F477409

General Info

Members Datasets Scaffolds Average Seq Length
722 301 722 163

Family's Representative Sequence

Representative Sequence 3300005546|Ga0070696_100218371|Ga0070696_1002183712
Length 190
Sequence VAKLKLKKALKKLVRKAVPSKKAVVRKANGAGHHETQHAVEQFLFRQAELLDAKQWQDYIDLFTPEGVYWMPPEPSHTHWDGMPAIFAEDKNLMTVRMKRILHPDAWSQRPLWETNHVVSNIIVEKETADEVQVRSRFHMLELRRDDVRHFAGAYRHTLTRTPEGFRIKLQRVDMTNAQAAYDYVIQAWV

Samples

Sample ID Description Type Environment
1 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
76 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
148 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
149 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
150 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
151 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
152 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
153 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
154 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
155 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
156 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
157 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
158 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
159 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
160 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
161 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
162 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
163 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
164 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
165 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
166 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
167 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
168 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
169 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
170 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
171 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
172 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
173 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
174 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
175 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
176 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
177 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
178 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
179 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
180 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
181 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
182 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
183 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
184 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
185 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
186 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
187 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
188 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
189 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
190 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
191 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
192 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
193 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
194 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
195 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
196 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
197 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
198 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
199 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
200 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
201 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
202 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
203 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
204 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
205 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
206 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
207 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
208 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
209 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
210 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
211 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
212 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
213 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
214 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
215 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
216 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
217 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
218 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
219 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
220 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
221 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
222 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
223 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
224 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
225 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
226 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
227 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
228 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
229 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
230 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
231 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
232 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
233 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
234 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
235 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
236 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
237 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
238 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
239 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
240 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
241 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
242 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
243 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
244 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
245 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
246 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
247 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
248 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
249 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
250 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
251 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
252 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
253 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
254 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
255 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
256 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
257 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
258 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
259 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
271 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
272 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
273 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
274 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
275 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
276 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
277 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
278 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
279 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
280 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
281 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
282 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
283 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
284 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
286 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
287 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
288 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
289 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
290 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
291 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
292 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
293 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
294 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
295 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
296 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
297 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
298 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
299 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
300 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
301 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.14
Rhizosphere 99.72
Stem 0
Stem Tuber 0
Unclassified 0.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10020436 3300005295 Bacteria 1752
2 Ga0065707_10104294 3300005295 Bacteria 2703
3 Ga0070676_10060495 3300005328 Bacteria 2249
4 Ga0070683_100103896 3300005329 Bacteria 2678
5 Ga0070683_101282509 3300005329 Bacteria 704
6 Ga0070690_100000398 3300005330 Bacteria 21982
7 Ga0070690_100138389 3300005330 Unclassified 1651
8 Ga0068869_100001796 3300005334 Bacteria 12871
9 Ga0068869_100034494 3300005334 Unclassified 3580
10 Ga0070680_100001167 3300005336 Bacteria 18875
11 Ga0070680_100098560 3300005336 Bacteria 2424
12 Ga0070680_100118801 3300005336 Bacteria 2205
13 Ga0070680_100132431 3300005336 Bacteria 2087
14 Ga0070680_101115375 3300005336 Bacteria 682
15 Ga0070682_100001096 3300005337 Bacteria 15544
16 Ga0068868_100005562 3300005338 Bacteria 8862
17 Ga0070689_100000188 3300005340 Bacteria 37400
18 Ga0070689_100024102 3300005340 Unclassified 4563
19 Ga0070689_100097747 3300005340 Bacteria 2322
20 Ga0070689_100109570 3300005340 Bacteria 2194
21 Ga0070689_100701409 3300005340 Bacteria 884
22 Ga0070691_10022630 3300005341 Unclassified 2917
23 Ga0070687_100000069 3300005343 Bacteria 33055
24 Ga0070687_100232332 3300005343 Bacteria 1136
25 Ga0070692_10010076 3300005345 Bacteria 4287
26 Ga0070692_10303448 3300005345 Bacteria 976
27 Ga0070668_100022871 3300005347 Bacteria 4726
28 Ga0070669_100013309 3300005353 Bacteria 5847
29 Ga0070669_100364818 3300005353 Archaea 1175
30 Ga0070675_100230481 3300005354 Bacteria 1615
31 Ga0070671_100579148 3300005355 Archaea 969
32 Ga0070673_100269484 3300005364 Bacteria 1490
33 Ga0070673_100461768 3300005364 Bacteria 1143
34 Ga0070688_100146232 3300005365 Unclassified 1611
35 Ga0070688_100214206 3300005365 Bacteria 1354
36 Ga0070688_101090354 3300005365 Bacteria 638
37 Ga0070659_101147652 3300005366 Unclassified 686
38 Ga0070667_100761048 3300005367 Bacteria 898
39 Ga0070703_10083362 3300005406 Unclassified 1094
40 Ga0070714_100100787 3300005435 Bacteria 2544
41 Ga0070713_100195808 3300005436 Unclassified 1823
42 Ga0070710_10152865 3300005437 Bacteria 1425
43 Ga0070701_10000603 3300005438 Bacteria 12535
44 Ga0070711_100422986 3300005439 Bacteria 1086
45 Ga0070705_100001149 3300005440 Bacteria 14607
46 Ga0070705_100010469 3300005440 Bacteria 4644
47 Ga0070705_100024627 3300005440 Bacteria 3252
48 Ga0070705_100168798 3300005440 Bacteria 1471
49 Ga0070705_100234559 3300005440 Bacteria 1279
50 Ga0070700_100008466 3300005441 Bacteria 5600
51 Ga0070700_100023110 3300005441 Bacteria 3635
52 Ga0070700_101036391 3300005441 Unclassified 676
53 Ga0070694_100001966 3300005444 Bacteria 12184
54 Ga0070694_100038605 3300005444 Bacteria 3174
55 Ga0070694_100102411 3300005444 Bacteria 2027
56 Ga0070694_100154825 3300005444 Bacteria 1677
57 Ga0070694_100240387 3300005444 Bacteria 1366
58 Ga0070694_100319385 3300005444 Bacteria 1195
59 Ga0070694_100519864 3300005444 Unclassified 949
60 Ga0070694_100754982 3300005444 Unclassified 795
61 Ga0070694_100915354 3300005444 Bacteria 725
62 Ga0070708_100623349 3300005445 Bacteria 1017
63 Ga0070681_10035955 3300005458 Bacteria 4975
64 Ga0070681_10120479 3300005458 Bacteria 2559
65 Ga0070681_10229224 3300005458 Bacteria 1772
66 Ga0068867_100000296 3300005459 Bacteria 32704
67 Ga0068867_100011080 3300005459 Bacteria 6361
68 Ga0068867_100899274 3300005459 Unclassified 796
69 Ga0068867_101254362 3300005459 Bacteria 683
70 Ga0070706_100768166 3300005467 Bacteria 893
71 Ga0070706_101373514 3300005467 Bacteria 647
72 Ga0070707_100573127 3300005468 Bacteria 1091
73 Ga0070698_100052274 3300005471 Bacteria 4157
74 Ga0070698_100092149 3300005471 Bacteria 3011
75 Ga0070698_100490415 3300005471 Bacteria 1166
76 Ga0070699_100100337 3300005518 Bacteria 2537
77 Ga0070699_100234972 3300005518 Bacteria 1635
78 Ga0070699_100690030 3300005518 Bacteria 933
79 Ga0070699_101002427 3300005518 Bacteria 766
80 Ga0070679_100003737 3300005530 Bacteria 13955
81 Ga0070679_100112749 3300005530 Bacteria 2705
82 Ga0070679_100256385 3300005530 Bacteria 1704
83 Ga0070684_100212309 3300005535 Bacteria 1764
84 Ga0070697_100009252 3300005536 Bacteria 7699
85 Ga0070697_100396270 3300005536 Bacteria 1197
86 Ga0068853_100072412 3300005539 Unclassified 3003
87 Ga0070672_101561865 3300005543 Unclassified 592
88 Ga0070686_100000090 3300005544 Bacteria 63246
89 Ga0070686_100267793 3300005544 Bacteria 1255
90 Ga0070686_100358380 3300005544 Bacteria 1098
91 Ga0070686_100429094 3300005544 Bacteria 1011
92 Ga0070686_100434628 3300005544 Bacteria 1005
93 Ga0070686_101194839 3300005544 Unclassified 631
94 Ga0070695_100000188 3300005545 Bacteria 29840
95 Ga0070695_100004474 3300005545 Bacteria 8213
96 Ga0070695_100022517 3300005545 Bacteria 3866
97 Ga0070695_100119152 3300005545 Unclassified 1803
98 Ga0070695_100226764 3300005545 Bacteria 1349
99 Ga0070695_100443880 3300005545 Bacteria 993
100 Ga0070695_100465393 3300005545 Unclassified 971
101 Ga0070696_100000719 3300005546 Bacteria 21155
102 Ga0070696_100002632 3300005546 Bacteria 11903
103 Ga0070696_100036360 3300005546 Bacteria 3395
104 Ga0070696_100039245 3300005546 Bacteria 3270
105 Ga0070696_100218371 3300005546 Bacteria 1430
106 Ga0070696_100461964 3300005546 Bacteria 1004
107 Ga0070693_100000525 3300005547 Bacteria 17212
108 Ga0070704_100000168 3300005549 Bacteria 26018
109 Ga0070704_100000545 3300005549 Bacteria 18048
110 Ga0070704_100006984 3300005549 Bacteria 6696
111 Ga0070704_100037205 3300005549 Bacteria 3323
112 Ga0070704_100099034 3300005549 Bacteria 2192
113 Ga0070704_100466991 3300005549 Unclassified 1090
114 Ga0070704_100622522 3300005549 Bacteria 950
115 Ga0070704_101053583 3300005549 Unclassified 737
116 Ga0068855_100000833 3300005563 Bacteria 38155
117 Ga0068854_100000657 3300005578 Bacteria 20579
118 Ga0068854_100764757 3300005578 Bacteria 839
