Ga0495684_0387917 | Ga0495684_0387917_413_793 | 103 |
| 576 | 3300047471 | Ga0495684_0671733 | Ga0495684_0671733_48_395 | 103 |
| 577 | 3300047471 | Ga0495684_0735105 | Ga0495684_0735105_181_528 | 103 |
| 578 | 3300047471 | Ga0495684_0840601 | Ga0495684_0840601_158_505 | 103 |
| 579 | 3300047673 | Ga0495593_0001378 | Ga0495593_0001378_5563_5913 | 103 |
| 580 | 3300047673 | Ga0495593_0013402 | Ga0495593_0013402_3879_4220 | 103 |
| 581 | 3300047673 | Ga0495593_0029352 | Ga0495593_0029352_2327_2707 | 103 |
| 582 | 3300047673 | Ga0495593_0394632 | Ga0495593_0394632_194_553 | 103 |
| 583 | 3300047673 | Ga0495593_0608838 | Ga0495593_0608838_164_514 | 103 |
| 584 | 3300048088 | Ga0495602_0001101 | Ga0495602_0001101_8254_8601 | 103 |
| 585 | 3300048088 | Ga0495602_0027300 | Ga0495602_0027300_3208_3555 | 103 |
| 586 | 3300048088 | Ga0495602_0078601 | Ga0495602_0078601_1076_1423 | 103 |
| 587 | 3300048088 | Ga0495602_0208504 | Ga0495602_0208504_304_654 | 103 |
| 588 | 3300048088 | Ga0495602_0287897 | Ga0495602_0287897_150_497 | 103 |
| 589 | 3300048088 | Ga0495602_0496725 | Ga0495602_0496725_105_446 | 103 |
| 590 | 3300048089 | Ga0495614_0073849 | Ga0495614_0073849_995_1336 | 103 |
| 591 | 3300048089 | Ga0495614_0123982 | Ga0495614_0123982_622_981 | 103 |
| 592 | 3300048089 | Ga0495614_0167276 | Ga0495614_0167276_152_532 | 103 |
| 593 | 3300048903 | Ga0496100_0007843 | Ga0496100_0007843_5451_5798 | 103 |
| 594 | 3300048903 | Ga0496100_0980306 | Ga0496100_0980306_266_625 | 103 |
| 595 | 3300048904 | Ga0496101_0210138 | Ga0496101_0210138_673_1020 | 103 |
| 596 | 3300048904 | Ga0496101_0495393 | Ga0496101_0495393_449_796 | 103 |
| 597 | 3300048906 | Ga0496103_0275483 | Ga0496103_0275483_172_513 | 103 |
| 598 | 3300048906 | Ga0496103_0540728 | Ga0496103_0540728_176_523 | 103 |
| 599 | 3300048907 | Ga0496104_0000398 | Ga0496104_0000398_18637_18984 | 103 |
| 600 | 3300048907 | Ga0496104_0080748 | Ga0496104_0080748_1713_2060 | 103 |
| 601 | 3300048907 | Ga0496104_0159296 | Ga0496104_0159296_1181_1522 | 103 |
| 602 | 3300048908 | Ga0496105_0002315 | Ga0496105_0002315_7899_8246 | 103 |
| 603 | 3300048908 | Ga0496105_0048728 | Ga0496105_0048728_142_501 | 103 |
| 604 | 3300048909 | Ga0496106_0152986 | Ga0496106_0152986_909_1256 | 103 |
| 605 | 3300048909 | Ga0496106_0320558 | Ga0496106_0320558_749_1096 | 103 |
| 606 | 3300048909 | Ga0496106_0449649 | Ga0496106_0449649_616_975 | 103 |
| 607 | 3300048910 | Ga0496107_0074893 | Ga0496107_0074893_339_686 | 103 |
| 608 | 3300048911 | Ga0496108_0003584 | Ga0496108_0003584_6598_6945 | 103 |
| 609 | 3300048911 | Ga0496108_0048697 | Ga0496108_0048697_2258_2605 | 103 |
| 610 | 3300048912 | Ga0496109_0016447 | Ga0496109_0016447_5908_6255 | 103 |
| 611 | 3300048912 | Ga0496109_0233952 | Ga0496109_0233952_934_1293 | 103 |
| 612 | 3300048912 | Ga0496109_1226849 | Ga0496109_1226849_100_441 | 103 |
| 613 | 3300048913 | Ga0496110_0056717 | Ga0496110_0056717_2717_3076 | 103 |
| 614 | 3300048913 | Ga0496110_0101351 | Ga0496110_0101351_1665_2012 | 103 |
| 615 | 3300048913 | Ga0496110_0535929 | Ga0496110_0535929_597_938 | 103 |
| 616 | 3300048914 | Ga0496111_0015587 | Ga0496111_0015587_2883_3224 | 103 |
| 617 | 3300048915 | Ga0496112_0000555 | Ga0496112_0000555_20879_21226 | 103 |