119 Ga0068856_100003103 3300005614 Bacteria 16966
120 Ga0070702_100000002 3300005615 Bacteria 83999
121 Ga0070702_100004543 3300005615 Bacteria 6350
122 Ga0070702_100595670 3300005615 Bacteria 828
123 Ga0068852_100439119 3300005616 Bacteria 1290
124 Ga0068859_100000195 3300005617 Bacteria 59015
125 Ga0068859_100115984 3300005617 Unclassified 2743
126 Ga0068859_100345673 3300005617 Bacteria 1582
127 Ga0068859_100719125 3300005617 Unclassified 1089
128 Ga0068864_100319590 3300005618 Bacteria 1458
129 Ga0068864_100666633 3300005618 Bacteria 1014
130 Ga0068866_10002071 3300005718 Bacteria 8341
131 Ga0068866_10089292 3300005718 Bacteria 1675
132 Ga0068861_100000043 3300005719 Bacteria 57807
133 Ga0068861_100062821 3300005719 Bacteria 2853
134 Ga0068858_100005138 3300005842 Bacteria 12824
135 Ga0068858_100199292 3300005842 Unclassified 1893
136 Ga0068860_100002559 3300005843 Bacteria 19020
137 Ga0068860_100083022 3300005843 Bacteria 3047
138 Ga0068862_100002188 3300005844 Bacteria 17538
139 Ga0068862_100070855 3300005844 Bacteria 3010
140 Ga0068862_100132940 3300005844 Bacteria 2202
141 Ga0068862_101635017 3300005844 Unclassified 652
142 Ga0081538_10125963 3300005981 Bacteria 1217
143 Ga0081539_10000233 3300005985 Bacteria 130647
144 Ga0070715_10050628 3300006163 Bacteria 1784
145 Ga0070716_100007311 3300006173 Bacteria 5433
146 Ga0070716_100059116 3300006173 Unclassified 2209
147 Ga0097621_100000045 3300006237 Bacteria 65278
148 Ga0097621_100016034 3300006237 Bacteria 5653
149 Ga0097621_100167247 3300006237 Bacteria 1894
150 Ga0097621_100350612 3300006237 Unclassified 1312
151 Ga0068871_100000040 3300006358 Bacteria 69044
152 Ga0068871_100012220 3300006358 Bacteria 6321
153 Ga0075428_100000047 3300006844 Bacteria 96882
154 Ga0075428_100043245 3300006844 Bacteria 4952
155 Ga0075428_100050115 3300006844 Bacteria 4580
156 Ga0075428_100097885 3300006844 Bacteria 3198
157 Ga0075428_100253105 3300006844 Unclassified 1897
158 Ga0075428_100530864 3300006844 Bacteria 1258
159 Ga0075428_101074348 3300006844 Bacteria 850
160 Ga0075430_100004392 3300006846 Bacteria 11904
161 Ga0075430_100018834 3300006846 Bacteria 5873
162 Ga0075430_100023346 3300006846 Bacteria 5263
163 Ga0075430_100058324 3300006846 Bacteria 3245
164 Ga0075430_100147024 3300006846 Unclassified 1963
165 Ga0075430_100164839 3300006846 Bacteria 1844
166 Ga0075431_100014374 3300006847 Bacteria 8006
167 Ga0075431_100101199 3300006847 Bacteria 2973
168 Ga0075431_100120534 3300006847 Bacteria 2707
169 Ga0075431_100237297 3300006847 Bacteria 1856
170 Ga0075433_10000605 3300006852 Bacteria 23895
171 Ga0075433_10071751 3300006852 Bacteria 3044
172 Ga0075434_100000006 3300006871 Bacteria 96966
173 Ga0075434_100000554 3300006871 Bacteria 28632
174 Ga0075434_100047891 3300006871 Bacteria 4241
175 Ga0075434_101456026 3300006871 Bacteria 694
176 Ga0075434_101813977 3300006871 Unclassified 617
177 Ga0075434_102044309 3300006871 Bacteria 578
178 Ga0075429_100000008 3300006880 Bacteria 86739
179 Ga0075429_100000067 3300006880 Bacteria 51949
180 Ga0075429_100052460 3300006880 Bacteria 3548
181 Ga0075429_100177709 3300006880 Bacteria 1865
182 Ga0075429_100298831 3300006880 Unclassified 1410
183 Ga0075429_101293697 3300006880 Unclassified 636
184 Ga0068865_100001956 3300006881 Bacteria 12156
185 Ga0075436_100000174 3300006914 Bacteria 40099
186 Ga0075436_100001082 3300006914 Bacteria 18349
187 Ga0075436_100009225 3300006914 Bacteria 6751
188 Ga0075436_100022044 3300006914 Bacteria 4374
189 Ga0075436_100072304 3300006914 Bacteria 2386
190 Ga0075436_100090296 3300006914 Bacteria 2129
191 Ga0075436_100127289 3300006914 Bacteria 1785
192 Ga0075436_100349398 3300006914 Bacteria 1065
193 Ga0075436_100466701 3300006914 Bacteria 921
194 Ga0097620_100000195 3300006931 Bacteria 59015
195 Ga0097620_100115982 3300006931 Unclassified 2743
196 Ga0097620_100345671 3300006931 Bacteria 1582
197 Ga0097620_100719110 3300006931 Unclassified 1089
198 Ga0075435_100020896 3300007076 Bacteria 5026
199 Ga0075435_100039691 3300007076 Bacteria 3757
200 Ga0075435_100058248 3300007076 Bacteria 3128
201 Ga0075435_100433430 3300007076 Bacteria 1133
202 Ga0099794_10501479 3300007265 Unclassified 639
203 Ga0105250_10073498 3300009092 Bacteria 1383
204 Ga0105250_10375435 3300009092 Bacteria 626
205 Ga0111539_10219068 3300009094 Bacteria 2217
206 Ga0111539_10226278 3300009094 Bacteria 2179
207 Ga0111539_10663354 3300009094 Bacteria 1214
208 Ga0111539_11002257 3300009094 Unclassified 971
209 Ga0111539_11198955 3300009094 Bacteria 882
210 Ga0111539_11293948 3300009094 Bacteria 846
211 Ga0105245_10000306 3300009098 Bacteria 47026
212 Ga0105245_10048544 3300009098 Bacteria 3798
213 Ga0105245_10536166 3300009098 Bacteria 1191
214 Ga0105245_11794603 3300009098 Bacteria 666
215 Ga0114129_10000040 3300009147 Bacteria 107971
216 Ga0114129_10021807 3300009147 Bacteria 9092
217 Ga0114129_10210929 3300009147 Bacteria 2625
218 Ga0114129_10298916 3300009147 Bacteria 2146
219 Ga0114129_10710863 3300009147 Bacteria 1290
220 Ga0114129_10897341 3300009147 Bacteria 1123
221 Ga0114129_10981008 3300009147 Bacteria 1065
222 Ga0114129_12239374 3300009147 Bacteria 657
223 Ga0105243_10000035 3300009148 Bacteria 177598
224 Ga0105243_10002936 3300009148 Bacteria 14105
225 Ga0105241_10070539 3300009174 Unclassified 2711
226 Ga0105242_10004996 3300009176 Bacteria 10258
227 Ga0105242_10039137 3300009176 Bacteria 3815
228 Ga0105242_10258541 3300009176 Bacteria 1572
229 Ga0105242_11735615 3300009176 Bacteria 661
230 Ga0105249_10007943 3300009553 Bacteria 9249
231 Ga0105249_10055112 3300009553 Bacteria 3636
232 Ga0105249_10189440 3300009553 Bacteria 2007
233 Ga0105239_10048386 3300010375 Bacteria 4663
234 Ga0157316_1019378 3300012510 Bacteria 729
235 Ga0157378_10001996 3300013297 Bacteria 18243
236 Ga0157378_10686009 3300013297 Bacteria 1043
237 Ga0163162_10347688 3300013306 Unclassified 1615
238 Ga0157372_11047746 3300013307 Bacteria 944
239 Ga0157372_11048349 3300013307 Unclassified 944
240 Ga0157375_10133322 3300013308 Bacteria 2605
241 Ga0157375_10546244 3300013308 Bacteria 1320
242 Ga0157380_10018970 3300014326 Bacteria 5119
243 Ga0157380_10106095 3300014326 Bacteria 2350
244 Ga0157380_10154190 3300014326 Bacteria 1989
245 Ga0157380_11415728 3300014326 Bacteria 746
246 Ga0157377_10049229 3300014745 Bacteria 2368
247 Ga0157377_10286936 3300014745 Unclassified 1081
248 Ga0157379_10978035 3300014968 Bacteria 806
249 Ga0157376_10000403 3300014969 Bacteria 28093
250 Ga0157376_10022959 3300014969 Bacteria 4873
251 Ga0163161_10225180 3300017792 Bacteria 1454
252 Ga0207692_10117272 3300025898 Unclassified 1485
253 Ga0207642_10003118 3300025899 Bacteria 5199
254 Ga0207642_10052050 3300025899 Bacteria 1856
255 Ga0207685_10260991 3300025905 Bacteria 842
256 Ga0207645_10414579 3300025907 Unclassified 907
257 Ga0207643_10044298 3300025908 Bacteria 2512
258 Ga0207643_10084606 3300025908 Bacteria 1841
259 Ga0207684_10682965 3300025910 Bacteria 873
260 Ga0207654_10034497 3300025911 Unclassified 2812
261 Ga0207707_10028946 3300025912 Bacteria 4841
262 Ga0207707_10048467 3300025912 Bacteria 3700
263 Ga0207707_10476037 3300025912 Unclassified 1067
264 Ga0207693_10462161 3300025915 Bacteria 991
265 Ga0207663_10133508 3300025916 Unclassified 1719
266 Ga0207660_10006506 3300025917 Bacteria 7582
267 Ga0207660_10047673 3300025917 Bacteria 3031
268 Ga0207660_10088771 3300025917 Bacteria 2287
269 Ga0207660_10155707 3300025917 Bacteria 1759
270 Ga0207660_10914922 3300025917 Unclassified 716
271 Ga0207662_10000006 3300025918 Bacteria 105457
272 Ga0207662_10039730 3300025918 Bacteria 2761
273 Ga0207652_10088081 3300025921 Bacteria 2723
274 Ga0207646_10280400 3300025922 Bacteria 1506
275 Ga0207681_10025231 3300025923 Bacteria 3821
276 Ga0207687_10003249 3300025927 Bacteria 11009
277 Ga0207687_10027525 3300025927 Bacteria 3815
278 Ga0207664_10036885 3300025929 Bacteria 3780
279 Ga0207644_10540261 3300025931 Unclassified 964
280 Ga0207686_10003499 3300025934 Bacteria 8434
281 Ga0207686_10016405 3300025934 Bacteria 4158
282 Ga0207686_11024912 3300025934 Bacteria 670
283 Ga0207709_10007469 3300025935 Bacteria 6084
284 Ga0207709_10015032 3300025935 Bacteria 4286
285 Ga0207670_10001617 3300025936 Bacteria 11751
286 Ga0207670_10020433 3300025936 Unclassified 4069
287 Ga0207670_10117777 3300025936 Bacteria 1925
288 Ga0207670_10594479 3300025936 Bacteria 908
289 Ga0207669_10021023 3300025937 Bacteria 3436
290 Ga0207665_10007350 3300025939 Bacteria 7284
291 Ga0207665_10081009 3300025939 Unclassified 2234
292 Ga0207665_10663647 3300025939 Unclassified 818
293 Ga0207711_10530941 3300025941 Bacteria 1097
294 Ga0207711_11559720 3300025941 Bacteria 604
295 Ga0207689_10000082 3300025942 Bacteria 76708
296 Ga0207689_10010692 3300025942 Bacteria 7895
297 Ga0207689_10097302 3300025942 Unclassified 2417
298 Ga0207689_10229664 3300025942 Unclassified 1534
299 Ga0207661_10010666 3300025944 Bacteria 6623
300 Ga0207667_10012981 3300025949 Bacteria 9561
301 Ga0207651_10048965 3300025960 Unclassified 2860
302 Ga0207712_10033486 3300025961 Bacteria 3474
303 Ga0207712_10096830 3300025961 Bacteria 2185
304 Ga0207640_10001404 3300025981 Bacteria 13006
305 Ga0207677_10005887 3300026023 Bacteria 6671
306 Ga0207703_10017112 3300026035 Bacteria 5653
307 Ga0207703_11678154 3300026035 Bacteria 611
308 Ga0207639_10203879 3300026041 Unclassified 1698
309 Ga0207708_10000936 3300026075 Bacteria 21857
310 Ga0207708_10005903 3300026075 Bacteria 9059
311 Ga0207708_10076932 3300026075 Bacteria 2560
312 Ga0207702_10014977 3300026078 Bacteria 6433
313 Ga0207648_10000316 3300026089 Bacteria 52941
314 Ga0207648_10012170 3300026089 Bacteria 8061
315 Ga0207648_10098142 3300026089 Bacteria 2564
316 Ga0207648_10280594 3300026089 Bacteria 1490
317 Ga0207648_10414948 3300026089 Bacteria 1222
318 Ga0207676_10036639 3300026095 Unclassified 3734
319 Ga0207676_11050539 3300026095 Bacteria 804
320 Ga0207674_10481037 3300026116 Bacteria 1200
321 Ga0207675_100000064 3300026118 Bacteria 79279
322 Ga0207675_100020995 3300026118 Bacteria 6088
323 Ga0207675_100776432 3300026118 Bacteria 970
324 Ga0209969_1003506 3300027360 Bacteria 2173
325 Ga0209969_1019015 3300027360 Bacteria 1017
326 Ga0209969_1021320 3300027360 Bacteria 967
327 Ga0209967_1000357 3300027364 Bacteria 6048
328 Ga0209981_1008074 3300027378 Bacteria 1426
329 Ga0209981_1012236 3300027378 Bacteria 1187
330 Ga0210000_1000809 3300027462 Bacteria 4332
331 Ga0210000_1010309 3300027462 Bacteria 1382
332 Ga0210000_1015146 3300027462 Bacteria 1159
333 Ga0209995_1002187 3300027471 Bacteria 3072
334 Ga0209968_1009734 3300027526 Bacteria 1473
335 Ga0209968_1014172 3300027526 Bacteria 1254
336 Ga0209968_1028151 3300027526 Unclassified 932
337 Ga0209983_1007574 3300027665 Bacteria 2224
338 Ga0209588_1019685 3300027671 Bacteria 2109
339 Ga0209588_1173135 3300027671 Bacteria 679
340 Ga0209966_1046734 3300027695 Unclassified 914
341 Ga0209966_1100938 3300027695 Bacteria 652
342 Ga0209998_10004757 3300027717 Bacteria 2869
343 Ga0207428_10006021 3300027907 Bacteria 11221
344 Ga0207428_10225761 3300027907 Bacteria 1403
345 Ga0207428_10323740 3300027907 Bacteria 1138
346 Ga0207428_11007083 3300027907 Bacteria 585
347 Ga0268265_10006971 3300028380 Bacteria 7644
348 Ga0268265_10014708 3300028380 Bacteria 5338
349 Ga0268265_10127613 3300028380 Bacteria 2108
350 Ga0268264_10001394 3300028381 Bacteria 22601
351 Ga0268264_10112410 3300028381 Unclassified 2388
352 Ga0307408_100009977 3300031548 Bacteria 6257
353 Ga0307408_100197104 3300031548 Bacteria 1627
354 Ga0307408_100899559 3300031548 Unclassified 810
355 Ga0307408_101239381 3300031548 Unclassified 697
356 Ga0307408_101396030 3300031548 Bacteria 659
357 Ga0307412_10623669 3300031911 Bacteria 916
358 Ga0307416_100014510 3300032002 Bacteria 5405
359 Ga0307416_100146913 3300032002 Bacteria 2154
360 Ga0307416_100450787 3300032002 Bacteria 1339
361 Ga0307416_100701589 3300032002 Bacteria 1101
362 Ga0307411_10079222 3300032005 Bacteria 2255
363 Ga0307411_10277041 3300032005 Bacteria 1333
364 Ga0307411_10531564 3300032005 Bacteria 1000
365 Ga0373948_0018888 3300034817 Archaea 1299
366 Ga0373959_0011584 3300034820 Unclassified 1560
367 Ga0373938_0040440 3300034957 Bacteria 1034
368 Ga0373938_0134466 3300034957 Bacteria 647
369 Ga0373926_0001625 3300035083 Bacteria 6933
370 Ga0373928_0048764 3300035084 Bacteria 994
371 Ga0373928_0106030 3300035084 Bacteria 739
372 Ga0373929_0029314 3300035085 Bacteria 1167
373 Ga0373929_0067608 3300035085 Bacteria 849
374 Ga0373934_0000505 3300035086 Bacteria 13698
375 Ga0373934_0059617 3300035086 Unclassified 1519
376 Ga0373934_0147300 3300035086 Unclassified 963
377 Ga0373940_0001144 3300035088 Bacteria 4640
378 Ga0373944_0001341 3300035089 Bacteria 6197
379 Ga0373949_0047640 3300035090 Bacteria 1072
380 Ga0373951_0009424 3300035091 Bacteria 2198
381 Ga0373952_0052459 3300035092 Bacteria 976
382 Ga0373923_0005638 3300035111 Bacteria 4263
383 Ga0373923_0359759 3300035111 Bacteria 696
384 Ga0373936_0063265 3300035113 Archaea 1514
385 Ga0373939_0004598 3300035114 Bacteria 3268
386 Ga0373939_0004651 3300035114 Bacteria 3252
387 Ga0373939_0015372 3300035114 Bacteria 2002
388 Ga0373941_0034851 3300035115 Bacteria 1521
389 Ga0373945_0009215 3300035116 Bacteria 3230
390 Ga0373953_0020872 3300035117 Unclassified 2451
391 Ga0373953_0029634 3300035117 Bacteria 2118
392 Ga0373953_0106868 3300035117 Unclassified 1181
393 Ga0373954_0000020 3300035118 Bacteria 60211
394 Ga0373954_0000592 3300035118 Bacteria 13753
395 Ga0373954_0013456 3300035118 Bacteria 3646
396 Ga0373954_0152396 3300035118 Unclassified 1129
397 Ga0373956_0000714 3300035119 Bacteria 13664
398 Ga0373956_0008076 3300035119 Bacteria 4256
399 Ga0373957_0010655 3300035120 Bacteria 3046
400 Ga0373957_0103267 3300035120 Bacteria 1143
401 Ga0373957_0209768 3300035120 Bacteria 813
402 Ga0373960_0096245 3300035121 Unclassified 954
403 Ga0373960_0096662 3300035121 Bacteria 952
404 Ga0373960_0126494 3300035121 Unclassified 853
405 Ga0373960_0129364 3300035121 Bacteria 845
406 Ga0373946_0005400 3300035171 Bacteria 4607
407 Ga0373955_0008526 3300035172 Bacteria 4764
408 Ga0373955_0020377 3300035172 Bacteria 3333
409 Ga0373955_0045973 3300035172 Bacteria 2358
410 Ga0373955_0778866 3300035172 Unclassified 588
411 Ga0373942_0019335 3300035207 Unclassified 1699
412 Ga0373942_0104127 3300035207 Bacteria 870
413 Ga0373942_0192844 3300035207 Unclassified 672
414 Ga0373961_0013206 3300035241 Unclassified 2078
415 Ga0373961_0053627 3300035241 Bacteria 1204
416 Ga0373961_0110463 3300035241 Unclassified 900
417 Ga0373962_0023028 3300035242 Bacteria 1656
418 Ga0373924_0011800 3300035410 Bacteria 3251
419 Ga0373924_0034126 3300035410 Bacteria 2058
420 Ga0373931_0003341 3300035691 Bacteria 7186
421 Ga0373931_0017425 3300035691 Bacteria 3553
422 Ga0373931_0069470 3300035691 Unclassified 1919
423 Ga0373931_0099167 3300035691 Bacteria 1636
424 Ga0373931_0145086 3300035691 Bacteria 1379
425 Ga0373931_0430763 3300035691 Bacteria 840
426 Ga0373935_0007432 3300035692 Bacteria 6558
427 Ga0373935_0010129 3300035692 Bacteria 5645
428 Ga0373935_0164435 3300035692 Bacteria 1514
429 Ga0373935_0226679 3300035692 Bacteria 1300
430 Ga0373935_0937556 3300035692 Bacteria 642
431 Ga0373927_0028362 3300035695 Bacteria 3650
432 Ga0373927_0342917 3300035695 Bacteria 984
433 Ga0373933_0001085 3300035724 Bacteria 16282
434 Ga0373933_0010314 3300035724 Bacteria 5120
435 Ga0373933_0023497 3300035724 Bacteria 3522
436 Ga0373933_0089132 3300035724 Bacteria 1901
437 Ga0373933_0248342 3300035724 Bacteria 1145
438 Ga0373947_0188465 3300035725 Unclassified 1345
439 Ga0373947_0303141 3300035725 Archaea 1065
440 Ga0373937_0005040 3300036401 Bacteria 11244
441 Ga0373937_0011050 3300036401 Bacteria 7914
442 Ga0373937_0044614 3300036401 Bacteria 4050
443 Ga0373937_0047468 3300036401 Bacteria 3929
444 Ga0373937_0092999 3300036401 Bacteria 2795
445 Ga0373937_0619215 3300036401 Bacteria 1027
446 Ga0373925_0284174 3300037068 Bacteria 1333
447 Ga0242420_023185 3300038996 Bacteria 1120
448 Ga0439439_0042570 3300041406 Bacteria 1180
449 Ga0439461_0002846 3300041410 Bacteria 2800
450 Ga0439465_0151432 3300041413 Unclassified 829
451 Ga0451807_1028620 3300041486 Bacteria 1526
452 Ga0451853_4099157 3300041512 Bacteria 781
453 Ga0439441_016881 3300042001 Bacteria 1306
454 Ga0439441_028188 3300042001 Bacteria 1075
455 Ga0439462_0063660 3300042015 Bacteria 998
456 Ga0439446_0027521 3300042156 Bacteria 1632
457 Ga0439434_0012556 3300042435 Bacteria 2506
458 Ga0439434_0029512 3300042435 Bacteria 1663
459 Ga0439435_0009299 3300042436 Bacteria 2303
460 Ga0439435_0026661 3300042436 Unclassified 1540
461 Ga0439435_0072329 3300042436 Bacteria 1022
462 Ga0439435_0109451 3300042436 Unclassified 856
463 Ga0439444_0018510 3300042437 Bacteria 1206
464 Ga0439444_0020499 3300042437 Bacteria 1163
465 Ga0439460_0002845 3300042461 Bacteria 4167
466 Ga0450893_0010142 3300042532 Bacteria 1545
467 Ga0451577_0810099 3300042876 Bacteria 846
468 Ga0451577_1191818 3300042876 Bacteria 679
469 Ga0466964_0040288 3300044706 Unclassified 1886
470 Ga0453684_0364527 3300044712 Unclassified 1626
471 Ga0466957_0047747 3300044842 Unclassified 2602
472 Ga0466960_0074678 3300044901 Bacteria 1695
473 Ga0451576_0000822 3300045051 Bacteria 60600
474 Ga0451576_0022841 3300045051 Bacteria 6777
475 Ga0451576_0029853 3300045051 Bacteria 5832
476 Ga0451576_0098737 3300045051 Bacteria 3037
477 Ga0451576_0177885 3300045051 Bacteria 2221
478 Ga0451576_0520242 3300045051 Bacteria 1250
479 Ga0466967_0164773 3300045976 Bacteria 2082
480 Ga0495592_0000293 3300046454 Bacteria 42689
481 Ga0495592_0044598 3300046454 Bacteria 3312
482 Ga0495592_0057151 3300046454 Bacteria 2880
483 Ga0495592_0136588 3300046454 Bacteria 1709
484 Ga0495603_0046469 3300046455 Bacteria 2587
485 Ga0495629_0476902 3300046459 Bacteria 843
486 Ga0495641_0010332 3300046461 Bacteria 5420
487 Ga0495641_0058502 3300046461 Unclassified 1744
488 Ga0495651_0011710 3300046462 Bacteria 6740
489 Ga0495651_0176623 3300046462 Bacteria 1516
490 Ga0495651_0376261 3300046462 Bacteria 932
491 Ga0495653_0190250 3300046463 Unclassified 1401
492 Ga0495580_0087444 3300046472 Bacteria 2170
493 Ga0495582_0012388 3300046473 Bacteria 4698
494 Ga0495639_0005058 3300046475 Bacteria 5665
495 Ga0495639_0030059 3300046475 Unclassified 2413
496 Ga0495662_0005966 3300046476 Bacteria 6088
497 Ga0495662_0017552 3300046476 Bacteria 3464
498 Ga0495662_0026785 3300046476 Bacteria 2784
499 Ga0495594_0304706 3300046499 Bacteria 907
500 Ga0495608_0047424 3300046511 Bacteria 2856
501 Ga0495608_0072742 3300046511 Bacteria 2242
502 Ga0495608_0150098 3300046511 Bacteria 1485
503 Ga0495608_0178831 3300046511 Bacteria 1343
504 Ga0495608_0337276 3300046511 Bacteria 929
505 Ga0495618_0033479 3300046514 Bacteria 3222
506 Ga0495618_0230766 3300046514 Unclassified 1165
507 Ga0495628_0017983 3300046516 Bacteria 5864
508 Ga0495628_0024530 3300046516 Bacteria 4935
509 Ga0495628_0080332 3300046516 Bacteria 2535
510 Ga0495628_0200299 3300046516 Unclassified 1504
511 Ga0495628_0251110 3300046516 Unclassified 1320
512 Ga0495628_0355832 3300046516 Bacteria 1076
513 Ga0495630_0032665 3300046517 Bacteria 3879
514 Ga0495630_0055939 3300046517 Bacteria 2956
515 Ga0495630_0081150 3300046517 Unclassified 2447
516 Ga0495644_0111494 3300046523 Bacteria 1038
517 Ga0495663_0159817 3300046525 Unclassified 773
518 Ga0495666_0033095 3300046526 Bacteria 2527
519 Ga0495666_0176120 3300046526 Bacteria 988
520 Ga0495642_0031610 3300046528 Bacteria 2123
521 Ga0495642_0239912 3300046528 Bacteria 792
522 Ga0495652_0086237 3300046529 Bacteria 2578
523 Ga0495652_0146302 3300046529 Bacteria 1852
524 Ga0495652_0298567 3300046529 Bacteria 1172
525 Ga0495665_0085235 3300046531 Bacteria 1660
526 Ga0495640_0018156 3300046533 Bacteria 5227
527 Ga0495640_0044954 3300046533 Bacteria 3066
528 Ga0495640_0242237 3300046533 Bacteria 1131
529 Ga0495586_0008518 3300046535 Bacteria 5457
530 Ga0495586_0176346 3300046535 Bacteria 1208
531 Ga0495586_0203553 3300046535 Unclassified 1122
532 Ga0495587_0024137 3300046536 Bacteria 3731
533 Ga0495587_0058727 3300046536 Bacteria 2259
534 Ga0495587_0167599 3300046536 Unclassified 1248
535 Ga0495598_0054186 3300046537 Bacteria 1217
536 Ga0495598_0132401 3300046537 Unclassified 856
537 Ga0495609_0108116 3300046538 Bacteria 1202
538 Ga0495621_0060974 3300046539 Bacteria 1369
539 Ga0495621_0074683 3300046539 Bacteria 1255
540 Ga0495645_0000344 3300046543 Bacteria 32939
541 Ga0495645_0078290 3300046543 Bacteria 2376
542 Ga0495667_0018506 3300046559 Bacteria 4706
543 Ga0495667_0064884 3300046559 Bacteria 2388
544 Ga0495667_0083269 3300046559 Bacteria 2077
545 Ga0495667_0118538 3300046559 Unclassified 1709
546 Ga0495667_0736911 3300046559 Bacteria 609
547 Ga0495634_0012351 3300046642 Bacteria 6185
548 Ga0495634_0022467 3300046642 Bacteria 4444
549 Ga0495634_0068049 3300046642 Bacteria 2353
550 Ga0495635_0056142 3300046663 Bacteria 2712
551 Ga0495635_0182715 3300046663 Bacteria 1425
552 Ga0495659_0125174 3300046664 Bacteria 1015
553 Ga0495659_0196544 3300046664 Bacteria 826
554 Ga0495588_0060033 3300046674 Bacteria 1968
555 Ga0495657_0014522 3300046675 Bacteria 5778
556 Ga0495657_0116727 3300046675 Bacteria 1685
557 Ga0495657_0159295 3300046675 Bacteria 1397
558 Ga0495657_0180204 3300046675 Bacteria 1297
559 Ga0495599_0000231 3300046678 Bacteria 35177
560 Ga0495599_0022846 3300046678 Bacteria 3906
561 Ga0495646_0156587 3300046680 Unclassified 1264
562 Ga0495647_0004648 3300046681 Bacteria 4474
563 Ga0495647_0310225 3300046681 Bacteria 712
564 Ga0495658_0015526 3300046683 Bacteria 3907
565 Ga0495658_0036547 3300046683 Bacteria 2710
566 Ga0495658_0519895 3300046683 Bacteria 762
567 Ga0495669_0033260 3300046684 Bacteria 2269
568 Ga0495613_0024505 3300046689 Bacteria 4495
569 Ga0495613_0031717 3300046689 Bacteria 3925
570 Ga0495624_0231645 3300046690 Bacteria 1119
571 Ga0495600_0009220 3300046809 Bacteria 6087
572 Ga0495600_0036340 3300046809 Bacteria 3201
573 Ga0495581_0123335 3300047315 Bacteria 1508
574 Ga0495581_0683956 3300047315 Bacteria 592
575 Ga0495604_0011098 3300047317 Bacteria 7151
576 Ga0495604_0015663 3300047317 Bacteria 6052
577 Ga0495636_0002166 3300047318 Bacteria 7532
578 Ga0495674_0080284 3300047319 Unclassified 2799
579 Ga0495674_0084033 3300047319 Bacteria 2728
580 Ga0495676_0211726 3300047321 Bacteria 1340
581 Ga0495680_0032475 3300047322 Bacteria 4236
582 Ga0495680_0056542 3300047322 Bacteria 3037
583 Ga0495680_0079301 3300047322 Bacteria 2483
584 Ga0495680_0101042 3300047322 Unclassified 2148
585 Ga0495680_0170505 3300047322 Bacteria 1576
586 Ga0495684_0025957 3300047471 Bacteria 4502
587 Ga0495684_0096567 3300047471 Bacteria 2236
588 Ga0495684_0319093 3300047471 Bacteria 1111
589 Ga0495684_0320692 3300047471 Unclassified 1108
590 Ga0495684_0700763 3300047471 Bacteria 671
591 Ga0495614_0164452 3300048089 Bacteria 994
592 Ga0501292_119558 3300049515 Bacteria 536
593 Ga0501298_073631 3300049521 Bacteria 741
594 Ga0501033_0030094 3300049570 Bacteria 4080
595 Ga0501036_0401188 3300049572 Bacteria 1144
596 Ga0501037_0253477 3300049573 Bacteria 1231
597 Ga0501037_0480080 3300049573 Bacteria 845
598 Ga0501038_0050494 3300049574 Bacteria 3593
599 Ga0501038_0305991 3300049574 Bacteria 1246
600 Ga0501039_0078134 3300049575 Bacteria 2574
601 Ga0501039_0318257 3300049575 Bacteria 1223
602 Ga0501039_0378992 3300049575 Bacteria 1111
603 Ga0501039_0762417 3300049575 Bacteria 755
604 Ga0501040_0034358 3300049576 Bacteria 3435
605 Ga0501040_0156972 3300049576 Unclassified 1607
606 Ga0501040_0402107 3300049576 Bacteria 983
607 Ga0501040_0454069 3300049576 Bacteria 922
608 Ga0501041_0137227 3300049577 Bacteria 1524
609 Ga0501041_0285010 3300049577 Bacteria 1040
610 Ga0501041_0330409 3300049577 Unclassified 962
611 Ga0501041_0463001 3300049577 Bacteria 805
612 Ga0501042_0035847 3300049578 Bacteria 3519
613 Ga0501042_0309100 3300049578 Bacteria 1142
614 Ga0501042_0444357 3300049578 Unclassified 940
615 Ga0501043_0812048 3300049579 Unclassified 676
616 Ga0501046_0028053 3300049580 Bacteria 4588
617 Ga0501046_0055514 3300049580 Bacteria 3112
618 Ga0501046_0541311 3300049580 Bacteria 831
619 Ga0501048_0083168 3300049582 Bacteria 2257
620 Ga0501048_0189561 3300049582 Bacteria 1457
621 Ga0501048_0662988 3300049582 Bacteria 749
622 Ga0501068_0032306 3300049584 Bacteria 3113
623 Ga0501071_0000879 3300049587 Bacteria 16236
624 Ga0501071_0071317 3300049587 Bacteria 2532
625 Ga0501071_0469648 3300049587 Bacteria 964
626 Ga0501072_0003042 3300049588 Bacteria 12653
627 Ga0501072_0076283 3300049588 Bacteria 2652
628 Ga0501072_0077852 3300049588 Bacteria 2626
629 Ga0501072_0081610 3300049588 Bacteria 2563
630 Ga0501072_0126733 3300049588 Bacteria 2034
631 Ga0501073_0155271 3300049589 Bacteria 1586
632 Ga0501073_0284449 3300049589 Bacteria 1141
633 Ga0501074_0211108 3300049590 Bacteria 1383
634 Ga0501075_0044465 3300049591 Bacteria 3332
635 Ga0501075_0166662 3300049591 Bacteria 1681
636 Ga0501075_0181147 3300049591 Bacteria 1607
637 Ga0501076_0001168 3300049592 Bacteria 17374
638 Ga0501077_0213297 3300049593 Bacteria 1227
639 Ga0501235_044322 3300049669 Bacteria 1022
640 Ga0501249_034262 3300049679 Bacteria 1139
641 Ga0501079_0002730 3300049741 Bacteria 12860
642 Ga0501079_0041684 3300049741 Bacteria 3545
643 Ga0501079_0358803 3300049741 Bacteria 1142
644 Ga0501080_0058100 3300049742 Bacteria 3601
645 Ga0501081_0013737 3300049743 Bacteria 5326
646 Ga0501273_014629 3300049770 Bacteria 1012
647 Ga0501035_0047672 3300049822 Bacteria 3845
648 Ga0501035_0432495 3300049822 Bacteria 1091
649 Ga0501045_0068835 3300049824 Bacteria 2601
650 Ga0501045_0082061 3300049824 Bacteria 2377
651 nmdc:mga05p37_109_c1 3300050507 Bacteria 74571
652 nmdc:mga05p37_261434_c1 3300050507 Bacteria 2071
653 nmdc:mga05p37_358492_c1 3300050507 Bacteria 1715
654 nmdc:mga05p37_604246_c1 3300050507 Bacteria 1237
655 nmdc:mga05p37_886_c1 3300050507 Bacteria 33754
656 nmdc:mga09592_140748_c1 3300050508 Bacteria 2080
657 nmdc:mga09592_202854_c1 3300050508 Unclassified 1717
658 nmdc:mga09592_2901_c1 3300050508 Bacteria 13899
659 nmdc:mga09592_6868_c1 3300050508 Bacteria 9261
660 nmdc:mga0qj67_1170396_c1 3300050509 Unclassified 599
661 nmdc:mga0qj67_137754_c1 3300050509 Unclassified 1978
662 nmdc:mga0qj67_2700_c1 3300050509 Bacteria 12721
663 nmdc:mga0qj67_27222_c1 3300050509 Bacteria 4428
664 nmdc:mga0qj67_385230_c1 3300050509 Bacteria 1132
665 nmdc:mga0qj67_41917_c1 3300050509 Bacteria 3603
666 nmdc:mga0qj67_422082_c1 3300050509 Bacteria 1075
667 nmdc:mga0qj67_507182_c1 3300050509 Bacteria 970
668 nmdc:mga0qj67_662400_c1 3300050509 Unclassified 832
669 nmdc:mga0qj67_6924_c1 3300050509 Bacteria 8346
670 nmdc:mga06r32_1611305_c1 3300050510 Bacteria 587
671 nmdc:mga06r32_16323_c1 3300050510 Bacteria 6764
672 nmdc:mga06r32_173746_c1 3300050510 Bacteria 2139
673 nmdc:mga06r32_287585_c1 3300050510 Bacteria 1631
674 nmdc:mga06r32_309216_c1 3300050510 Unclassified 1566
675 nmdc:mga06r32_383217_c1 3300050510 Bacteria 1389
676 nmdc:mga06r32_395194_c1 3300050510 Bacteria 1365
677 nmdc:mga08y16_152610_c1 3300050511 Bacteria 2401
678 nmdc:mga08y16_189087_c1 3300050511 Unclassified 2136
679 nmdc:mga08y16_346845_c1 3300050511 Bacteria 1526
680 nmdc:mga08y16_429286_c1 3300050511 Unclassified 1350
681 nmdc:mga08y16_90814_c1 3300050511 Bacteria 3184
682 nmdc:mga0n895_423934_c1 3300050512 Bacteria 1345
683 nmdc:mga0n895_4702_c1 3300050512 Bacteria 11267
684 nmdc:mga0n895_677390_c1 3300050512 Unclassified 1028
685 nmdc:mga0n895_772692_c1 3300050512 Archaea 952
686 nmdc:mga0n895_8407_c1 3300050512 Bacteria 8937
687 nmdc:mga0n895_86_c1 3300050512 Bacteria 53794
688 nmdc:mga0rr50_241822_c1 3300050513 Unclassified 1496
689 nmdc:mga0rr50_3195_c1 3300050513 Bacteria 9370
690 nmdc:mga0rr50_390926_c1 3300050513 Bacteria 1174
691 nmdc:mga0rr50_664_c1 3300050513 Bacteria 18446
692 nmdc:mga08x19_11713_c1 3300050514 Bacteria 5282
693 nmdc:mga08x19_138253_c1 3300050514 Bacteria 1644
694 nmdc:mga08x19_20408_c1 3300050514 Bacteria 4079
695 nmdc:mga08x19_4656_c1 3300050514 Bacteria 8139
696 nmdc:mga08x19_557910_c1 3300050514 Bacteria 811
697 nmdc:mga08x19_6463_c1 3300050514 Bacteria 6938
698 nmdc:mga08x19_70089_c1 3300050514 Bacteria 2284
699 nmdc:mga08x19_758067_c1 3300050514 Unclassified 689
700 nmdc:mga0a205_281873_c1 3300050515 Bacteria 1537
701 nmdc:mga0a205_31489_c1 3300050515 Bacteria 5081
702 nmdc:mga0a205_385096_c1 3300050515 Unclassified 1267
703 nmdc:mga0a205_505_c1 3300050515 Bacteria 30610
704 Ga0495601_0000862 3300053077 Bacteria 16539
705 Ga0495601_0018854 3300053077 Bacteria 4203
706 Ga0495601_0029688 3300053077 Bacteria 3393
707 Ga0495601_0153551 3300053077 Bacteria 1503
708 Ga0495601_0254334 3300053077 Bacteria 1147
709 Ga0495595_0008449 3300053084 Bacteria 4225
710 Ga0495595_0523631 3300053084 Bacteria 605
711 Ga0495619_0034504 3300053085 Bacteria 3289
712 Ga0495619_0108655 3300053085 Unclassified 1893
713 Ga0501084_0047735 3300054114 Bacteria 3586
714 Ga0501084_0096251 3300054114 Bacteria 2486
715 Ga0501084_0544486 3300054114 Bacteria 981
716 Ga0590075_057417 3300059424 Bacteria 1002
717 Ga0501082_0237309 3300060353 Bacteria 1587
718 Ga0501082_0744156 3300060353 Bacteria 858
719 Ga0530510_0001231 3300061734 Bacteria 17086
720 Ga0530510_0215943 3300061734 Bacteria 1425
721 Ga0530510_0220211 3300061734 Unclassified 1411
722 Ga0530510_1022899 3300061734 Bacteria 632

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005345 Ga0070692_10303448 Ga0070692_103034482 130
2 3300005985 Ga0081539_10000233 Ga0081539_1000023391 147
3 3300005440 Ga0070705_100234559 Ga0070705_1002345592 148
4 3300005545 Ga0070695_100004474 Ga0070695_1000044744 148
5 3300006871 Ga0075434_101813977 Ga0075434_1018139771 148
6 3300050514 nmdc:mga08x19_138253_c1 nmdc:mga08x19_138253_c1_1126_1611 148
7 3300035086 Ga0373934_0147300 Ga0373934_0147300_44_580 150
8 3300035111 Ga0373923_0005638 Ga0373923_0005638_3119_3655 150
9 3300035117 Ga0373953_0020872 Ga0373953_0020872_1823_2359 150
10 3300035118 Ga0373954_0013456 Ga0373954_0013456_1114_1650 150
11 3300035119 Ga0373956_0008076 Ga0373956_0008076_2078_2614 150
12 3300035120 Ga0373957_0010655 Ga0373957_0010655_577_1113 150
13 3300035120 Ga0373957_0209768 Ga0373957_0209768_185_721 150
14 3300035172 Ga0373955_0008526 Ga0373955_0008526_2482_3018 150
15 3300035410 Ga0373924_0011800 Ga0373924_0011800_749_1285 150
16 3300035692 Ga0373935_0010129 Ga0373935_0010129_4999_5535 150
17 3300035692 Ga0373935_0937556 Ga0373935_0937556_24_560 150
18 3300035724 Ga0373933_0023497 Ga0373933_0023497_903_1439 150
19 3300035724 Ga0373933_0248342 Ga0373933_0248342_308_844 150
20 3300035725 Ga0373947_0188465 Ga0373947_0188465_44_580 150
21 3300046454 Ga0495592_0044598 Ga0495592_0044598_903_1439 150
22 3300046461 Ga0495641_0010332 Ga0495641_0010332_3215_3751 150
23 3300046475 Ga0495639_0030059 Ga0495639_0030059_69_605 150
24 3300046476 Ga0495662_0017552 Ga0495662_0017552_44_580 150
25 3300046499 Ga0495594_0304706 Ga0495594_0304706_155_691 150
26 3300046511 Ga0495608_0047424 Ga0495608_0047424_1768_2304 150
27 3300046511 Ga0495608_0150098 Ga0495608_0150098_241_777 150
28 3300046514 Ga0495618_0230766 Ga0495618_0230766_521_1057 150
29 3300046516 Ga0495628_0024530 Ga0495628_0024530_301_837 150
30 3300046517 Ga0495630_0055939 Ga0495630_0055939_1205_1741 150
31 3300046517 Ga0495630_0081150 Ga0495630_0081150_1747_2283 150
32 3300046535 Ga0495586_0176346 Ga0495586_0176346_575_1111 150
33 3300046535 Ga0495586_0203553 Ga0495586_0203553_542_1078 150
34 3300046536 Ga0495587_0058727 Ga0495587_0058727_1684_2220 150
35 3300046536 Ga0495587_0167599 Ga0495587_0167599_497_1033 150
36 3300046559 Ga0495667_0083269 Ga0495667_0083269_602_1138 150
37 3300046559 Ga0495667_0118538 Ga0495667_0118538_1009_1545 150
38 3300046559 Ga0495667_0736911 Ga0495667_0736911_16_552 150
39 3300046642 Ga0495634_0022467 Ga0495634_0022467_2162_2698 150
40 3300046642 Ga0495634_0068049 Ga0495634_0068049_1743_2279 150
41 3300046675 Ga0495657_0014522 Ga0495657_0014522_1653_2189 150
42 3300046678 Ga0495599_0022846 Ga0495599_0022846_249_785 150
43 3300046681 Ga0495647_0310225 Ga0495647_0310225_82_618 150
44 3300046683 Ga0495658_0036547 Ga0495658_0036547_874_1410 150
45 3300046689 Ga0495613_0024505 Ga0495613_0024505_1233_1769 150
46 3300046690 Ga0495624_0231645 Ga0495624_0231645_82_618 150
47 3300046809 Ga0495600_0009220 Ga0495600_0009220_2114_2650 150
48 3300047317 Ga0495604_0011098 Ga0495604_0011098_2042_2578 150
49 3300047319 Ga0495674_0080284 Ga0495674_0080284_1567_2103 150
50 3300047319 Ga0495674_0084033 Ga0495674_0084033_50_586 150
51 3300047322 Ga0495680_0101042 Ga0495680_0101042_732_1268 150
52 3300047471 Ga0495684_0025957 Ga0495684_0025957_2473_3009 150
53 3300047471 Ga0495684_0096567 Ga0495684_0096567_510_1046 150
54 3300047471 Ga0495684_0700763 Ga0495684_0700763_93_629 150
55 3300048089 Ga0495614_0164452 Ga0495614_0164452_184_720 150
56 3300053077 Ga0495601_0153551 Ga0495601_0153551_601_1137 150
57 3300053084 Ga0495595_0008449 Ga0495595_0008449_3293_3829 150
58 3300053085 Ga0495619_0034504 Ga0495619_0034504_912_1448 150
59 3300053085 Ga0495619_0108655 Ga0495619_0108655_166_702 150
60 3300005546 Ga0070696_100036360 Ga0070696_1000363604 151
61 3300006846 Ga0075430_100164839 Ga0075430_1001648392 151
62 3300035692 Ga0373935_0226679 Ga0373935_0226679_613_1149 151
63 3300042435 Ga0439434_0012556 Ga0439434_0012556_1012_1578 151
64 3300046528 Ga0495642_0239912 Ga0495642_0239912_35_574 151
65 3300049570 Ga0501033_0030094 Ga0501033_0030094_992_1450 151
66 3300049574 Ga0501038_0305991 Ga0501038_0305991_253_711 151
67 3300049575 Ga0501039_0318257 Ga0501039_0318257_117_575 151
68 3300049576 Ga0501040_0402107 Ga0501040_0402107_197_655 151
69 3300049577 Ga0501041_0463001 Ga0501041_0463001_78_536 151
70 3300049580 Ga0501046_0055514 Ga0501046_0055514_906_1364 151
71 3300049588 Ga0501072_0126733 Ga0501072_0126733_879_1337 151
72 3300049824 Ga0501045_0068835 Ga0501045_0068835_1460_1918 151
73 3300050510 nmdc:mga06r32_395194_c1 nmdc:mga06r32_395194_c1_86_625 151
74 3300050511 nmdc:mga08y16_429286_c1 nmdc:mga08y16_429286_c1_110_649 151
75 3300061734 Ga0530510_1022899 Ga0530510_1022899_54_512 151
76 3300005336 Ga0070680_101115375 Ga0070680_1011153752 153
77 3300025917 Ga0207660_10914922 Ga0207660_109149222 153
78 3300034957 Ga0373938_0040440 Ga0373938_0040440_70_537 153
79 3300046473 Ga0495582_0012388 Ga0495582_0012388_289_825 153
80 3300005545 Ga0070695_100465393 Ga0070695_1004653932 154
81 3300005546 Ga0070696_100039245 Ga0070696_1000392452 154
82 3300006844 Ga0075428_100097885 Ga0075428_1000978854 154
83 3300006846 Ga0075430_100023346 Ga0075430_1000233466 154
84 3300006846 Ga0075430_100058324 Ga0075430_1000583243 154
85 3300006847 Ga0075431_100101199 Ga0075431_1001011994 154
86 3300006871 Ga0075434_100047891 Ga0075434_1000478915 154
87 3300006880 Ga0075429_100052460 Ga0075429_1000524603 154
88 3300009147 Ga0114129_10210929 Ga0114129_102109292 154
89 3300026116 Ga0207674_10481037 Ga0207674_104810372 154
90 3300027360 Ga0209969_1021320 Ga0209969_10213202 154
91 3300027378 Ga0209981_1012236 Ga0209981_10122362 154
92 3300027526 Ga0209968_1014172 Ga0209968_10141722 154
93 3300032002 Ga0307416_100450787 Ga0307416_1004507872 154
94 3300035241 Ga0373961_0053627 Ga0373961_0053627_557_1036 154
95 3300042001 Ga0439441_028188 Ga0439441_028188_413_895 154
96 3300042436 Ga0439435_0009299 Ga0439435_0009299_1448_1984 154
97 3300042436 Ga0439435_0072329 Ga0439435_0072329_212_694 154
98 3300042437 Ga0439444_0018510 Ga0439444_0018510_61_597 154
99 3300042437 Ga0439444_0020499 Ga0439444_0020499_283_765 154
100 3300042461 Ga0439460_0002845 Ga0439460_0002845_1736_2218 154
101 3300042532 Ga0450893_0010142 Ga0450893_0010142_138_620 154
102 3300046689 Ga0495613_0031717 Ga0495613_0031717_1768_2238 154
103 3300049576 Ga0501040_0156972 Ga0501040_0156972_523_1005 154
104 3300049577 Ga0501041_0330409 Ga0501041_0330409_359_853 154
105 3300050508 nmdc:mga09592_140748_c1 nmdc:mga09592_140748_c1_487_1023 154
106 3300050509 nmdc:mga0qj67_27222_c1 nmdc:mga0qj67_27222_c1_3115_3597 154
107 3300050509 nmdc:mga0qj67_507182_c1 nmdc:mga0qj67_507182_c1_410_946 154
108 3300050510 nmdc:mga06r32_173746_c1 nmdc:mga06r32_173746_c1_1522_2058 154
109 3300050512 nmdc:mga0n895_423934_c1 nmdc:mga0n895_423934_c1_354_824 154
110 3300050512 nmdc:mga0n895_86_c1 nmdc:mga0n895_86_c1_28062_28529 154
111 3300050513 nmdc:mga0rr50_664_c1 nmdc:mga0rr50_664_c1_15498_15965 154
112 3300050514 nmdc:mga08x19_557910_c1 nmdc:mga08x19_557910_c1_332_799 154
113 3300061734 Ga0530510_0220211 Ga0530510_0220211_193_675 154
114 3300005329 Ga0070683_100103896 Ga0070683_1001038962 155
115 3300005336 Ga0070680_100118801 Ga0070680_1001188012 155
116 3300005336 Ga0070680_100132431 Ga0070680_1001324312 155
117 3300005340 Ga0070689_100097747 Ga0070689_1000977473 155
118 3300005340 Ga0070689_100701409 Ga0070689_1007014091 155
119 3300005343 Ga0070687_100232332 Ga0070687_1002323322 155
120 3300005365 Ga0070688_101090354 Ga0070688_1010903541 155
121 3300005366 Ga0070659_101147652 Ga0070659_1011476521 155
122 3300005436 Ga0070713_100195808 Ga0070713_1001958082 155
123 3300005439 Ga0070711_100422986 Ga0070711_1004229861 155
124 3300005441 Ga0070700_101036391 Ga0070700_1010363911 155
125 3300005444 Ga0070694_100102411 Ga0070694_1001024112 155
126 3300005444 Ga0070694_100240387 Ga0070694_1002403872 155
127 3300005458 Ga0070681_10035955 Ga0070681_100359554 155
128 3300005459 Ga0068867_101254362 Ga0068867_1012543622 155
129 3300005518 Ga0070699_100234972 Ga0070699_1002349723 155
130 3300005530 Ga0070679_100112749 Ga0070679_1001127492 155
131 3300005530 Ga0070679_100256385 Ga0070679_1002563852 155
132 3300005535 Ga0070684_100212309 Ga0070684_1002123092 155
133 3300005544 Ga0070686_100429094 Ga0070686_1004290941 155
134 3300005544 Ga0070686_100434628 Ga0070686_1004346282 155
135 3300005544 Ga0070686_101194839 Ga0070686_1011948391 155
136 3300005546 Ga0070696_100461964 Ga0070696_1004619641 155
137 3300005549 Ga0070704_100622522 Ga0070704_1006225221 155
138 3300005618 Ga0068864_100319590 Ga0068864_1003195902 155
139 3300006237 Ga0097621_100016034 Ga0097621_1000160344 155
140 3300006358 Ga0068871_100012220 Ga0068871_1000122205 155
141 3300006844 Ga0075428_100253105 Ga0075428_1002531052 155
142 3300006844 Ga0075428_100530864 Ga0075428_1005308642 155
143 3300006871 Ga0075434_102044309 Ga0075434_1020443091 155
144 3300006914 Ga0075436_100127289 Ga0075436_1001272892 155
145 3300009094 Ga0111539_10226278 Ga0111539_102262783 155
146 3300009094 Ga0111539_11293948 Ga0111539_112939482 155
147 3300009147 Ga0114129_10298916 Ga0114129_102989161 155
148 3300009147 Ga0114129_10710863 Ga0114129_107108632 155
149 3300009147 Ga0114129_10897341 Ga0114129_108973412 155
150 3300009176 Ga0105242_10258541 Ga0105242_102585412 155
151 3300013297 Ga0157378_10686009 Ga0157378_106860092 155
152 3300014326 Ga0157380_10106095 Ga0157380_101060954 155
153 3300014968 Ga0157379_10978035 Ga0157379_109780352 155
154 3300014969 Ga0157376_10022959 Ga0157376_100229592 155
155 3300025912 Ga0207707_10028946 Ga0207707_100289463 155
156 3300025912 Ga0207707_10476037 Ga0207707_104760372 155
157 3300025917 Ga0207660_10047673 Ga0207660_100476733 155
158 3300025917 Ga0207660_10155707 Ga0207660_101557072 155
159 3300025918 Ga0207662_10039730 Ga0207662_100397302 155
160 3300025921 Ga0207652_10088081 Ga0207652_100880812 155
161 3300025934 Ga0207686_11024912 Ga0207686_110249122 155
162 3300025936 Ga0207670_10594479 Ga0207670_105944792 155
163 3300025942 Ga0207689_10229664 Ga0207689_102296643 155
164 3300025944 Ga0207661_10010666 Ga0207661_100106668 155
165 3300026075 Ga0207708_10076932 Ga0207708_100769322 155
166 3300026089 Ga0207648_10280594 Ga0207648_102805942 155
167 3300027907 Ga0207428_10225761 Ga0207428_102257612 155
168 3300031548 Ga0307408_100009977 Ga0307408_1000099774 155
169 3300031911 Ga0307412_10623669 Ga0307412_106236691 155
170 3300032002 Ga0307416_100014510 Ga0307416_1000145103 155
171 3300032002 Ga0307416_100146913 Ga0307416_1001469132 155
172 3300032005 Ga0307411_10079222 Ga0307411_100792221 155
173 3300035085 Ga0373929_0029314 Ga0373929_0029314_490_963 155
174 3300035085 Ga0373929_0067608 Ga0373929_0067608_301_783 155
175 3300035092 Ga0373952_0052459 Ga0373952_0052459_361_843 155
176 3300035114 Ga0373939_0015372 Ga0373939_0015372_211_693 155
177 3300035115 Ga0373941_0034851 Ga0373941_0034851_372_854 155
178 3300035117 Ga0373953_0106868 Ga0373953_0106868_71_544 155
179 3300035121 Ga0373960_0129364 Ga0373960_0129364_233_706 155
180 3300035172 Ga0373955_0778866 Ga0373955_0778866_101_574 155
181 3300035207 Ga0373942_0192844 Ga0373942_0192844_40_513 155
182 3300035691 Ga0373931_0017425 Ga0373931_0017425_1449_1931 155
183 3300035691 Ga0373931_0099167 Ga0373931_0099167_49_522 155
184 3300036401 Ga0373937_0092999 Ga0373937_0092999_1320_1793 155
185 3300038996 Ga0242420_023185 Ga0242420_023185_173_697 155
186 3300041486 Ga0451807_1028620 Ga0451807_1028620_590_1063 155
187 3300041512 Ga0451853_4099157 Ga0451853_4099157_294_770 155
188 3300045051 Ga0451576_0177885 Ga0451576_0177885_35_508 155
189 3300046454 Ga0495592_0057151 Ga0495592_0057151_1127_1600 155
190 3300046459 Ga0495629_0476902 Ga0495629_0476902_328_801 155
191 3300046461 Ga0495641_0058502 Ga0495641_0058502_514_987 155
192 3300046462 Ga0495651_0376261 Ga0495651_0376261_84_557 155
193 3300046463 Ga0495653_0190250 Ga0495653_0190250_154_627 155
194 3300046476 Ga0495662_0005966 Ga0495662_0005966_4778_5251 155
195 3300046476 Ga0495662_0026785 Ga0495662_0026785_595_1068 155
196 3300046511 Ga0495608_0072742 Ga0495608_0072742_779_1252 155
197 3300046511 Ga0495608_0337276 Ga0495608_0337276_382_855 155
198 3300046514 Ga0495618_0033479 Ga0495618_0033479_1541_2014 155
199 3300046516 Ga0495628_0200299 Ga0495628_0200299_35_508 155
200 3300046517 Ga0495630_0032665 Ga0495630_0032665_2426_2899 155
201 3300046523 Ga0495644_0111494 Ga0495644_0111494_358_834 155
202 3300046525 Ga0495663_0159817 Ga0495663_0159817_74_553 155
203 3300046526 Ga0495666_0033095 Ga0495666_0033095_1044_1517 155
204 3300046533 Ga0495640_0018156 Ga0495640_0018156_2816_3289 155
205 3300046533 Ga0495640_0044954 Ga0495640_0044954_1317_1790 155
206 3300046535 Ga0495586_0008518 Ga0495586_0008518_4207_4680 155
207 3300046536 Ga0495587_0024137 Ga0495587_0024137_1641_2114 155
208 3300046537 Ga0495598_0054186 Ga0495598_0054186_192_689 155
209 3300046537 Ga0495598_0132401 Ga0495598_0132401_370_843 155
210 3300046543 Ga0495645_0078290 Ga0495645_0078290_1245_1718 155
211 3300046559 Ga0495667_0064884 Ga0495667_0064884_495_968 155
212 3300046642 Ga0495634_0012351 Ga0495634_0012351_1807_2280 155
213 3300046663 Ga0495635_0056142 Ga0495635_0056142_2194_2667 155
214 3300046663 Ga0495635_0182715 Ga0495635_0182715_659_1132 155
215 3300046664 Ga0495659_0196544 Ga0495659_0196544_165_662 155
216 3300046683 Ga0495658_0519895 Ga0495658_0519895_231_704 155
217 3300046809 Ga0495600_0036340 Ga0495600_0036340_1154_1627 155
218 3300047315 Ga0495581_0683956 Ga0495581_0683956_20_493 155
219 3300047317 Ga0495604_0015663 Ga0495604_0015663_2542_3015 155
220 3300047318 Ga0495636_0002166 Ga0495636_0002166_5722_6195 155
221 3300047322 Ga0495680_0032475 Ga0495680_0032475_725_1198 155
222 3300047322 Ga0495680_0170505 Ga0495680_0170505_845_1318 155
223 3300047471 Ga0495684_0320692 Ga0495684_0320692_463_936 155
224 3300049515 Ga0501292_119558 Ga0501292_119558_10_486 155
225 3300049575 Ga0501039_0762417 Ga0501039_0762417_174_644 155
226 3300049578 Ga0501042_0444357 Ga0501042_0444357_394_864 155
227 3300050507 nmdc:mga05p37_261434_c1 nmdc:mga05p37_261434_c1_309_785 155
228 3300050507 nmdc:mga05p37_358492_c1 nmdc:mga05p37_358492_c1_240_713 155
229 3300050509 nmdc:mga0qj67_385230_c1 nmdc:mga0qj67_385230_c1_44_517 155
230 3300050510 nmdc:mga06r32_1611305_c1 nmdc:mga06r32_1611305_c1_37_513 155
231 3300050511 nmdc:mga08y16_346845_c1 nmdc:mga08y16_346845_c1_696_1169 155
232 3300050512 nmdc:mga0n895_4702_c1 nmdc:mga0n895_4702_c1_5182_5661 155
233 3300050512 nmdc:mga0n895_772692_c1 nmdc:mga0n895_772692_c1_28_504 155
234 3300050513 nmdc:mga0rr50_390926_c1 nmdc:mga0rr50_390926_c1_70_564 155
235 3300050514 nmdc:mga08x19_20408_c1 nmdc:mga08x19_20408_c1_1448_1924 155
236 3300053077 Ga0495601_0029688 Ga0495601_0029688_1375_1848 155
237 3300053084 Ga0495595_0523631 Ga0495595_0523631_41_514 155
238 3300054114 Ga0501084_0544486 Ga0501084_0544486_152_658 155
239 3300005435 Ga0070714_100100787 Ga0070714_1001007872 156
240 3300005437 Ga0070710_10152865 Ga0070710_101528652 156
241 3300005444 Ga0070694_100754982 Ga0070694_1007549822 156
242 3300005444 Ga0070694_100915354 Ga0070694_1009153542 156
243 3300005458 Ga0070681_10229224 Ga0070681_102292242 156
244 3300005518 Ga0070699_101002427 Ga0070699_1010024271 156
245 3300005545 Ga0070695_100226764 Ga0070695_1002267642 156
246 3300005546 Ga0070696_100218371 Ga0070696_1002183712 156
247 3300005615 Ga0070702_100595670 Ga0070702_1005956702 156
248 3300005617 Ga0068859_100345673 Ga0068859_1003456733 156
249 3300005844 Ga0068862_100132940 Ga0068862_1001329405 156
250 3300005981 Ga0081538_10125963 Ga0081538_101259632 156
251 3300006173 Ga0070716_100059116 Ga0070716_1000591162 156
252 3300006237 Ga0097621_100167247 Ga0097621_1001672472 156
253 3300006844 Ga0075428_101074348 Ga0075428_1010743482 156
254 3300006846 Ga0075430_100004392 Ga0075430_1000043928 156
255 3300006846 Ga0075430_100147024 Ga0075430_1001470242 156
256 3300006847 Ga0075431_100014374 Ga0075431_1000143743 156
257 3300006852 Ga0075433_10071751 Ga0075433_100717513 156
258 3300006871 Ga0075434_100000006 Ga0075434_1000000069 156
259 3300006914 Ga0075436_100009225 Ga0075436_1000092252 156
260 3300006914 Ga0075436_100466701 Ga0075436_1004667012 156
261 3300006931 Ga0097620_100345671 Ga0097620_1003456712 156
262 3300007076 Ga0075435_100039691 Ga0075435_1000396915 156
263 3300007265 Ga0099794_10501479 Ga0099794_105014791 156
264 3300009092 Ga0105250_10375435 Ga0105250_103754352 156
265 3300009094 Ga0111539_10663354 Ga0111539_106633542 156
266 3300009098 Ga0105245_10048544 Ga0105245_100485442 156
267 3300009098 Ga0105245_10536166 Ga0105245_105361662 156
268 3300009098 Ga0105245_11794603 Ga0105245_117946032 156
269 3300009176 Ga0105242_10039137 Ga0105242_100391372 156
270 3300009176 Ga0105242_11735615 Ga0105242_117356151 156
271 3300013307 Ga0157372_11048349 Ga0157372_110483491 156
272 3300025898 Ga0207692_10117272 Ga0207692_101172722 156
273 3300025927 Ga0207687_10027525 Ga0207687_100275252 156
274 3300025929 Ga0207664_10036885 Ga0207664_100368852 156
275 3300025934 Ga0207686_10016405 Ga0207686_100164052 156
276 3300025939 Ga0207665_10081009 Ga0207665_100810093 156
277 3300025941 Ga0207711_11559720 Ga0207711_115597201 156
278 3300026089 Ga0207648_10098142 Ga0207648_100981423 156
279 3300026118 Ga0207675_100776432 Ga0207675_1007764322 156
280 3300027360 Ga0209969_1003506 Ga0209969_10035062 156
281 3300027364 Ga0209967_1000357 Ga0209967_10003578 156
282 3300027378 Ga0209981_1008074 Ga0209981_10080742 156
283 3300027462 Ga0210000_1000809 Ga0210000_10008095 156
284 3300027471 Ga0209995_1002187 Ga0209995_10021873 156
285 3300027526 Ga0209968_1028151 Ga0209968_10281511 156
286 3300027665 Ga0209983_1007574 Ga0209983_10075742 156
287 3300028380 Ga0268265_10127613 Ga0268265_101276135 156
288 3300035084 Ga0373928_0106030 Ga0373928_0106030_51_527 156
289 3300035086 Ga0373934_0059617 Ga0373934_0059617_621_1097 156
290 3300035117 Ga0373953_0029634 Ga0373953_0029634_392_868 156
291 3300035118 Ga0373954_0000020 Ga0373954_0000020_53642_54118 156
292 3300035120 Ga0373957_0103267 Ga0373957_0103267_334_810 156
293 3300035121 Ga0373960_0126494 Ga0373960_0126494_39_611 156
294 3300035172 Ga0373955_0045973 Ga0373955_0045973_869_1345 156
295 3300035241 Ga0373961_0110463 Ga0373961_0110463_319_858 156
296 3300035410 Ga0373924_0034126 Ga0373924_0034126_1007_1483 156
297 3300035692 Ga0373935_0007432 Ga0373935_0007432_715_1191 156
298 3300035695 Ga0373927_0342917 Ga0373927_0342917_274_750 156
299 3300035724 Ga0373933_0010314 Ga0373933_0010314_113_589 156
300 3300035724 Ga0373933_0089132 Ga0373933_0089132_534_1010 156
301 3300036401 Ga0373937_0005040 Ga0373937_0005040_6898_7374 156
302 3300036401 Ga0373937_0044614 Ga0373937_0044614_2002_2478 156
303 3300036401 Ga0373937_0047468 Ga0373937_0047468_96_572 156
304 3300036401 Ga0373937_0619215 Ga0373937_0619215_209_685 156
305 3300037068 Ga0373925_0284174 Ga0373925_0284174_477_953 156
306 3300041406 Ga0439439_0042570 Ga0439439_0042570_401_877 156
307 3300041410 Ga0439461_0002846 Ga0439461_0002846_929_1495 156
308 3300041413 Ga0439465_0151432 Ga0439465_0151432_123_659 156
309 3300042015 Ga0439462_0063660 Ga0439462_0063660_10_486 156
310 3300042156 Ga0439446_0027521 Ga0439446_0027521_629_1195 156
311 3300042436 Ga0439435_0026661 Ga0439435_0026661_44_610 156
312 3300042876 Ga0451577_0810099 Ga0451577_0810099_245_778 156
313 3300044706 Ga0466964_0040288 Ga0466964_0040288_32_562 156
314 3300044842 Ga0466957_0047747 Ga0466957_0047747_1281_1811 156
315 3300045976 Ga0466967_0164773 Ga0466967_0164773_1248_1778 156
316 3300046462 Ga0495651_0176623 Ga0495651_0176623_825_1301 156
317 3300046511 Ga0495608_0178831 Ga0495608_0178831_128_604 156
318 3300046516 Ga0495628_0355832 Ga0495628_0355832_477_953 156
319 3300046528 Ga0495642_0031610 Ga0495642_0031610_658_1179 156
320 3300046529 Ga0495652_0146302 Ga0495652_0146302_592_1068 156
321 3300046529 Ga0495652_0298567 Ga0495652_0298567_182_658 156
322 3300046664 Ga0495659_0125174 Ga0495659_0125174_269_790 156
323 3300046675 Ga0495657_0116727 Ga0495657_0116727_115_591 156
324 3300046675 Ga0495657_0180204 Ga0495657_0180204_619_1095 156
325 3300046680 Ga0495646_0156587 Ga0495646_0156587_686_1162 156
326 3300046684 Ga0495669_0033260 Ga0495669_0033260_579_1100 156
327 3300047322 Ga0495680_0056542 Ga0495680_0056542_1237_1713 156
328 3300049589 Ga0501073_0155271 Ga0501073_0155271_248_724 156
329 3300049589 Ga0501073_0284449 Ga0501073_0284449_42_518 156
330 3300049591 Ga0501075_0166662 Ga0501075_0166662_846_1352 156
331 3300049593 Ga0501077_0213297 Ga0501077_0213297_58_537 156
332 3300050509 nmdc:mga0qj67_137754_c1 nmdc:mga0qj67_137754_c1_967_1443 156
333 3300050509 nmdc:mga0qj67_2700_c1 nmdc:mga0qj67_2700_c1_8939_9415 156
334 3300050510 nmdc:mga06r32_16323_c1 nmdc:mga06r32_16323_c1_1572_2048 156
335 3300050514 nmdc:mga08x19_11713_c1 nmdc:mga08x19_11713_c1_276_809 156
336 3300050515 nmdc:mga0a205_31489_c1 nmdc:mga0a205_31489_c1_4284_4760 156
337 3300060353 Ga0501082_0744156 Ga0501082_0744156_268_744 156
338 3300005295 Ga0065707_10020436 Ga0065707_100204362 157
339 3300005295 Ga0065707_10104294 Ga0065707_101042943 157
340 3300005328 Ga0070676_10060495 Ga0070676_100604954 157
341 3300005329 Ga0070683_101282509 Ga0070683_1012825092 157
342 3300005330 Ga0070690_100000398 Ga0070690_1000003984 157
343 3300005330 Ga0070690_100138389 Ga0070690_1001383892 157
344 3300005334 Ga0068869_100001796 Ga0068869_1000017968 157
345 3300005334 Ga0068869_100034494 Ga0068869_1000344944 157
346 3300005336 Ga0070680_100001167 Ga0070680_10000116713 157
347 3300005336 Ga0070680_100098560 Ga0070680_1000985602 157
348 3300005337 Ga0070682_100001096 Ga0070682_1000010964 157
349 3300005338 Ga0068868_100005562 Ga0068868_1000055628 157
350 3300005340 Ga0070689_100000188 Ga0070689_10000018831 157
351 3300005340 Ga0070689_100024102 Ga0070689_1000241024 157
352 3300005340 Ga0070689_100109570 Ga0070689_1001095702 157
353 3300005341 Ga0070691_10022630 Ga0070691_100226304 157
354 3300005343 Ga0070687_100000069 Ga0070687_10000006925 157
355 3300005345 Ga0070692_10010076 Ga0070692_100100769 157
356 3300005347 Ga0070668_100022871 Ga0070668_1000228719 157
357 3300005353 Ga0070669_100013309 Ga0070669_1000133092 157
358 3300005353 Ga0070669_100364818 Ga0070669_1003648182 157
359 3300005354 Ga0070675_100230481 Ga0070675_1002304813 157
360 3300005355 Ga0070671_100579148 Ga0070671_1005791481 157
361 3300005364 Ga0070673_100269484 Ga0070673_1002694842 157
362 3300005364 Ga0070673_100461768 Ga0070673_1004617681 157
363 3300005365 Ga0070688_100146232 Ga0070688_1001462322 157
364 3300005365 Ga0070688_100214206 Ga0070688_1002142062 157
365 3300005367 Ga0070667_100761048 Ga0070667_1007610482 157
366 3300005406 Ga0070703_10083362 Ga0070703_100833622 157
367 3300005438 Ga0070701_10000603 Ga0070701_100006034 157
368 3300005440 Ga0070705_100001149 Ga0070705_1000011495 157
369 3300005440 Ga0070705_100010469 Ga0070705_1000104691 157
370 3300005440 Ga0070705_100024627 Ga0070705_1000246273 157
371 3300005440 Ga0070705_100168798 Ga0070705_1001687982 157
372 3300005441 Ga0070700_100008466 Ga0070700_1000084666 157
373 3300005441 Ga0070700_100023110 Ga0070700_1000231107 157
374 3300005444 Ga0070694_100001966 Ga0070694_1000019669 157
375 3300005444 Ga0070694_100038605 Ga0070694_1000386052 157
376 3300005444 Ga0070694_100154825 Ga0070694_1001548252 157
377 3300005444 Ga0070694_100319385 Ga0070694_1003193852 157
378 3300005444 Ga0070694_100519864 Ga0070694_1005198642 157
379 3300005445 Ga0070708_100623349 Ga0070708_1006233492 157
380 3300005458 Ga0070681_10120479 Ga0070681_101204793 157
381 3300005459 Ga0068867_100000296 Ga0068867_10000029617 157
382 3300005459 Ga0068867_100011080 Ga0068867_1000110807 157
383 3300005459 Ga0068867_100899274 Ga0068867_1008992741 157
384 3300005467 Ga0070706_100768166 Ga0070706_1007681662 157
385 3300005467 Ga0070706_101373514 Ga0070706_1013735141 157
386 3300005468 Ga0070707_100573127 Ga0070707_1005731272 157
387 3300005471 Ga0070698_100052274 Ga0070698_1000522742 157
388 3300005471 Ga0070698_100092149 Ga0070698_1000921494 157
389 3300005471 Ga0070698_100490415 Ga0070698_1004904152 157
390 3300005518 Ga0070699_100100337 Ga0070699_1001003372 157
391 3300005518 Ga0070699_100690030 Ga0070699_1006900302 157
392 3300005530 Ga0070679_100003737 Ga0070679_10000373716 157
393 3300005536 Ga0070697_100009252 Ga0070697_1000092529 157
394 3300005536 Ga0070697_100396270 Ga0070697_1003962702 157
395 3300005539 Ga0068853_100072412 Ga0068853_1000724122 157
396 3300005543 Ga0070672_101561865 Ga0070672_1015618651 157
397 3300005544 Ga0070686_100000090 Ga0070686_10000009042 157
398 3300005544 Ga0070686_100267793 Ga0070686_1002677932 157
399 3300005544 Ga0070686_100358380 Ga0070686_1003583802 157
400 3300005545 Ga0070695_100000188 Ga0070695_1000001888 157
401 3300005545 Ga0070695_100022517 Ga0070695_1000225175 157
402 3300005545 Ga0070695_100119152 Ga0070695_1001191522 157
403 3300005545 Ga0070695_100443880 Ga0070695_1004438801 157
404 3300005546 Ga0070696_100000719 Ga0070696_10000071912 157
405 3300005546 Ga0070696_100002632 Ga0070696_1000026329 157
406 3300005547 Ga0070693_100000525 Ga0070693_10000052513 157
407 3300005549 Ga0070704_100000168 Ga0070704_1000001689 157
408 3300005549 Ga0070704_100000545 Ga0070704_10000054518 157
409 3300005549 Ga0070704_100006984 Ga0070704_10000698410 157
410 3300005549 Ga0070704_100037205 Ga0070704_1000372052 157
411 3300005549 Ga0070704_100099034 Ga0070704_1000990342 157
412 3300005549 Ga0070704_100466991 Ga0070704_1004669912 157
413 3300005549 Ga0070704_101053583 Ga0070704_1010535832 157
414 3300005563 Ga0068855_100000833 Ga0068855_10000083328 157
415 3300005578 Ga0068854_100000657 Ga0068854_10000065710 157
416 3300005578 Ga0068854_100764757 Ga0068854_1007647572 157
417 3300005614 Ga0068856_100003103 Ga0068856_10000310312 157
418 3300005615 Ga0070702_100000002 Ga0070702_10000000217 157
419 3300005615 Ga0070702_100004543 Ga0070702_1000045432 157
420 3300005616 Ga0068852_100439119 Ga0068852_1004391192 157
421 3300005617 Ga0068859_100000195 Ga0068859_10000019513 157
422 3300005617 Ga0068859_100115984 Ga0068859_1001159843 157
423 3300005617 Ga0068859_100719125 Ga0068859_1007191251 157
424 3300005618 Ga0068864_100666633 Ga0068864_1006666332 157
425 3300005718 Ga0068866_10002071 Ga0068866_100020718 157
426 3300005718 Ga0068866_10089292 Ga0068866_100892923 157
427 3300005719 Ga0068861_100000043 Ga0068861_10000004353 157
428 3300005719 Ga0068861_100062821 Ga0068861_1000628212 157
429 3300005842 Ga0068858_100005138 Ga0068858_10000513813 157
430 3300005842 Ga0068858_100199292 Ga0068858_1001992922 157
431 3300005843 Ga0068860_100002559 Ga0068860_10000255911 157
432 3300005843 Ga0068860_100083022 Ga0068860_1000830222 157
433 3300005844 Ga0068862_100002188 Ga0068862_10000218815 157
434 3300005844 Ga0068862_100070855 Ga0068862_1000708552 157
435 3300005844 Ga0068862_101635017 Ga0068862_1016350172 157
436 3300006163 Ga0070715_10050628 Ga0070715_100506283 157
437 3300006173 Ga0070716_100007311 Ga0070716_1000073112 157
438 3300006237 Ga0097621_100000045 Ga0097621_10000004563 157
439 3300006237 Ga0097621_100350612 Ga0097621_1003506122 157
440 3300006358 Ga0068871_100000040 Ga0068871_10000004023 157
441 3300006844 Ga0075428_100000047 Ga0075428_10000004710 157
442 3300006844 Ga0075428_100043245 Ga0075428_1000432454 157
443 3300006844 Ga0075428_100050115 Ga0075428_1000501153 157
444 3300006846 Ga0075430_100018834 Ga0075430_1000188346 157
445 3300006847 Ga0075431_100120534 Ga0075431_1001205343 157
446 3300006847 Ga0075431_100237297 Ga0075431_1002372972 157
447 3300006852 Ga0075433_10000605 Ga0075433_100006054 157
448 3300006871 Ga0075434_100000554 Ga0075434_10000055424 157
449 3300006871 Ga0075434_101456026 Ga0075434_1014560262 157
450 3300006880 Ga0075429_100000008 Ga0075429_10000000814 157
451 3300006880 Ga0075429_100000067 Ga0075429_10000006730 157
452 3300006880 Ga0075429_100177709 Ga0075429_1001777092 157
453 3300006880 Ga0075429_100298831 Ga0075429_1002988313 157
454 3300006880 Ga0075429_101293697 Ga0075429_1012936971 157
455 3300006881 Ga0068865_100001956 Ga0068865_1000019568 157
456 3300006914 Ga0075436_100000174 Ga0075436_1000001742 157
457 3300006914 Ga0075436_100001082 Ga0075436_10000108217 157
458 3300006914 Ga0075436_100022044 Ga0075436_1000220445 157
459 3300006914 Ga0075436_100072304 Ga0075436_1000723043 157
460 3300006914 Ga0075436_100090296 Ga0075436_1000902962 157
461 3300006914 Ga0075436_100349398 Ga0075436_1003493982 157
462 3300006931 Ga0097620_100000195 Ga0097620_10000019554 157
463 3300006931 Ga0097620_100115982 Ga0097620_1001159823 157
464 3300006931 Ga0097620_100719110 Ga0097620_1007191103 157
465 3300007076 Ga0075435_100020896 Ga0075435_1000208962 157
466 3300007076 Ga0075435_100058248 Ga0075435_1000582483 157
467 3300007076 Ga0075435_100433430 Ga0075435_1004334302 157
468 3300009092 Ga0105250_10073498 Ga0105250_100734982 157
469 3300009094 Ga0111539_10219068 Ga0111539_102190683 157
470 3300009094 Ga0111539_11002257 Ga0111539_110022572 157
471 3300009094 Ga0111539_11198955 Ga0111539_111989552 157
472 3300009098 Ga0105245_10000306 Ga0105245_1000030648 157
473 3300009147 Ga0114129_10000040 Ga0114129_1000004054 157
474 3300009147 Ga0114129_10021807 Ga0114129_100218079 157
475 3300009147 Ga0114129_10981008 Ga0114129_109810082 157
476 3300009147 Ga0114129_12239374 Ga0114129_122393742 157
477 3300009148 Ga0105243_10000035 Ga0105243_10000035141 157
478 3300009148 Ga0105243_10002936 Ga0105243_1000293610 157
479 3300009174 Ga0105241_10070539 Ga0105241_100705394 157
480 3300009176 Ga0105242_10004996 Ga0105242_1000499610 157
481 3300009553 Ga0105249_10007943 Ga0105249_1000794310 157
482 3300009553 Ga0105249_10055112 Ga0105249_100551123 157
483 3300009553 Ga0105249_10189440 Ga0105249_101894404 157
484 3300010375 Ga0105239_10048386 Ga0105239_100483865 157
485 3300012510 Ga0157316_1019378 Ga0157316_10193781 157
486 3300013297 Ga0157378_10001996 Ga0157378_1000199615 157
487 3300013306 Ga0163162_10347688 Ga0163162_103476882 157
488 3300013307 Ga0157372_11047746 Ga0157372_110477462 157
489 3300013308 Ga0157375_10133322 Ga0157375_101333223 157
490 3300013308 Ga0157375_10546244 Ga0157375_105462442 157
491 3300014326 Ga0157380_10018970 Ga0157380_100189705 157
492 3300014326 Ga0157380_10154190 Ga0157380_101541902 157
493 3300014326 Ga0157380_11415728 Ga0157380_114157281 157
494 3300014745 Ga0157377_10049229 Ga0157377_100492292 157
495 3300014745 Ga0157377_10286936 Ga0157377_102869362 157
496 3300014969 Ga0157376_10000403 Ga0157376_1000040316 157
497 3300017792 Ga0163161_10225180 Ga0163161_102251803 157
498 3300025899 Ga0207642_10003118 Ga0207642_100031183 157
499 3300025899 Ga0207642_10052050 Ga0207642_100520504 157
500 3300025905 Ga0207685_10260991 Ga0207685_102609912 157
501 3300025907 Ga0207645_10414579 Ga0207645_104145792 157
502 3300025908 Ga0207643_10044298 Ga0207643_100442982 157
503 3300025908 Ga0207643_10084606 Ga0207643_100846062 157
504 3300025910 Ga0207684_10682965 Ga0207684_106829652 157
505 3300025911 Ga0207654_10034497 Ga0207654_100344972 157
506 3300025912 Ga0207707_10048467 Ga0207707_100484672 157
507 3300025915 Ga0207693_10462161 Ga0207693_104621612 157
508 3300025916 Ga0207663_10133508 Ga0207663_101335082 157
509 3300025917 Ga0207660_10006506 Ga0207660_100065067 157
510 3300025917 Ga0207660_10088771 Ga0207660_100887713 157
511 3300025918 Ga0207662_10000006 Ga0207662_1000000693 157
512 3300025922 Ga0207646_10280400 Ga0207646_102804002 157
513 3300025923 Ga0207681_10025231 Ga0207681_100252316 157
514 3300025927 Ga0207687_10003249 Ga0207687_100032497 157
515 3300025931 Ga0207644_10540261 Ga0207644_105402611 157
516 3300025934 Ga0207686_10003499 Ga0207686_100034998 157
517 3300025935 Ga0207709_10007469 Ga0207709_100074697 157
518 3300025935 Ga0207709_10015032 Ga0207709_100150324 157
519 3300025936 Ga0207670_10001617 Ga0207670_100016178 157
520 3300025936 Ga0207670_10020433 Ga0207670_100204334 157
521 3300025936 Ga0207670_10117777 Ga0207670_101177772 157
522 3300025937 Ga0207669_10021023 Ga0207669_100210232 157
523 3300025939 Ga0207665_10007350 Ga0207665_100073506 157
524 3300025939 Ga0207665_10663647 Ga0207665_106636471 157
525 3300025941 Ga0207711_10530941 Ga0207711_105309412 157
526 3300025942 Ga0207689_10000082 Ga0207689_1000008213 157
527 3300025942 Ga0207689_10010692 Ga0207689_100106928 157
528 3300025942 Ga0207689_10097302 Ga0207689_100973023 157
529 3300025949 Ga0207667_10012981 Ga0207667_1001298110 157
530 3300025960 Ga0207651_10048965 Ga0207651_100489654 157
531 3300025961 Ga0207712_10033486 Ga0207712_100334862 157
532 3300025961 Ga0207712_10096830 Ga0207712_100968302 157
533 3300025981 Ga0207640_10001404 Ga0207640_100014044 157
534 3300026023 Ga0207677_10005887 Ga0207677_100058872 157
535 3300026035 Ga0207703_10017112 Ga0207703_100171123 157
536 3300026035 Ga0207703_11678154 Ga0207703_116781541 157
537 3300026041 Ga0207639_10203879 Ga0207639_102038792 157
538 3300026075 Ga0207708_10000936 Ga0207708_1000093614 157
539 3300026075 Ga0207708_10005903 Ga0207708_1000590312 157
540 3300026078 Ga0207702_10014977 Ga0207702_100149773 157
541 3300026089 Ga0207648_10000316 Ga0207648_100003168 157
542 3300026089 Ga0207648_10012170 Ga0207648_1001217012 157
543 3300026089 Ga0207648_10414948 Ga0207648_104149482 157
544 3300026095 Ga0207676_10036639 Ga0207676_100366392 157
545 3300026095 Ga0207676_11050539 Ga0207676_110505391 157
546 3300026118 Ga0207675_100000064 Ga0207675_10000006472 157
547 3300026118 Ga0207675_100020995 Ga0207675_1000209952 157
548 3300027360 Ga0209969_1019015 Ga0209969_10190152 157
549 3300027462 Ga0210000_1010309 Ga0210000_10103092 157
550 3300027462 Ga0210000_1015146 Ga0210000_10151462 157
551 3300027526 Ga0209968_1009734 Ga0209968_10097341 157
552 3300027671 Ga0209588_1019685 Ga0209588_10196853 157
553 3300027671 Ga0209588_1173135 Ga0209588_11731352 157
554 3300027695 Ga0209966_1046734 Ga0209966_10467342 157
555 3300027695 Ga0209966_1100938 Ga0209966_11009381 157
556 3300027717 Ga0209998_10004757 Ga0209998_100047573 157
557 3300027907 Ga0207428_10006021 Ga0207428_100060212 157
558 3300027907 Ga0207428_10323740 Ga0207428_103237402 157
559 3300027907 Ga0207428_11007083 Ga0207428_110070832 157
560 3300028380 Ga0268265_10006971 Ga0268265_100069713 157
561 3300028380 Ga0268265_10014708 Ga0268265_100147087 157
562 3300028381 Ga0268264_10001394 Ga0268264_100013945 157
563 3300028381 Ga0268264_10112410 Ga0268264_101124102 157
564 3300031548 Ga0307408_100197104 Ga0307408_1001971041 157
565 3300031548 Ga0307408_100899559 Ga0307408_1008995591 157
566 3300031548 Ga0307408_101239381 Ga0307408_1012393812 157
567 3300031548 Ga0307408_101396030 Ga0307408_1013960301 157
568 3300032002 Ga0307416_100701589 Ga0307416_1007015893 157
569 3300032005 Ga0307411_10277041 Ga0307411_102770413 157
570 3300032005 Ga0307411_10531564 Ga0307411_105315642 157
571 3300034817 Ga0373948_0018888 Ga0373948_0018888_340_813 157
572 3300034820 Ga0373959_0011584 Ga0373959_0011584_13_486 157
573 3300034957 Ga0373938_0134466 Ga0373938_0134466_113_586 157
574 3300035083 Ga0373926_0001625 Ga0373926_0001625_5644_6120 157
575 3300035084 Ga0373928_0048764 Ga0373928_0048764_298_771 157
576 3300035086 Ga0373934_0000505 Ga0373934_0000505_11798_12361 157
577 3300035088 Ga0373940_0001144 Ga0373940_0001144_2293_2766 157
578 3300035089 Ga0373944_0001341 Ga0373944_0001341_4188_4664 157
579 3300035090 Ga0373949_0047640 Ga0373949_0047640_308_781 157
580 3300035091 Ga0373951_0009424 Ga0373951_0009424_231_704 157
581 3300035111 Ga0373923_0359759 Ga0373923_0359759_38_598 157
582 3300035113 Ga0373936_0063265 Ga0373936_0063265_1021_1494 157
583 3300035114 Ga0373939_0004598 Ga0373939_0004598_2244_2717 157
584 3300035114 Ga0373939_0004651 Ga0373939_0004651_2389_2862 157
585 3300035116 Ga0373945_0009215 Ga0373945_0009215_1261_1737 157
586 3300035118 Ga0373954_0000592 Ga0373954_0000592_3025_3585 157
587 3300035118 Ga0373954_0152396 Ga0373954_0152396_37_600 157
588 3300035119 Ga0373956_0000714 Ga0373956_0000714_1493_2056 157
589 3300035121 Ga0373960_0096245 Ga0373960_0096245_332_805 157
590 3300035121 Ga0373960_0096662 Ga0373960_0096662_85_642 157
591 3300035171 Ga0373946_0005400 Ga0373946_0005400_1348_1824 157
592 3300035172 Ga0373955_0020377 Ga0373955_0020377_208_771 157
593 3300035207 Ga0373942_0019335 Ga0373942_0019335_790_1263 157
594 3300035207 Ga0373942_0104127 Ga0373942_0104127_297_839 157
595 3300035241 Ga0373961_0013206 Ga0373961_0013206_495_968 157
596 3300035242 Ga0373962_0023028 Ga0373962_0023028_363_836 157
597 3300035691 Ga0373931_0003341 Ga0373931_0003341_2110_2583 157
598 3300035691 Ga0373931_0069470 Ga0373931_0069470_734_1207 157
599 3300035691 Ga0373931_0145086 Ga0373931_0145086_697_1173 157
600 3300035691 Ga0373931_0430763 Ga0373931_0430763_60_617 157
601 3300035692 Ga0373935_0164435 Ga0373935_0164435_192_668 157
602 3300035695 Ga0373927_0028362 Ga0373927_0028362_1925_2401 157
603 3300035724 Ga0373933_0001085 Ga0373933_0001085_1444_2007 157
604 3300035725 Ga0373947_0303141 Ga0373947_0303141_569_1045 157
605 3300036401 Ga0373937_0011050 Ga0373937_0011050_7329_7892 157
606 3300042001 Ga0439441_016881 Ga0439441_016881_292_777 157
607 3300042435 Ga0439434_0029512 Ga0439434_0029512_482_967 157
608 3300042436 Ga0439435_0109451 Ga0439435_0109451_83_622 157
609 3300042876 Ga0451577_1191818 Ga0451577_1191818_179_652 157
610 3300044712 Ga0453684_0364527 Ga0453684_0364527_1028_1501 157
611 3300044901 Ga0466960_0074678 Ga0466960_0074678_84_644 157
612 3300045051 Ga0451576_0000822 Ga0451576_0000822_29331_29804 157
613 3300045051 Ga0451576_0022841 Ga0451576_0022841_2188_2661 157
614 3300045051 Ga0451576_0029853 Ga0451576_0029853_2713_3186 157
615 3300045051 Ga0451576_0098737 Ga0451576_0098737_367_852 157
616 3300045051 Ga0451576_0520242 Ga0451576_0520242_650_1126 157
617 3300046454 Ga0495592_0000293 Ga0495592_0000293_27297_27833 157
618 3300046454 Ga0495592_0136588 Ga0495592_0136588_1028_1588 157
619 3300046455 Ga0495603_0046469 Ga0495603_0046469_1873_2349 157
620 3300046462 Ga0495651_0011710 Ga0495651_0011710_141_686 157
621 3300046472 Ga0495580_0087444 Ga0495580_0087444_1509_1985 157
622 3300046475 Ga0495639_0005058 Ga0495639_0005058_3990_4466 157
623 3300046516 Ga0495628_0017983 Ga0495628_0017983_2696_3232 157
624 3300046516 Ga0495628_0080332 Ga0495628_0080332_754_1314 157
625 3300046516 Ga0495628_0251110 Ga0495628_0251110_513_1049 157
626 3300046526 Ga0495666_0176120 Ga0495666_0176120_390_866 157
627 3300046529 Ga0495652_0086237 Ga0495652_0086237_1947_2483 157
628 3300046531 Ga0495665_0085235 Ga0495665_0085235_148_624 157
629 3300046533 Ga0495640_0242237 Ga0495640_0242237_553_1089 157
630 3300046538 Ga0495609_0108116 Ga0495609_0108116_648_1187 157
631 3300046539 Ga0495621_0060974 Ga0495621_0060974_753_1292 157
632 3300046539 Ga0495621_0074683 Ga0495621_0074683_260_745 157
633 3300046543 Ga0495645_0000344 Ga0495645_0000344_30776_31312 157
634 3300046559 Ga0495667_0018506 Ga0495667_0018506_3879_4439 157
635 3300046674 Ga0495588_0060033 Ga0495588_0060033_1037_1513 157
636 3300046675 Ga0495657_0159295 Ga0495657_0159295_55_618 157
637 3300046678 Ga0495599_0000231 Ga0495599_0000231_30760_31296 157
638 3300046681 Ga0495647_0004648 Ga0495647_0004648_2747_3223 157
639 3300046683 Ga0495658_0015526 Ga0495658_0015526_406_882 157
640 3300047315 Ga0495581_0123335 Ga0495581_0123335_50_526 157
641 3300047321 Ga0495676_0211726 Ga0495676_0211726_639_1115 157
642 3300047322 Ga0495680_0079301 Ga0495680_0079301_1543_2103 157
643 3300047471 Ga0495684_0319093 Ga0495684_0319093_472_1032 157
644 3300049521 Ga0501298_073631 Ga0501298_073631_138_677 157
645 3300049572 Ga0501036_0401188 Ga0501036_0401188_164_646 157
646 3300049573 Ga0501037_0253477 Ga0501037_0253477_254_820 157
647 3300049573 Ga0501037_0480080 Ga0501037_0480080_66_548 157
648 3300049574 Ga0501038_0050494 Ga0501038_0050494_284_850 157
649 3300049575 Ga0501039_0078134 Ga0501039_0078134_568_1134 157
650 3300049575 Ga0501039_0378992 Ga0501039_0378992_117_599 157
651 3300049576 Ga0501040_0034358 Ga0501040_0034358_208_681 157
652 3300049576 Ga0501040_0454069 Ga0501040_0454069_16_582 157
653 3300049577 Ga0501041_0137227 Ga0501041_0137227_254_727 157
654 3300049577 Ga0501041_0285010 Ga0501041_0285010_481_963 157
655 3300049578 Ga0501042_0035847 Ga0501042_0035847_1245_1811 157
656 3300049578 Ga0501042_0309100 Ga0501042_0309100_624_1097 157
657 3300049579 Ga0501043_0812048 Ga0501043_0812048_45_590 157
658 3300049580 Ga0501046_0028053 Ga0501046_0028053_3976_4542 157
659 3300049580 Ga0501046_0541311 Ga0501046_0541311_157_633 157
660 3300049582 Ga0501048_0083168 Ga0501048_0083168_585_1151 157
661 3300049582 Ga0501048_0189561 Ga0501048_0189561_660_1133 157
662 3300049582 Ga0501048_0662988 Ga0501048_0662988_217_699 157
663 3300049584 Ga0501068_0032306 Ga0501068_0032306_165_647 157
664 3300049587 Ga0501071_0000879 Ga0501071_0000879_2164_2646 157
665 3300049587 Ga0501071_0071317 Ga0501071_0071317_1010_1483 157
666 3300049587 Ga0501071_0469648 Ga0501071_0469648_75_710 157
667 3300049588 Ga0501072_0003042 Ga0501072_0003042_9697_10263 157
668 3300049588 Ga0501072_0076283 Ga0501072_0076283_372_938 157
669 3300049588 Ga0501072_0077852 Ga0501072_0077852_1260_1742 157
670 3300049588 Ga0501072_0081610 Ga0501072_0081610_1767_2240 157
671 3300049590 Ga0501074_0211108 Ga0501074_0211108_437_1003 157
672 3300049591 Ga0501075_0044465 Ga0501075_0044465_867_1433 157
673 3300049591 Ga0501075_0181147 Ga0501075_0181147_750_1232 157
674 3300049592 Ga0501076_0001168 Ga0501076_0001168_7960_8526 157
675 3300049669 Ga0501235_044322 Ga0501235_044322_91_630 157
676 3300049679 Ga0501249_034262 Ga0501249_034262_330_869 157
677 3300049741 Ga0501079_0002730 Ga0501079_0002730_3477_4043 157
678 3300049741 Ga0501079_0041684 Ga0501079_0041684_2172_2645 157
679 3300049741 Ga0501079_0358803 Ga0501079_0358803_59_541 157
680 3300049742 Ga0501080_0058100 Ga0501080_0058100_248_814 157
681 3300049743 Ga0501081_0013737 Ga0501081_0013737_1851_2417 157
682 3300049770 Ga0501273_014629 Ga0501273_014629_24_581 157
683 3300049822 Ga0501035_0047672 Ga0501035_0047672_2923_3432 157
684 3300049822 Ga0501035_0432495 Ga0501035_0432495_399_872 157
685 3300049824 Ga0501045_0082061 Ga0501045_0082061_523_1089 157
686 3300050507 nmdc:mga05p37_109_c1 nmdc:mga05p37_109_c1_5471_5956 157
687 3300050507 nmdc:mga05p37_604246_c1 nmdc:mga05p37_604246_c1_267_776 157
688 3300050507 nmdc:mga05p37_886_c1 nmdc:mga05p37_886_c1_27478_27951 157
689 3300050508 nmdc:mga09592_202854_c1 nmdc:mga09592_202854_c1_1001_1537 157
690 3300050508 nmdc:mga09592_2901_c1 nmdc:mga09592_2901_c1_12035_12520 157
691 3300050508 nmdc:mga09592_6868_c1 nmdc:mga09592_6868_c1_2735_3208 157
692 3300050509 nmdc:mga0qj67_1170396_c1 nmdc:mga0qj67_1170396_c1_10_549 157
693 3300050509 nmdc:mga0qj67_41917_c1 nmdc:mga0qj67_41917_c1_2926_3465 157
694 3300050509 nmdc:mga0qj67_422082_c1 nmdc:mga0qj67_422082_c1_329_802 157
695 3300050509 nmdc:mga0qj67_662400_c1 nmdc:mga0qj67_662400_c1_116_592 157
696 3300050509 nmdc:mga0qj67_6924_c1 nmdc:mga0qj67_6924_c1_6059_6595 157
697 3300050510 nmdc:mga06r32_287585_c1 nmdc:mga06r32_287585_c1_520_1005 157
698 3300050510 nmdc:mga06r32_309216_c1 nmdc:mga06r32_309216_c1_268_804 157
699 3300050510 nmdc:mga06r32_383217_c1 nmdc:mga06r32_383217_c1_511_1050 157
700 3300050511 nmdc:mga08y16_152610_c1 nmdc:mga08y16_152610_c1_161_646 157
701 3300050511 nmdc:mga08y16_189087_c1 nmdc:mga08y16_189087_c1_185_658 157
702 3300050511 nmdc:mga08y16_90814_c1 nmdc:mga08y16_90814_c1_1248_1721 157
703 3300050512 nmdc:mga0n895_677390_c1 nmdc:mga0n895_677390_c1_92_655 157
704 3300050512 nmdc:mga0n895_8407_c1 nmdc:mga0n895_8407_c1_5972_6445 157
705 3300050513 nmdc:mga0rr50_241822_c1 nmdc:mga0rr50_241822_c1_327_812 157
706 3300050513 nmdc:mga0rr50_3195_c1 nmdc:mga0rr50_3195_c1_1494_1967 157
707 3300050514 nmdc:mga08x19_4656_c1 nmdc:mga08x19_4656_c1_6397_6870 157
708 3300050514 nmdc:mga08x19_6463_c1 nmdc:mga08x19_6463_c1_4661_5173 157
709 3300050514 nmdc:mga08x19_70089_c1 nmdc:mga08x19_70089_c1_858_1421 157
710 3300050514 nmdc:mga08x19_758067_c1 nmdc:mga08x19_758067_c1_147_656 157
711 3300050515 nmdc:mga0a205_281873_c1 nmdc:mga0a205_281873_c1_807_1280 157
712 3300050515 nmdc:mga0a205_385096_c1 nmdc:mga0a205_385096_c1_742_1236 157
713 3300050515 nmdc:mga0a205_505_c1 nmdc:mga0a205_505_c1_1270_1743 157
714 3300053077 Ga0495601_0000862 Ga0495601_0000862_14085_14621 157
715 3300053077 Ga0495601_0018854 Ga0495601_0018854_198_734 157
716 3300053077 Ga0495601_0254334 Ga0495601_0254334_225_785 157
717 3300054114 Ga0501084_0047735 Ga0501084_0047735_2933_3406 157
718 3300054114 Ga0501084_0096251 Ga0501084_0096251_857_1423 157
719 3300059424 Ga0590075_057417 Ga0590075_057417_219_698 157
720 3300060353 Ga0501082_0237309 Ga0501082_0237309_1057_1539 157
721 3300061734 Ga0530510_0001231 Ga0530510_0001231_9496_10062 157
722 3300061734 Ga0530510_0215943 Ga0530510_0215943_410_883 157

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00866

Ring_hydroxyl_B

Ring hydroxylating beta subunit

46

180

0.97

PF13577

SnoaL_4

SnoaL-like domain

33

172

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
8h2t-assembly1.cif.gz_H cryo-em structure of iadd/e dioxygenase bound with iaa 0.9107 5 147
3e99-assembly1.cif.gz_A crystal structure of the beta subunit of the benzoate 1,2-dioxygenase (benb, bmaa0186) from burkholderia mallei atcc 23344 at 1.90 a resolution 0.8781 7 144
3ef8-assembly1.cif.gz_A crystal structure of putative scytalone dehydratase (yp_496742.1) from novosphingobium aromaticivorans dsm 12444 at 1.50 a resolution 0.8726 5 143
1wql-assembly1.cif.gz_B cumene dioxygenase (cuma1a2) from pseudomonas fluorescens ip01 0.8619 1 154
2chc-assembly1.cif.gz_A structure of rv3472(d26n), a function unknown protein from mycobacterium tuberculosis 0.858 6 143
ID Description Score Start End Superfamily
3e99A00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.87 7 144 3.10.450.50
af_Q47140_1_172_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8658 1 147 3.10.450.50
af_P71754_77_184_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8611 80 138 3.10.450.50
3ef8B00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8485 3 143 3.10.450.50
2b1xB00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8456 5 146 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A537C0D0-F1-model_v4 Aromatic-ring-hydroxylating dioxygenase subunit beta 0.9549 1 132 GO:0019380
GO:0051213
AF-A0A243SX33-F1-model_v4 deleted 0.9521 82 147
AF-A0A536XR34-F1-model_v4 Aromatic-ring-hydroxylating dioxygenase subunit beta 0.9496 2 140 GO:0019380
GO:0051213
AF-A0A537C0D0-F1-model_v4 Aromatic-ring-hydroxylating dioxygenase subunit beta 0.9411 1 132 GO:0019380
GO:0051213
AF-N9SU72-F1-model_v4 deleted 0.939 1 144

Feature Viewer

pLDDT pTM Quality
83.73 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map