| 618 | 3300048915 | Ga0496112_0148757 | Ga0496112_0148757_922_1269 | 103 |
| 619 | 3300048916 | Ga0496113_0007480 | Ga0496113_0007480_2620_2967 | 103 |
| 620 | 3300048916 | Ga0496113_0127075 | Ga0496113_0127075_1250_1597 | 103 |
| 621 | 3300048917 | Ga0496114_0139113 | Ga0496114_0139113_1056_1403 | 103 |
| 622 | 3300048917 | Ga0496114_0150228 | Ga0496114_0150228_767_1114 | 103 |
| 623 | 3300048918 | Ga0496115_0095603 | Ga0496115_0095603_1701_2048 | 103 |
| 624 | 3300048918 | Ga0496115_0095718 | Ga0496115_0095718_1134_1481 | 103 |
| 625 | 3300048918 | Ga0496115_0456277 | Ga0496115_0456277_144_503 | 103 |
| 626 | 3300049576 | Ga0501040_1017797 | Ga0501040_1017797_102_443 | 103 |
| 627 | 3300050507 | nmdc:mga05p37_55814_c1 | nmdc:mga05p37_55814_c1_3949_4290 | 103 |
| 628 | 3300050507 | nmdc:mga05p37_943223_c1 | nmdc:mga05p37_943223_c1_370_717 | 103 |
| 629 | 3300050508 | nmdc:mga09592_1297538_c1 | nmdc:mga09592_1297538_c1_54_395 | 103 |
| 630 | 3300050511 | nmdc:mga08y16_176108_c1 | nmdc:mga08y16_176108_c1_758_1105 | 103 |
| 631 | 3300050512 | nmdc:mga0n895_483430_c1 | nmdc:mga0n895_483430_c1_541_888 | 103 |
| 632 | 3300050512 | nmdc:mga0n895_4834_c1 | nmdc:mga0n895_4834_c1_811_1161 | 103 |
| 633 | 3300050513 | nmdc:mga0rr50_129776_c1 | nmdc:mga0rr50_129776_c1_448_795 | 103 |
| 634 | 3300050513 | nmdc:mga0rr50_160290_c1 | nmdc:mga0rr50_160290_c1_190_531 | 103 |
| 635 | 3300050513 | nmdc:mga0rr50_33563_c1 | nmdc:mga0rr50_33563_c1_1802_2149 | 103 |
| 636 | 3300050513 | nmdc:mga0rr50_39424_c1 | nmdc:mga0rr50_39424_c1_1244_1603 | 103 |
| 637 | 3300050513 | nmdc:mga0rr50_5465_c1 | nmdc:mga0rr50_5465_c1_5060_5410 | 103 |
| 638 | 3300050514 | nmdc:mga08x19_134520_c1 | nmdc:mga08x19_134520_c1_311_658 | 103 |
| 639 | 3300050514 | nmdc:mga08x19_20767_c1 | nmdc:mga08x19_20767_c1_690_1040 | 103 |
| 640 | 3300050514 | nmdc:mga08x19_307987_c1 | nmdc:mga08x19_307987_c1_465_806 | 103 |
| 641 | 3300050515 | nmdc:mga0a205_71814_c1 | nmdc:mga0a205_71814_c1_1924_2274 | 103 |
| 642 | 3300053077 | Ga0495601_0003370 | Ga0495601_0003370_8542_8892 | 103 |
| 643 | 3300053077 | Ga0495601_0164091 | Ga0495601_0164091_949_1296 | 103 |
| 644 | 3300053077 | Ga0495601_0249898 | Ga0495601_0249898_412_771 | 103 |
| 645 | 3300053077 | Ga0495601_0279924 | Ga0495601_0279924_422_763 | 103 |
| 646 | 3300053077 | Ga0495601_0304230 | Ga0495601_0304230_437_817 | 103 |
| 647 | 3300053077 | Ga0495601_0368083 | Ga0495601_0368083_133_492 | 103 |
| 648 | 3300053077 | Ga0495601_0788079 | Ga0495601_0788079_61_411 | 103 |
| 649 | 3300053078 | Ga0495612_0099800 | Ga0495612_0099800_150_500 | 103 |
| 650 | 3300053078 | Ga0495612_0223220 | Ga0495612_0223220_396_737 | 103 |
| 651 | 3300053084 | Ga0495595_0004176 | Ga0495595_0004176_3611_3958 | 103 |
| 652 | 3300053084 | Ga0495595_0009675 | Ga0495595_0009675_103_453 | 103 |
| 653 | 3300053084 | Ga0495595_0042151 | Ga0495595_0042151_449_790 | 103 |
| 654 | 3300053084 | Ga0495595_0099818 | Ga0495595_0099818_634_993 | 103 |
| 655 | 3300053084 | Ga0495595_0333039 | Ga0495595_0333039_304_654 | 103 |
| 656 | 3300053085 | Ga0495619_0001126 | Ga0495619_0001126_4425_4775 | 103 |
| 657 | 3300053085 | Ga0495619_0035907 | Ga0495619_0035907_1356_1703 | 103 |
| 658 | 3300053085 | Ga0495619_0058966 | Ga0495619_0058966_1474_1815 | 103 |
| 659 | 3300053085 | Ga0495619_0167066 | Ga0495619_0167066_384_734 | 103 |
| 660 | 3300053085 | Ga0495619_0308259 | Ga0495619_0308259_221_601 | 103 |
| 661 | 3300059647 | Ga0587079_190935 | Ga0587079_190935_15_359 | 103 |
| 662 | 3300005329 | Ga0070683_100245599 | Ga0070683_1002455991 | 104 |
| 663 | 3300005329 | Ga0070683_102303702 | Ga0070683_1023037021 | 104 |
| 664 | 3300005337 | Ga0070682_100962965 | Ga0070682_1009629651 | 104 |
| 665 | 3300005456 | Ga0070678_100374655 | Ga0070678_1003746552 | 104 |
| 666 | 3300005459 | Ga0068867_101176139 | Ga0068867_1011761391 | 104 |
| 667 | 3300005535 | Ga0070684_100210725 | Ga0070684_1002107252 | 104 |
| 668 | 3300009098 | Ga0105245_12613750 | Ga0105245_126137501 | 104 |
| 669 | 3300009177 | Ga0105248_11845621 | Ga0105248_118456212 | 104 |
| 670 | 3300013307 | Ga0157372_12948521 | Ga0157372_129485211 | 104 |
| 671 | 3300025911 | Ga0207654_11095668 | Ga0207654_110956681 | 104 |
| 672 | 3300025944 | Ga0207661_11136368 | Ga0207661_111363682 | 104 |
| 673 | 3300026121 | Ga0207683_10219179 | Ga0207683_102191792 | 104 |
| 674 | 3300031548 | Ga0307408_100450980 | Ga0307408_1004509802 | 104 |
| 675 | 3300031548 | Ga0307408_101527736 | Ga0307408_1015277361 | 104 |
| 676 | 3300031731 | Ga0307405_10140583 | Ga0307405_101405832 | 104 |
| 677 | 3300031731 | Ga0307405_10446875 | Ga0307405_104468752 | 104 |
| 678 | 3300031731 | Ga0307405_10725183 | Ga0307405_107251832 | 104 |
| 679 | 3300031824 | Ga0307413_10109837 | Ga0307413_101098372 | 104 |
| 680 | 3300031824 | Ga0307413_10194829 | Ga0307413_101948292 | 104 |
| 681 | 3300031824 | Ga0307413_11699630 | Ga0307413_116996301 | 104 |
| 682 | 3300031852 | Ga0307410_10845048 | Ga0307410_108450481 | 104 |
| 683 | 3300031852 | Ga0307410_11349582 | Ga0307410_113495821 | 104 |
| 684 | 3300031901 | Ga0307406_10070477 | Ga0307406_100704772 | 104 |
| 685 | 3300031901 | Ga0307406_10159376 | Ga0307406_101593762 | 104 |
| 686 | 3300031901 | Ga0307406_10272646 | Ga0307406_102726462 | 104 |
| 687 | 3300031901 | Ga0307406_10581931 | Ga0307406_105819311 | 104 |
| 688 | 3300031903 | Ga0307407_10312309 | Ga0307407_103123092 | 104 |
| 689 | 3300031903 | Ga0307407_10509654 | Ga0307407_105096541 | 104 |
| 690 | 3300031903 | Ga0307407_11421859 | Ga0307407_114218591 | 104 |
| 691 | 3300031911 | Ga0307412_10753094 | Ga0307412_107530941 | 104 |
| 692 | 3300031995 | Ga0307409_100017384 | Ga0307409_1000173842 | 104 |
| 693 | 3300031995 | Ga0307409_100985556 | Ga0307409_1009855562 | 104 |
| 694 | 3300031995 | Ga0307409_101493794 | Ga0307409_1014937941 | 104 |
| 695 | 3300031995 | Ga0307409_102332438 | Ga0307409_1023324381 | 104 |
| 696 | 3300032002 | Ga0307416_100170664 | Ga0307416_1001706642 | 104 |
| 697 | 3300032002 | Ga0307416_100257444 | Ga0307416_1002574441 | 104 |
| 698 | 3300032002 | Ga0307416_100753070 | Ga0307416_1007530702 | 104 |
| 699 | 3300032002 | Ga0307416_103133877 | Ga0307416_1031338771 | 104 |
| 700 | 3300032002 | Ga0307416_103815936 | Ga0307416_1038159361 | 104 |
| 701 | 3300032004 | Ga0307414_10013607 | Ga0307414_100136073 | 104 |
| 702 | 3300032004 | Ga0307414_10996961 | Ga0307414_109969612 | 104 |
| 703 | 3300032005 | Ga0307411_10860870 | Ga0307411_108608701 | 104 |
| 704 | 3300032005 | Ga0307411_11942706 | Ga0307411_119427061 | 104 |
| 705 | 3300032126 | Ga0307415_100051097 | Ga0307415_1000510972 | 104 |
| 706 | 3300032126 | Ga0307415_100274201 | Ga0307415_1002742012 | 104 |
| 707 | 3300032126 | Ga0307415_101148679 | Ga0307415_1011486792 | 104 |
| 708 | 3300032126 | Ga0307415_101378515 | Ga0307415_1013785151 | 104 |
| 709 | 3300041463 | Ga0451804_0297374 | Ga0451804_0297374_188_532 | 104 |
| 710 | 3300046500 | Ga0495596_0159804 | Ga0495596_0159804_435_794 | 104 |
| 711 | 3300046616 | Ga0495668_0801198 | Ga0495668_0801198_138_497 | 104 |
| 712 | 3300048903 | Ga0496100_1206893 | Ga0496100_1206893_61_405 | 104 |
| 713 | 3300035118 | Ga0373954_0400496 | Ga0373954_0400496_18_365 | 105 |
| 714 | 3300035691 | Ga0373931_0051453 | Ga0373931_0051453_1804_2163 | 106 |
| 715 | 3300005435 | Ga0070714_100024330 | Ga0070714_1000243306 | 107 |
| 716 | 3300005435 | Ga0070714_100172340 | Ga0070714_1001723403 | 107 |
| 717 | 3300028800 | Ga0265338_10008774 | Ga0265338_100087743 | 107 |
| 718 | 3300044693 | Ga0466961_0103358 | Ga0466961_0103358_117_479 | 107 |
| 719 | 3300045976 | Ga0466967_1109237 | Ga0466967_1109237_359_721 | 107 |
| 720 | 3300046459 | Ga0495629_0284677 | Ga0495629_0284677_622_972 | 107 |
| 721 | 3300046678 | Ga0495599_0879568 | Ga0495599_0879568_101_463 | 107 |
| 722 | 3300050512 | nmdc:mga0n895_592950_c1 | nmdc:mga0n895_592950_c1_381_752 | 107 |
| 723 | 3300003320 | rootH2_10086014 | rootH2_100860142 | 118 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3zo7-assembly1.cif.gz_E | crystal structure of clcfe27a with substrate | 0.7072 | 1 | 117 |
| 3znj-assembly1.cif.gz_3 | crystal structure of unliganded clcf from r.opacus 1cp in crystal form 1. | 0.6917 | 1 | 117 |
| 4fpi-assembly1.cif.gz_E | crystal structure of 5-chloromuconolactone isomerase from rhodococcus opacus 1cp | 0.6865 | 1 | 117 |
| 3znj-assembly3.cif.gz_9 | crystal structure of unliganded clcf from r.opacus 1cp in crystal form 1. | 0.6812 | 1 | 117 |
| 3zo7-assembly1.cif.gz_F | crystal structure of clcfe27a with substrate | 0.6806 | 1 | 117 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3znj100 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel | 0.688 | 1 | 117 | 3.30.70.1060 |
| af_O07243_1_96_3.30.70.1060 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel | 0.6633 | 1 | 117 | 3.30.70.1060 |
| 3znj100 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel | 0.6408 | 1 | 117 | 3.30.70.1060 |
| af_O07243_1_96_3.30.70.1060 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel | 0.6212 | 1 | 117 | 3.30.70.1060 |
| af_O07243_108_202_3.30.70.1060 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel | 0.6201 | 1 | 117 | 3.30.70.1060 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Q7WJB4-F1-model_v4 | YCII-related domain-containing protein | 0.642 | 1 | 118 |
|
| AF-A0A1Q7WJB4-F1-model_v4 | YCII-related domain-containing protein | 0.6369 | 1 | 118 |
|
| AF-A0A3T1B3Q3-F1-model_v4 | YCII-related domain-containing protein | 0.6302 | 1 | 114 |
|
| AF-A0A2V5SXJ2-F1-model_v4 | Dehydrogenase | 0.6283 | 1 | 118 |
|
| AF-A0A402CUE9-F1-model_v4 | Uncharacterized protein | 0.6276 | 1 | 118 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar