F477409
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 722 | 301 | 722 | 163 |
Family's Representative Sequence
| Representative Sequence | 3300005546|Ga0070696_100218371|Ga0070696_1002183712 |
| Length | 190 |
| Sequence | VAKLKLKKALKKLVRKAVPSKKAVVRKANGAGHHETQHAVEQFLFRQAELLDAKQWQDYIDLFTPEGVYWMPPEPSHTHWDGMPAIFAEDKNLMTVRMKRILHPDAWSQRPLWETNHVVSNIIVEKETADEVQVRSRFHMLELRRDDVRHFAGAYRHTLTRTPEGFRIKLQRVDMTNAQAAYDYVIQAWV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 33 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 52 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 53 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 54 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 55 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 56 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 57 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 58 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 59 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 60 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 61 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 65 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 66 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 67 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 68 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 69 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 70 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 71 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 72 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 73 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 75 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 76 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 86 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 145 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 148 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 149 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 150 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 151 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 152 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 153 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 154 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 155 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 156 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 157 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 158 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 159 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 160 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 161 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 162 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 163 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 164 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 165 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 166 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 167 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 168 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 169 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 170 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 171 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 172 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 173 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 174 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 175 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 176 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 177 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 178 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 179 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 180 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 181 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 182 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 183 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 184 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 185 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 186 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 187 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 188 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 189 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 190 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 191 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 192 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 193 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 194 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 195 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 196 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 197 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 198 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 199 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 200 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 201 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 202 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 203 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 204 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 205 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 206 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 207 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 258 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 259 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 279 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 280 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 284 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 300 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0.14 |
| Rhizosphere | 99.72 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.14 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065707_10020436 | 3300005295 | Bacteria | 1752 |
| 2 | Ga0065707_10104294 | 3300005295 | Bacteria | 2703 |
| 3 | Ga0070676_10060495 | 3300005328 | Bacteria | 2249 |
| 4 | Ga0070683_100103896 | 3300005329 | Bacteria | 2678 |
| 5 | Ga0070683_101282509 | 3300005329 | Bacteria | 704 |
| 6 | Ga0070690_100000398 | 3300005330 | Bacteria | 21982 |
| 7 | Ga0070690_100138389 | 3300005330 | Unclassified | 1651 |
| 8 | Ga0068869_100001796 | 3300005334 | Bacteria | 12871 |
| 9 | Ga0068869_100034494 | 3300005334 | Unclassified | 3580 |
| 10 | Ga0070680_100001167 | 3300005336 | Bacteria | 18875 |
| 11 | Ga0070680_100098560 | 3300005336 | Bacteria | 2424 |
| 12 | Ga0070680_100118801 | 3300005336 | Bacteria | 2205 |
| 13 | Ga0070680_100132431 | 3300005336 | Bacteria | 2087 |
| 14 | Ga0070680_101115375 | 3300005336 | Bacteria | 682 |
| 15 | Ga0070682_100001096 | 3300005337 | Bacteria | 15544 |
| 16 | Ga0068868_100005562 | 3300005338 | Bacteria | 8862 |
| 17 | Ga0070689_100000188 | 3300005340 | Bacteria | 37400 |
| 18 | Ga0070689_100024102 | 3300005340 | Unclassified | 4563 |
| 19 | Ga0070689_100097747 | 3300005340 | Bacteria | 2322 |
| 20 | Ga0070689_100109570 | 3300005340 | Bacteria | 2194 |
| 21 | Ga0070689_100701409 | 3300005340 | Bacteria | 884 |
| 22 | Ga0070691_10022630 | 3300005341 | Unclassified | 2917 |
| 23 | Ga0070687_100000069 | 3300005343 | Bacteria | 33055 |
| 24 | Ga0070687_100232332 | 3300005343 | Bacteria | 1136 |
| 25 | Ga0070692_10010076 | 3300005345 | Bacteria | 4287 |
| 26 | Ga0070692_10303448 | 3300005345 | Bacteria | 976 |
| 27 | Ga0070668_100022871 | 3300005347 | Bacteria | 4726 |
| 28 | Ga0070669_100013309 | 3300005353 | Bacteria | 5847 |
| 29 | Ga0070669_100364818 | 3300005353 | Archaea | 1175 |
| 30 | Ga0070675_100230481 | 3300005354 | Bacteria | 1615 |
| 31 | Ga0070671_100579148 | 3300005355 | Archaea | 969 |
| 32 | Ga0070673_100269484 | 3300005364 | Bacteria | 1490 |
| 33 | Ga0070673_100461768 | 3300005364 | Bacteria | 1143 |
| 34 | Ga0070688_100146232 | 3300005365 | Unclassified | 1611 |
| 35 | Ga0070688_100214206 | 3300005365 | Bacteria | 1354 |
| 36 | Ga0070688_101090354 | 3300005365 | Bacteria | 638 |
| 37 | Ga0070659_101147652 | 3300005366 | Unclassified | 686 |
| 38 | Ga0070667_100761048 | 3300005367 | Bacteria | 898 |
| 39 | Ga0070703_10083362 | 3300005406 | Unclassified | 1094 |
| 40 | Ga0070714_100100787 | 3300005435 | Bacteria | 2544 |
| 41 | Ga0070713_100195808 | 3300005436 | Unclassified | 1823 |
| 42 | Ga0070710_10152865 | 3300005437 | Bacteria | 1425 |
| 43 | Ga0070701_10000603 | 3300005438 | Bacteria | 12535 |
| 44 | Ga0070711_100422986 | 3300005439 | Bacteria | 1086 |
| 45 | Ga0070705_100001149 | 3300005440 | Bacteria | 14607 |
| 46 | Ga0070705_100010469 | 3300005440 | Bacteria | 4644 |
| 47 | Ga0070705_100024627 | 3300005440 | Bacteria | 3252 |
| 48 | Ga0070705_100168798 | 3300005440 | Bacteria | 1471 |
| 49 | Ga0070705_100234559 | 3300005440 | Bacteria | 1279 |
| 50 | Ga0070700_100008466 | 3300005441 | Bacteria | 5600 |
| 51 | Ga0070700_100023110 | 3300005441 | Bacteria | 3635 |
| 52 | Ga0070700_101036391 | 3300005441 | Unclassified | 676 |
| 53 | Ga0070694_100001966 | 3300005444 | Bacteria | 12184 |
| 54 | Ga0070694_100038605 | 3300005444 | Bacteria | 3174 |
| 55 | Ga0070694_100102411 | 3300005444 | Bacteria | 2027 |
| 56 | Ga0070694_100154825 | 3300005444 | Bacteria | 1677 |
| 57 | Ga0070694_100240387 | 3300005444 | Bacteria | 1366 |
| 58 | Ga0070694_100319385 | 3300005444 | Bacteria | 1195 |
| 59 | Ga0070694_100519864 | 3300005444 | Unclassified | 949 |
| 60 | Ga0070694_100754982 | 3300005444 | Unclassified | 795 |
| 61 | Ga0070694_100915354 | 3300005444 | Bacteria | 725 |
| 62 | Ga0070708_100623349 | 3300005445 | Bacteria | 1017 |
| 63 | Ga0070681_10035955 | 3300005458 | Bacteria | 4975 |
| 64 | Ga0070681_10120479 | 3300005458 | Bacteria | 2559 |
| 65 | Ga0070681_10229224 | 3300005458 | Bacteria | 1772 |
| 66 | Ga0068867_100000296 | 3300005459 | Bacteria | 32704 |
| 67 | Ga0068867_100011080 | 3300005459 | Bacteria | 6361 |
| 68 | Ga0068867_100899274 | 3300005459 | Unclassified | 796 |
| 69 | Ga0068867_101254362 | 3300005459 | Bacteria | 683 |
| 70 | Ga0070706_100768166 | 3300005467 | Bacteria | 893 |
| 71 | Ga0070706_101373514 | 3300005467 | Bacteria | 647 |
| 72 | Ga0070707_100573127 | 3300005468 | Bacteria | 1091 |
| 73 | Ga0070698_100052274 | 3300005471 | Bacteria | 4157 |
| 74 | Ga0070698_100092149 | 3300005471 | Bacteria | 3011 |
| 75 | Ga0070698_100490415 | 3300005471 | Bacteria | 1166 |
| 76 | Ga0070699_100100337 | 3300005518 | Bacteria | 2537 |
| 77 | Ga0070699_100234972 | 3300005518 | Bacteria | 1635 |
| 78 | Ga0070699_100690030 | 3300005518 | Bacteria | 933 |
| 79 | Ga0070699_101002427 | 3300005518 | Bacteria | 766 |
| 80 | Ga0070679_100003737 | 3300005530 | Bacteria | 13955 |
| 81 | Ga0070679_100112749 | 3300005530 | Bacteria | 2705 |
| 82 | Ga0070679_100256385 | 3300005530 | Bacteria | 1704 |
| 83 | Ga0070684_100212309 | 3300005535 | Bacteria | 1764 |
| 84 | Ga0070697_100009252 | 3300005536 | Bacteria | 7699 |
| 85 | Ga0070697_100396270 | 3300005536 | Bacteria | 1197 |
| 86 | Ga0068853_100072412 | 3300005539 | Unclassified | 3003 |
| 87 | Ga0070672_101561865 | 3300005543 | Unclassified | 592 |
| 88 | Ga0070686_100000090 | 3300005544 | Bacteria | 63246 |
| 89 | Ga0070686_100267793 | 3300005544 | Bacteria | 1255 |
| 90 | Ga0070686_100358380 | 3300005544 | Bacteria | 1098 |
| 91 | Ga0070686_100429094 | 3300005544 | Bacteria | 1011 |
| 92 | Ga0070686_100434628 | 3300005544 | Bacteria | 1005 |
| 93 | Ga0070686_101194839 | 3300005544 | Unclassified | 631 |
| 94 | Ga0070695_100000188 | 3300005545 | Bacteria | 29840 |
| 95 | Ga0070695_100004474 | 3300005545 | Bacteria | 8213 |
| 96 | Ga0070695_100022517 | 3300005545 | Bacteria | 3866 |
| 97 | Ga0070695_100119152 | 3300005545 | Unclassified | 1803 |
| 98 | Ga0070695_100226764 | 3300005545 | Bacteria | 1349 |
| 99 | Ga0070695_100443880 | 3300005545 | Bacteria | 993 |
| 100 | Ga0070695_100465393 | 3300005545 | Unclassified | 971 |
| 101 | Ga0070696_100000719 | 3300005546 | Bacteria | 21155 |
| 102 | Ga0070696_100002632 | 3300005546 | Bacteria | 11903 |
| 103 | Ga0070696_100036360 | 3300005546 | Bacteria | 3395 |
| 104 | Ga0070696_100039245 | 3300005546 | Bacteria | 3270 |
| 105 | Ga0070696_100218371 | 3300005546 | Bacteria | 1430 |
| 106 | Ga0070696_100461964 | 3300005546 | Bacteria | 1004 |
| 107 | Ga0070693_100000525 | 3300005547 | Bacteria | 17212 |
| 108 | Ga0070704_100000168 | 3300005549 | Bacteria | 26018 |
| 109 | Ga0070704_100000545 | 3300005549 | Bacteria | 18048 |
| 110 | Ga0070704_100006984 | 3300005549 | Bacteria | 6696 |
| 111 | Ga0070704_100037205 | 3300005549 | Bacteria | 3323 |
| 112 | Ga0070704_100099034 | 3300005549 | Bacteria | 2192 |
| 113 | Ga0070704_100466991 | 3300005549 | Unclassified | 1090 |
| 114 | Ga0070704_100622522 | 3300005549 | Bacteria | 950 |
| 115 | Ga0070704_101053583 | 3300005549 | Unclassified | 737 |
| 116 | Ga0068855_100000833 | 3300005563 | Bacteria | 38155 |
| 117 | Ga0068854_100000657 | 3300005578 | Bacteria | 20579 |
| 118 | Ga0068854_100764757 | 3300005578 | Bacteria | 839 |
| 119 | Ga0068856_100003103 | 3300005614 | Bacteria | 16966 |
| 120 | Ga0070702_100000002 | 3300005615 | Bacteria | 83999 |
| 121 | Ga0070702_100004543 | 3300005615 | Bacteria | 6350 |
| 122 | Ga0070702_100595670 | 3300005615 | Bacteria | 828 |
| 123 | Ga0068852_100439119 | 3300005616 | Bacteria | 1290 |
| 124 | Ga0068859_100000195 | 3300005617 | Bacteria | 59015 |
| 125 | Ga0068859_100115984 | 3300005617 | Unclassified | 2743 |
| 126 | Ga0068859_100345673 | 3300005617 | Bacteria | 1582 |
| 127 | Ga0068859_100719125 | 3300005617 | Unclassified | 1089 |
| 128 | Ga0068864_100319590 | 3300005618 | Bacteria | 1458 |
| 129 | Ga0068864_100666633 | 3300005618 | Bacteria | 1014 |
| 130 | Ga0068866_10002071 | 3300005718 | Bacteria | 8341 |
| 131 | Ga0068866_10089292 | 3300005718 | Bacteria | 1675 |
| 132 | Ga0068861_100000043 | 3300005719 | Bacteria | 57807 |
| 133 | Ga0068861_100062821 | 3300005719 | Bacteria | 2853 |
| 134 | Ga0068858_100005138 | 3300005842 | Bacteria | 12824 |
| 135 | Ga0068858_100199292 | 3300005842 | Unclassified | 1893 |
| 136 | Ga0068860_100002559 | 3300005843 | Bacteria | 19020 |
| 137 | Ga0068860_100083022 | 3300005843 | Bacteria | 3047 |
| 138 | Ga0068862_100002188 | 3300005844 | Bacteria | 17538 |
| 139 | Ga0068862_100070855 | 3300005844 | Bacteria | 3010 |
| 140 | Ga0068862_100132940 | 3300005844 | Bacteria | 2202 |
| 141 | Ga0068862_101635017 | 3300005844 | Unclassified | 652 |
| 142 | Ga0081538_10125963 | 3300005981 | Bacteria | 1217 |
| 143 | Ga0081539_10000233 | 3300005985 | Bacteria | 130647 |
| 144 | Ga0070715_10050628 | 3300006163 | Bacteria | 1784 |
| 145 | Ga0070716_100007311 | 3300006173 | Bacteria | 5433 |
| 146 | Ga0070716_100059116 | 3300006173 | Unclassified | 2209 |
| 147 | Ga0097621_100000045 | 3300006237 | Bacteria | 65278 |
| 148 | Ga0097621_100016034 | 3300006237 | Bacteria | 5653 |
| 149 | Ga0097621_100167247 | 3300006237 | Bacteria | 1894 |
| 150 | Ga0097621_100350612 | 3300006237 | Unclassified | 1312 |
| 151 | Ga0068871_100000040 | 3300006358 | Bacteria | 69044 |
| 152 | Ga0068871_100012220 | 3300006358 | Bacteria | 6321 |
| 153 | Ga0075428_100000047 | 3300006844 | Bacteria | 96882 |
| 154 | Ga0075428_100043245 | 3300006844 | Bacteria | 4952 |
| 155 | Ga0075428_100050115 | 3300006844 | Bacteria | 4580 |
| 156 | Ga0075428_100097885 | 3300006844 | Bacteria | 3198 |
| 157 | Ga0075428_100253105 | 3300006844 | Unclassified | 1897 |
| 158 | Ga0075428_100530864 | 3300006844 | Bacteria | 1258 |
| 159 | Ga0075428_101074348 | 3300006844 | Bacteria | 850 |
| 160 | Ga0075430_100004392 | 3300006846 | Bacteria | 11904 |
| 161 | Ga0075430_100018834 | 3300006846 | Bacteria | 5873 |
| 162 | Ga0075430_100023346 | 3300006846 | Bacteria | 5263 |
| 163 | Ga0075430_100058324 | 3300006846 | Bacteria | 3245 |
| 164 | Ga0075430_100147024 | 3300006846 | Unclassified | 1963 |
| 165 | Ga0075430_100164839 | 3300006846 | Bacteria | 1844 |
| 166 | Ga0075431_100014374 | 3300006847 | Bacteria | 8006 |
| 167 | Ga0075431_100101199 | 3300006847 | Bacteria | 2973 |
| 168 | Ga0075431_100120534 | 3300006847 | Bacteria | 2707 |
| 169 | Ga0075431_100237297 | 3300006847 | Bacteria | 1856 |
| 170 | Ga0075433_10000605 | 3300006852 | Bacteria | 23895 |
| 171 | Ga0075433_10071751 | 3300006852 | Bacteria | 3044 |
| 172 | Ga0075434_100000006 | 3300006871 | Bacteria | 96966 |
| 173 | Ga0075434_100000554 | 3300006871 | Bacteria | 28632 |
| 174 | Ga0075434_100047891 | 3300006871 | Bacteria | 4241 |
| 175 | Ga0075434_101456026 | 3300006871 | Bacteria | 694 |
| 176 | Ga0075434_101813977 | 3300006871 | Unclassified | 617 |
| 177 | Ga0075434_102044309 | 3300006871 | Bacteria | 578 |
| 178 | Ga0075429_100000008 | 3300006880 | Bacteria | 86739 |
| 179 | Ga0075429_100000067 | 3300006880 | Bacteria | 51949 |
| 180 | Ga0075429_100052460 | 3300006880 | Bacteria | 3548 |
| 181 | Ga0075429_100177709 | 3300006880 | Bacteria | 1865 |
| 182 | Ga0075429_100298831 | 3300006880 | Unclassified | 1410 |
| 183 | Ga0075429_101293697 | 3300006880 | Unclassified | 636 |
| 184 | Ga0068865_100001956 | 3300006881 | Bacteria | 12156 |
| 185 | Ga0075436_100000174 | 3300006914 | Bacteria | 40099 |
| 186 | Ga0075436_100001082 | 3300006914 | Bacteria | 18349 |
| 187 | Ga0075436_100009225 | 3300006914 | Bacteria | 6751 |
| 188 | Ga0075436_100022044 | 3300006914 | Bacteria | 4374 |
| 189 | Ga0075436_100072304 | 3300006914 | Bacteria | 2386 |
| 190 | Ga0075436_100090296 | 3300006914 | Bacteria | 2129 |
| 191 | Ga0075436_100127289 | 3300006914 | Bacteria | 1785 |
| 192 | Ga0075436_100349398 | 3300006914 | Bacteria | 1065 |
| 193 | Ga0075436_100466701 | 3300006914 | Bacteria | 921 |
| 194 | Ga0097620_100000195 | 3300006931 | Bacteria | 59015 |
| 195 | Ga0097620_100115982 | 3300006931 | Unclassified | 2743 |
| 196 | Ga0097620_100345671 | 3300006931 | Bacteria | 1582 |
| 197 | Ga0097620_100719110 | 3300006931 | Unclassified | 1089 |
| 198 | Ga0075435_100020896 | 3300007076 | Bacteria | 5026 |
| 199 | Ga0075435_100039691 | 3300007076 | Bacteria | 3757 |
| 200 | Ga0075435_100058248 | 3300007076 | Bacteria | 3128 |
| 201 | Ga0075435_100433430 | 3300007076 | Bacteria | 1133 |
| 202 | Ga0099794_10501479 | 3300007265 | Unclassified | 639 |
| 203 | Ga0105250_10073498 | 3300009092 | Bacteria | 1383 |
| 204 | Ga0105250_10375435 | 3300009092 | Bacteria | 626 |
| 205 | Ga0111539_10219068 | 3300009094 | Bacteria | 2217 |
| 206 | Ga0111539_10226278 | 3300009094 | Bacteria | 2179 |
| 207 | Ga0111539_10663354 | 3300009094 | Bacteria | 1214 |
| 208 | Ga0111539_11002257 | 3300009094 | Unclassified | 971 |
| 209 | Ga0111539_11198955 | 3300009094 | Bacteria | 882 |
| 210 | Ga0111539_11293948 | 3300009094 | Bacteria | 846 |
| 211 | Ga0105245_10000306 | 3300009098 | Bacteria | 47026 |
| 212 | Ga0105245_10048544 | 3300009098 | Bacteria | 3798 |
| 213 | Ga0105245_10536166 | 3300009098 | Bacteria | 1191 |
| 214 | Ga0105245_11794603 | 3300009098 | Bacteria | 666 |
| 215 | Ga0114129_10000040 | 3300009147 | Bacteria | 107971 |
| 216 | Ga0114129_10021807 | 3300009147 | Bacteria | 9092 |
| 217 | Ga0114129_10210929 | 3300009147 | Bacteria | 2625 |
| 218 | Ga0114129_10298916 | 3300009147 | Bacteria | 2146 |
| 219 | Ga0114129_10710863 | 3300009147 | Bacteria | 1290 |
| 220 | Ga0114129_10897341 | 3300009147 | Bacteria | 1123 |
| 221 | Ga0114129_10981008 | 3300009147 | Bacteria | 1065 |
| 222 | Ga0114129_12239374 | 3300009147 | Bacteria | 657 |
| 223 | Ga0105243_10000035 | 3300009148 | Bacteria | 177598 |
| 224 | Ga0105243_10002936 | 3300009148 | Bacteria | 14105 |
| 225 | Ga0105241_10070539 | 3300009174 | Unclassified | 2711 |
| 226 | Ga0105242_10004996 | 3300009176 | Bacteria | 10258 |
| 227 | Ga0105242_10039137 | 3300009176 | Bacteria | 3815 |
| 228 | Ga0105242_10258541 | 3300009176 | Bacteria | 1572 |
| 229 | Ga0105242_11735615 | 3300009176 | Bacteria | 661 |
| 230 | Ga0105249_10007943 | 3300009553 | Bacteria | 9249 |
| 231 | Ga0105249_10055112 | 3300009553 | Bacteria | 3636 |
| 232 | Ga0105249_10189440 | 3300009553 | Bacteria | 2007 |
| 233 | Ga0105239_10048386 | 3300010375 | Bacteria | 4663 |
| 234 | Ga0157316_1019378 | 3300012510 | Bacteria | 729 |
| 235 | Ga0157378_10001996 | 3300013297 | Bacteria | 18243 |
| 236 | Ga0157378_10686009 | 3300013297 | Bacteria | 1043 |
| 237 | Ga0163162_10347688 | 3300013306 | Unclassified | 1615 |
| 238 | Ga0157372_11047746 | 3300013307 | Bacteria | 944 |
| 239 | Ga0157372_11048349 | 3300013307 | Unclassified | 944 |
| 240 | Ga0157375_10133322 | 3300013308 | Bacteria | 2605 |
| 241 | Ga0157375_10546244 | 3300013308 | Bacteria | 1320 |
| 242 | Ga0157380_10018970 | 3300014326 | Bacteria | 5119 |
| 243 | Ga0157380_10106095 | 3300014326 | Bacteria | 2350 |
| 244 | Ga0157380_10154190 | 3300014326 | Bacteria | 1989 |
| 245 | Ga0157380_11415728 | 3300014326 | Bacteria | 746 |
| 246 | Ga0157377_10049229 | 3300014745 | Bacteria | 2368 |
| 247 | Ga0157377_10286936 | 3300014745 | Unclassified | 1081 |
| 248 | Ga0157379_10978035 | 3300014968 | Bacteria | 806 |
| 249 | Ga0157376_10000403 | 3300014969 | Bacteria | 28093 |
| 250 | Ga0157376_10022959 | 3300014969 | Bacteria | 4873 |
| 251 | Ga0163161_10225180 | 3300017792 | Bacteria | 1454 |
| 252 | Ga0207692_10117272 | 3300025898 | Unclassified | 1485 |
| 253 | Ga0207642_10003118 | 3300025899 | Bacteria | 5199 |
| 254 | Ga0207642_10052050 | 3300025899 | Bacteria | 1856 |
| 255 | Ga0207685_10260991 | 3300025905 | Bacteria | 842 |
| 256 | Ga0207645_10414579 | 3300025907 | Unclassified | 907 |
| 257 | Ga0207643_10044298 | 3300025908 | Bacteria | 2512 |
| 258 | Ga0207643_10084606 | 3300025908 | Bacteria | 1841 |
| 259 | Ga0207684_10682965 | 3300025910 | Bacteria | 873 |
| 260 | Ga0207654_10034497 | 3300025911 | Unclassified | 2812 |
| 261 | Ga0207707_10028946 | 3300025912 | Bacteria | 4841 |
| 262 | Ga0207707_10048467 | 3300025912 | Bacteria | 3700 |
| 263 | Ga0207707_10476037 | 3300025912 | Unclassified | 1067 |
| 264 | Ga0207693_10462161 | 3300025915 | Bacteria | 991 |
| 265 | Ga0207663_10133508 | 3300025916 | Unclassified | 1719 |
| 266 | Ga0207660_10006506 | 3300025917 | Bacteria | 7582 |
| 267 | Ga0207660_10047673 | 3300025917 | Bacteria | 3031 |
| 268 | Ga0207660_10088771 | 3300025917 | Bacteria | 2287 |
| 269 | Ga0207660_10155707 | 3300025917 | Bacteria | 1759 |
| 270 | Ga0207660_10914922 | 3300025917 | Unclassified | 716 |
| 271 | Ga0207662_10000006 | 3300025918 | Bacteria | 105457 |
| 272 | Ga0207662_10039730 | 3300025918 | Bacteria | 2761 |
| 273 | Ga0207652_10088081 | 3300025921 | Bacteria | 2723 |
| 274 | Ga0207646_10280400 | 3300025922 | Bacteria | 1506 |
| 275 | Ga0207681_10025231 | 3300025923 | Bacteria | 3821 |
| 276 | Ga0207687_10003249 | 3300025927 | Bacteria | 11009 |
| 277 | Ga0207687_10027525 | 3300025927 | Bacteria | 3815 |
| 278 | Ga0207664_10036885 | 3300025929 | Bacteria | 3780 |
| 279 | Ga0207644_10540261 | 3300025931 | Unclassified | 964 |
| 280 | Ga0207686_10003499 | 3300025934 | Bacteria | 8434 |
| 281 | Ga0207686_10016405 | 3300025934 | Bacteria | 4158 |
| 282 | Ga0207686_11024912 | 3300025934 | Bacteria | 670 |
| 283 | Ga0207709_10007469 | 3300025935 | Bacteria | 6084 |
| 284 | Ga0207709_10015032 | 3300025935 | Bacteria | 4286 |
| 285 | Ga0207670_10001617 | 3300025936 | Bacteria | 11751 |
| 286 | Ga0207670_10020433 | 3300025936 | Unclassified | 4069 |
| 287 | Ga0207670_10117777 | 3300025936 | Bacteria | 1925 |
| 288 | Ga0207670_10594479 | 3300025936 | Bacteria | 908 |
| 289 | Ga0207669_10021023 | 3300025937 | Bacteria | 3436 |
| 290 | Ga0207665_10007350 | 3300025939 | Bacteria | 7284 |
| 291 | Ga0207665_10081009 | 3300025939 | Unclassified | 2234 |
| 292 | Ga0207665_10663647 | 3300025939 | Unclassified | 818 |
| 293 | Ga0207711_10530941 | 3300025941 | Bacteria | 1097 |
| 294 | Ga0207711_11559720 | 3300025941 | Bacteria | 604 |
| 295 | Ga0207689_10000082 | 3300025942 | Bacteria | 76708 |
| 296 | Ga0207689_10010692 | 3300025942 | Bacteria | 7895 |
| 297 | Ga0207689_10097302 | 3300025942 | Unclassified | 2417 |
| 298 | Ga0207689_10229664 | 3300025942 | Unclassified | 1534 |
| 299 | Ga0207661_10010666 | 3300025944 | Bacteria | 6623 |
| 300 | Ga0207667_10012981 | 3300025949 | Bacteria | 9561 |
| 301 | Ga0207651_10048965 | 3300025960 | Unclassified | 2860 |
| 302 | Ga0207712_10033486 | 3300025961 | Bacteria | 3474 |
| 303 | Ga0207712_10096830 | 3300025961 | Bacteria | 2185 |
| 304 | Ga0207640_10001404 | 3300025981 | Bacteria | 13006 |
| 305 | Ga0207677_10005887 | 3300026023 | Bacteria | 6671 |
| 306 | Ga0207703_10017112 | 3300026035 | Bacteria | 5653 |
| 307 | Ga0207703_11678154 | 3300026035 | Bacteria | 611 |
| 308 | Ga0207639_10203879 | 3300026041 | Unclassified | 1698 |
| 309 | Ga0207708_10000936 | 3300026075 | Bacteria | 21857 |
| 310 | Ga0207708_10005903 | 3300026075 | Bacteria | 9059 |
| 311 | Ga0207708_10076932 | 3300026075 | Bacteria | 2560 |
| 312 | Ga0207702_10014977 | 3300026078 | Bacteria | 6433 |
| 313 | Ga0207648_10000316 | 3300026089 | Bacteria | 52941 |
| 314 | Ga0207648_10012170 | 3300026089 | Bacteria | 8061 |
| 315 | Ga0207648_10098142 | 3300026089 | Bacteria | 2564 |
| 316 | Ga0207648_10280594 | 3300026089 | Bacteria | 1490 |
| 317 | Ga0207648_10414948 | 3300026089 | Bacteria | 1222 |
| 318 | Ga0207676_10036639 | 3300026095 | Unclassified | 3734 |
| 319 | Ga0207676_11050539 | 3300026095 | Bacteria | 804 |
| 320 | Ga0207674_10481037 | 3300026116 | Bacteria | 1200 |
| 321 | Ga0207675_100000064 | 3300026118 | Bacteria | 79279 |
| 322 | Ga0207675_100020995 | 3300026118 | Bacteria | 6088 |
| 323 | Ga0207675_100776432 | 3300026118 | Bacteria | 970 |
| 324 | Ga0209969_1003506 | 3300027360 | Bacteria | 2173 |
| 325 | Ga0209969_1019015 | 3300027360 | Bacteria | 1017 |
| 326 | Ga0209969_1021320 | 3300027360 | Bacteria | 967 |
| 327 | Ga0209967_1000357 | 3300027364 | Bacteria | 6048 |
| 328 | Ga0209981_1008074 | 3300027378 | Bacteria | 1426 |
| 329 | Ga0209981_1012236 | 3300027378 | Bacteria | 1187 |
| 330 | Ga0210000_1000809 | 3300027462 | Bacteria | 4332 |
| 331 | Ga0210000_1010309 | 3300027462 | Bacteria | 1382 |
| 332 | Ga0210000_1015146 | 3300027462 | Bacteria | 1159 |
| 333 | Ga0209995_1002187 | 3300027471 | Bacteria | 3072 |
| 334 | Ga0209968_1009734 | 3300027526 | Bacteria | 1473 |
| 335 | Ga0209968_1014172 | 3300027526 | Bacteria | 1254 |
| 336 | Ga0209968_1028151 | 3300027526 | Unclassified | 932 |
| 337 | Ga0209983_1007574 | 3300027665 | Bacteria | 2224 |
| 338 | Ga0209588_1019685 | 3300027671 | Bacteria | 2109 |
| 339 | Ga0209588_1173135 | 3300027671 | Bacteria | 679 |
| 340 | Ga0209966_1046734 | 3300027695 | Unclassified | 914 |
| 341 | Ga0209966_1100938 | 3300027695 | Bacteria | 652 |
| 342 | Ga0209998_10004757 | 3300027717 | Bacteria | 2869 |
| 343 | Ga0207428_10006021 | 3300027907 | Bacteria | 11221 |
| 344 | Ga0207428_10225761 | 3300027907 | Bacteria | 1403 |
| 345 | Ga0207428_10323740 | 3300027907 | Bacteria | 1138 |
| 346 | Ga0207428_11007083 | 3300027907 | Bacteria | 585 |
| 347 | Ga0268265_10006971 | 3300028380 | Bacteria | 7644 |
| 348 | Ga0268265_10014708 | 3300028380 | Bacteria | 5338 |
| 349 | Ga0268265_10127613 | 3300028380 | Bacteria | 2108 |
| 350 | Ga0268264_10001394 | 3300028381 | Bacteria | 22601 |
| 351 | Ga0268264_10112410 | 3300028381 | Unclassified | 2388 |
| 352 | Ga0307408_100009977 | 3300031548 | Bacteria | 6257 |
| 353 | Ga0307408_100197104 | 3300031548 | Bacteria | 1627 |
| 354 | Ga0307408_100899559 | 3300031548 | Unclassified | 810 |
| 355 | Ga0307408_101239381 | 3300031548 | Unclassified | 697 |
| 356 | Ga0307408_101396030 | 3300031548 | Bacteria | 659 |
| 357 | Ga0307412_10623669 | 3300031911 | Bacteria | 916 |
| 358 | Ga0307416_100014510 | 3300032002 | Bacteria | 5405 |
| 359 | Ga0307416_100146913 | 3300032002 | Bacteria | 2154 |
| 360 | Ga0307416_100450787 | 3300032002 | Bacteria | 1339 |
| 361 | Ga0307416_100701589 | 3300032002 | Bacteria | 1101 |
| 362 | Ga0307411_10079222 | 3300032005 | Bacteria | 2255 |
| 363 | Ga0307411_10277041 | 3300032005 | Bacteria | 1333 |
| 364 | Ga0307411_10531564 | 3300032005 | Bacteria | 1000 |
| 365 | Ga0373948_0018888 | 3300034817 | Archaea | 1299 |
| 366 | Ga0373959_0011584 | 3300034820 | Unclassified | 1560 |
| 367 | Ga0373938_0040440 | 3300034957 | Bacteria | 1034 |
| 368 | Ga0373938_0134466 | 3300034957 | Bacteria | 647 |
| 369 | Ga0373926_0001625 | 3300035083 | Bacteria | 6933 |
| 370 | Ga0373928_0048764 | 3300035084 | Bacteria | 994 |
| 371 | Ga0373928_0106030 | 3300035084 | Bacteria | 739 |
| 372 | Ga0373929_0029314 | 3300035085 | Bacteria | 1167 |
| 373 | Ga0373929_0067608 | 3300035085 | Bacteria | 849 |
| 374 | Ga0373934_0000505 | 3300035086 | Bacteria | 13698 |
| 375 | Ga0373934_0059617 | 3300035086 | Unclassified | 1519 |
| 376 | Ga0373934_0147300 | 3300035086 | Unclassified | 963 |
| 377 | Ga0373940_0001144 | 3300035088 | Bacteria | 4640 |
| 378 | Ga0373944_0001341 | 3300035089 | Bacteria | 6197 |
| 379 | Ga0373949_0047640 | 3300035090 | Bacteria | 1072 |
| 380 | Ga0373951_0009424 | 3300035091 | Bacteria | 2198 |
| 381 | Ga0373952_0052459 | 3300035092 | Bacteria | 976 |
| 382 | Ga0373923_0005638 | 3300035111 | Bacteria | 4263 |
| 383 | Ga0373923_0359759 | 3300035111 | Bacteria | 696 |
| 384 | Ga0373936_0063265 | 3300035113 | Archaea | 1514 |
| 385 | Ga0373939_0004598 | 3300035114 | Bacteria | 3268 |
| 386 | Ga0373939_0004651 | 3300035114 | Bacteria | 3252 |
| 387 | Ga0373939_0015372 | 3300035114 | Bacteria | 2002 |
| 388 | Ga0373941_0034851 | 3300035115 | Bacteria | 1521 |
| 389 | Ga0373945_0009215 | 3300035116 | Bacteria | 3230 |
| 390 | Ga0373953_0020872 | 3300035117 | Unclassified | 2451 |
| 391 | Ga0373953_0029634 | 3300035117 | Bacteria | 2118 |
| 392 | Ga0373953_0106868 | 3300035117 | Unclassified | 1181 |
| 393 | Ga0373954_0000020 | 3300035118 | Bacteria | 60211 |
| 394 | Ga0373954_0000592 | 3300035118 | Bacteria | 13753 |
| 395 | Ga0373954_0013456 | 3300035118 | Bacteria | 3646 |
| 396 | Ga0373954_0152396 | 3300035118 | Unclassified | 1129 |
| 397 | Ga0373956_0000714 | 3300035119 | Bacteria | 13664 |
| 398 | Ga0373956_0008076 | 3300035119 | Bacteria | 4256 |
| 399 | Ga0373957_0010655 | 3300035120 | Bacteria | 3046 |
| 400 | Ga0373957_0103267 | 3300035120 | Bacteria | 1143 |
| 401 | Ga0373957_0209768 | 3300035120 | Bacteria | 813 |
| 402 | Ga0373960_0096245 | 3300035121 | Unclassified | 954 |
| 403 | Ga0373960_0096662 | 3300035121 | Bacteria | 952 |
| 404 | Ga0373960_0126494 | 3300035121 | Unclassified | 853 |
| 405 | Ga0373960_0129364 | 3300035121 | Bacteria | 845 |
| 406 | Ga0373946_0005400 | 3300035171 | Bacteria | 4607 |
| 407 | Ga0373955_0008526 | 3300035172 | Bacteria | 4764 |
| 408 | Ga0373955_0020377 | 3300035172 | Bacteria | 3333 |
| 409 | Ga0373955_0045973 | 3300035172 | Bacteria | 2358 |
| 410 | Ga0373955_0778866 | 3300035172 | Unclassified | 588 |
| 411 | Ga0373942_0019335 | 3300035207 | Unclassified | 1699 |
| 412 | Ga0373942_0104127 | 3300035207 | Bacteria | 870 |
| 413 | Ga0373942_0192844 | 3300035207 | Unclassified | 672 |
| 414 | Ga0373961_0013206 | 3300035241 | Unclassified | 2078 |
| 415 | Ga0373961_0053627 | 3300035241 | Bacteria | 1204 |
| 416 | Ga0373961_0110463 | 3300035241 | Unclassified | 900 |
| 417 | Ga0373962_0023028 | 3300035242 | Bacteria | 1656 |
| 418 | Ga0373924_0011800 | 3300035410 | Bacteria | 3251 |
| 419 | Ga0373924_0034126 | 3300035410 | Bacteria | 2058 |
| 420 | Ga0373931_0003341 | 3300035691 | Bacteria | 7186 |
| 421 | Ga0373931_0017425 | 3300035691 | Bacteria | 3553 |
| 422 | Ga0373931_0069470 | 3300035691 | Unclassified | 1919 |
| 423 | Ga0373931_0099167 | 3300035691 | Bacteria | 1636 |
| 424 | Ga0373931_0145086 | 3300035691 | Bacteria | 1379 |
| 425 | Ga0373931_0430763 | 3300035691 | Bacteria | 840 |
| 426 | Ga0373935_0007432 | 3300035692 | Bacteria | 6558 |
| 427 | Ga0373935_0010129 | 3300035692 | Bacteria | 5645 |
| 428 | Ga0373935_0164435 | 3300035692 | Bacteria | 1514 |
| 429 | Ga0373935_0226679 | 3300035692 | Bacteria | 1300 |
| 430 | Ga0373935_0937556 | 3300035692 | Bacteria | 642 |
| 431 | Ga0373927_0028362 | 3300035695 | Bacteria | 3650 |
| 432 | Ga0373927_0342917 | 3300035695 | Bacteria | 984 |
| 433 | Ga0373933_0001085 | 3300035724 | Bacteria | 16282 |
| 434 | Ga0373933_0010314 | 3300035724 | Bacteria | 5120 |
| 435 | Ga0373933_0023497 | 3300035724 | Bacteria | 3522 |
| 436 | Ga0373933_0089132 | 3300035724 | Bacteria | 1901 |
| 437 | Ga0373933_0248342 | 3300035724 | Bacteria | 1145 |
| 438 | Ga0373947_0188465 | 3300035725 | Unclassified | 1345 |
| 439 | Ga0373947_0303141 | 3300035725 | Archaea | 1065 |
| 440 | Ga0373937_0005040 | 3300036401 | Bacteria | 11244 |
| 441 | Ga0373937_0011050 | 3300036401 | Bacteria | 7914 |
| 442 | Ga0373937_0044614 | 3300036401 | Bacteria | 4050 |
| 443 | Ga0373937_0047468 | 3300036401 | Bacteria | 3929 |
| 444 | Ga0373937_0092999 | 3300036401 | Bacteria | 2795 |
| 445 | Ga0373937_0619215 | 3300036401 | Bacteria | 1027 |
| 446 | Ga0373925_0284174 | 3300037068 | Bacteria | 1333 |
| 447 | Ga0242420_023185 | 3300038996 | Bacteria | 1120 |
| 448 | Ga0439439_0042570 | 3300041406 | Bacteria | 1180 |
| 449 | Ga0439461_0002846 | 3300041410 | Bacteria | 2800 |
| 450 | Ga0439465_0151432 | 3300041413 | Unclassified | 829 |
| 451 | Ga0451807_1028620 | 3300041486 | Bacteria | 1526 |
| 452 | Ga0451853_4099157 | 3300041512 | Bacteria | 781 |
| 453 | Ga0439441_016881 | 3300042001 | Bacteria | 1306 |
| 454 | Ga0439441_028188 | 3300042001 | Bacteria | 1075 |
| 455 | Ga0439462_0063660 | 3300042015 | Bacteria | 998 |
| 456 | Ga0439446_0027521 | 3300042156 | Bacteria | 1632 |
| 457 | Ga0439434_0012556 | 3300042435 | Bacteria | 2506 |
| 458 | Ga0439434_0029512 | 3300042435 | Bacteria | 1663 |
| 459 | Ga0439435_0009299 | 3300042436 | Bacteria | 2303 |
| 460 | Ga0439435_0026661 | 3300042436 | Unclassified | 1540 |
| 461 | Ga0439435_0072329 | 3300042436 | Bacteria | 1022 |
| 462 | Ga0439435_0109451 | 3300042436 | Unclassified | 856 |
| 463 | Ga0439444_0018510 | 3300042437 | Bacteria | 1206 |
| 464 | Ga0439444_0020499 | 3300042437 | Bacteria | 1163 |
| 465 | Ga0439460_0002845 | 3300042461 | Bacteria | 4167 |
| 466 | Ga0450893_0010142 | 3300042532 | Bacteria | 1545 |
| 467 | Ga0451577_0810099 | 3300042876 | Bacteria | 846 |
| 468 | Ga0451577_1191818 | 3300042876 | Bacteria | 679 |
| 469 | Ga0466964_0040288 | 3300044706 | Unclassified | 1886 |
| 470 | Ga0453684_0364527 | 3300044712 | Unclassified | 1626 |
| 471 | Ga0466957_0047747 | 3300044842 | Unclassified | 2602 |
| 472 | Ga0466960_0074678 | 3300044901 | Bacteria | 1695 |
| 473 | Ga0451576_0000822 | 3300045051 | Bacteria | 60600 |
| 474 | Ga0451576_0022841 | 3300045051 | Bacteria | 6777 |
| 475 | Ga0451576_0029853 | 3300045051 | Bacteria | 5832 |
| 476 | Ga0451576_0098737 | 3300045051 | Bacteria | 3037 |
| 477 | Ga0451576_0177885 | 3300045051 | Bacteria | 2221 |
| 478 | Ga0451576_0520242 | 3300045051 | Bacteria | 1250 |
| 479 | Ga0466967_0164773 | 3300045976 | Bacteria | 2082 |
| 480 | Ga0495592_0000293 | 3300046454 | Bacteria | 42689 |
| 481 | Ga0495592_0044598 | 3300046454 | Bacteria | 3312 |
| 482 | Ga0495592_0057151 | 3300046454 | Bacteria | 2880 |
| 483 | Ga0495592_0136588 | 3300046454 | Bacteria | 1709 |
| 484 | Ga0495603_0046469 | 3300046455 | Bacteria | 2587 |
| 485 | Ga0495629_0476902 | 3300046459 | Bacteria | 843 |
| 486 | Ga0495641_0010332 | 3300046461 | Bacteria | 5420 |
| 487 | Ga0495641_0058502 | 3300046461 | Unclassified | 1744 |
| 488 | Ga0495651_0011710 | 3300046462 | Bacteria | 6740 |
| 489 | Ga0495651_0176623 | 3300046462 | Bacteria | 1516 |
| 490 | Ga0495651_0376261 | 3300046462 | Bacteria | 932 |
| 491 | Ga0495653_0190250 | 3300046463 | Unclassified | 1401 |
| 492 | Ga0495580_0087444 | 3300046472 | Bacteria | 2170 |
| 493 | Ga0495582_0012388 | 3300046473 | Bacteria | 4698 |
| 494 | Ga0495639_0005058 | 3300046475 | Bacteria | 5665 |
| 495 | Ga0495639_0030059 | 3300046475 | Unclassified | 2413 |
| 496 | Ga0495662_0005966 | 3300046476 | Bacteria | 6088 |
| 497 | Ga0495662_0017552 | 3300046476 | Bacteria | 3464 |
| 498 | Ga0495662_0026785 | 3300046476 | Bacteria | 2784 |
| 499 | Ga0495594_0304706 | 3300046499 | Bacteria | 907 |
| 500 | Ga0495608_0047424 | 3300046511 | Bacteria | 2856 |
| 501 | Ga0495608_0072742 | 3300046511 | Bacteria | 2242 |
| 502 | Ga0495608_0150098 | 3300046511 | Bacteria | 1485 |
| 503 | Ga0495608_0178831 | 3300046511 | Bacteria | 1343 |
| 504 | Ga0495608_0337276 | 3300046511 | Bacteria | 929 |
| 505 | Ga0495618_0033479 | 3300046514 | Bacteria | 3222 |
| 506 | Ga0495618_0230766 | 3300046514 | Unclassified | 1165 |
| 507 | Ga0495628_0017983 | 3300046516 | Bacteria | 5864 |
| 508 | Ga0495628_0024530 | 3300046516 | Bacteria | 4935 |
| 509 | Ga0495628_0080332 | 3300046516 | Bacteria | 2535 |
| 510 | Ga0495628_0200299 | 3300046516 | Unclassified | 1504 |
| 511 | Ga0495628_0251110 | 3300046516 | Unclassified | 1320 |
| 512 | Ga0495628_0355832 | 3300046516 | Bacteria | 1076 |
| 513 | Ga0495630_0032665 | 3300046517 | Bacteria | 3879 |
| 514 | Ga0495630_0055939 | 3300046517 | Bacteria | 2956 |
| 515 | Ga0495630_0081150 | 3300046517 | Unclassified | 2447 |
| 516 | Ga0495644_0111494 | 3300046523 | Bacteria | 1038 |
| 517 | Ga0495663_0159817 | 3300046525 | Unclassified | 773 |
| 518 | Ga0495666_0033095 | 3300046526 | Bacteria | 2527 |
| 519 | Ga0495666_0176120 | 3300046526 | Bacteria | 988 |
| 520 | Ga0495642_0031610 | 3300046528 | Bacteria | 2123 |
| 521 | Ga0495642_0239912 | 3300046528 | Bacteria | 792 |
| 522 | Ga0495652_0086237 | 3300046529 | Bacteria | 2578 |
| 523 | Ga0495652_0146302 | 3300046529 | Bacteria | 1852 |
| 524 | Ga0495652_0298567 | 3300046529 | Bacteria | 1172 |
| 525 | Ga0495665_0085235 | 3300046531 | Bacteria | 1660 |
| 526 | Ga0495640_0018156 | 3300046533 | Bacteria | 5227 |
| 527 | Ga0495640_0044954 | 3300046533 | Bacteria | 3066 |
| 528 | Ga0495640_0242237 | 3300046533 | Bacteria | 1131 |
| 529 | Ga0495586_0008518 | 3300046535 | Bacteria | 5457 |
| 530 | Ga0495586_0176346 | 3300046535 | Bacteria | 1208 |
| 531 | Ga0495586_0203553 | 3300046535 | Unclassified | 1122 |
| 532 | Ga0495587_0024137 | 3300046536 | Bacteria | 3731 |
| 533 | Ga0495587_0058727 | 3300046536 | Bacteria | 2259 |
| 534 | Ga0495587_0167599 | 3300046536 | Unclassified | 1248 |
| 535 | Ga0495598_0054186 | 3300046537 | Bacteria | 1217 |
| 536 | Ga0495598_0132401 | 3300046537 | Unclassified | 856 |
| 537 | Ga0495609_0108116 | 3300046538 | Bacteria | 1202 |
| 538 | Ga0495621_0060974 | 3300046539 | Bacteria | 1369 |
| 539 | Ga0495621_0074683 | 3300046539 | Bacteria | 1255 |
| 540 | Ga0495645_0000344 | 3300046543 | Bacteria | 32939 |
| 541 | Ga0495645_0078290 | 3300046543 | Bacteria | 2376 |
| 542 | Ga0495667_0018506 | 3300046559 | Bacteria | 4706 |
| 543 | Ga0495667_0064884 | 3300046559 | Bacteria | 2388 |
| 544 | Ga0495667_0083269 | 3300046559 | Bacteria | 2077 |
| 545 | Ga0495667_0118538 | 3300046559 | Unclassified | 1709 |
| 546 | Ga0495667_0736911 | 3300046559 | Bacteria | 609 |
| 547 | Ga0495634_0012351 | 3300046642 | Bacteria | 6185 |
| 548 | Ga0495634_0022467 | 3300046642 | Bacteria | 4444 |
| 549 | Ga0495634_0068049 | 3300046642 | Bacteria | 2353 |
| 550 | Ga0495635_0056142 | 3300046663 | Bacteria | 2712 |
| 551 | Ga0495635_0182715 | 3300046663 | Bacteria | 1425 |
| 552 | Ga0495659_0125174 | 3300046664 | Bacteria | 1015 |
| 553 | Ga0495659_0196544 | 3300046664 | Bacteria | 826 |
| 554 | Ga0495588_0060033 | 3300046674 | Bacteria | 1968 |
| 555 | Ga0495657_0014522 | 3300046675 | Bacteria | 5778 |
| 556 | Ga0495657_0116727 | 3300046675 | Bacteria | 1685 |
| 557 | Ga0495657_0159295 | 3300046675 | Bacteria | 1397 |
| 558 | Ga0495657_0180204 | 3300046675 | Bacteria | 1297 |
| 559 | Ga0495599_0000231 | 3300046678 | Bacteria | 35177 |
| 560 | Ga0495599_0022846 | 3300046678 | Bacteria | 3906 |
| 561 | Ga0495646_0156587 | 3300046680 | Unclassified | 1264 |
| 562 | Ga0495647_0004648 | 3300046681 | Bacteria | 4474 |
| 563 | Ga0495647_0310225 | 3300046681 | Bacteria | 712 |
| 564 | Ga0495658_0015526 | 3300046683 | Bacteria | 3907 |
| 565 | Ga0495658_0036547 | 3300046683 | Bacteria | 2710 |
| 566 | Ga0495658_0519895 | 3300046683 | Bacteria | 762 |
| 567 | Ga0495669_0033260 | 3300046684 | Bacteria | 2269 |
| 568 | Ga0495613_0024505 | 3300046689 | Bacteria | 4495 |
| 569 | Ga0495613_0031717 | 3300046689 | Bacteria | 3925 |
| 570 | Ga0495624_0231645 | 3300046690 | Bacteria | 1119 |
| 571 | Ga0495600_0009220 | 3300046809 | Bacteria | 6087 |
| 572 | Ga0495600_0036340 | 3300046809 | Bacteria | 3201 |
| 573 | Ga0495581_0123335 | 3300047315 | Bacteria | 1508 |
| 574 | Ga0495581_0683956 | 3300047315 | Bacteria | 592 |
| 575 | Ga0495604_0011098 | 3300047317 | Bacteria | 7151 |
| 576 | Ga0495604_0015663 | 3300047317 | Bacteria | 6052 |
| 577 | Ga0495636_0002166 | 3300047318 | Bacteria | 7532 |
| 578 | Ga0495674_0080284 | 3300047319 | Unclassified | 2799 |
| 579 | Ga0495674_0084033 | 3300047319 | Bacteria | 2728 |
| 580 | Ga0495676_0211726 | 3300047321 | Bacteria | 1340 |
| 581 | Ga0495680_0032475 | 3300047322 | Bacteria | 4236 |
| 582 | Ga0495680_0056542 | 3300047322 | Bacteria | 3037 |
| 583 | Ga0495680_0079301 | 3300047322 | Bacteria | 2483 |
| 584 | Ga0495680_0101042 | 3300047322 | Unclassified | 2148 |
| 585 | Ga0495680_0170505 | 3300047322 | Bacteria | 1576 |
| 586 | Ga0495684_0025957 | 3300047471 | Bacteria | 4502 |
| 587 | Ga0495684_0096567 | 3300047471 | Bacteria | 2236 |
| 588 | Ga0495684_0319093 | 3300047471 | Bacteria | 1111 |
| 589 | Ga0495684_0320692 | 3300047471 | Unclassified | 1108 |
| 590 | Ga0495684_0700763 | 3300047471 | Bacteria | 671 |
| 591 | Ga0495614_0164452 | 3300048089 | Bacteria | 994 |
| 592 | Ga0501292_119558 | 3300049515 | Bacteria | 536 |
| 593 | Ga0501298_073631 | 3300049521 | Bacteria | 741 |
| 594 | Ga0501033_0030094 | 3300049570 | Bacteria | 4080 |
| 595 | Ga0501036_0401188 | 3300049572 | Bacteria | 1144 |
| 596 | Ga0501037_0253477 | 3300049573 | Bacteria | 1231 |
| 597 | Ga0501037_0480080 | 3300049573 | Bacteria | 845 |
| 598 | Ga0501038_0050494 | 3300049574 | Bacteria | 3593 |
| 599 | Ga0501038_0305991 | 3300049574 | Bacteria | 1246 |
| 600 | Ga0501039_0078134 | 3300049575 | Bacteria | 2574 |
| 601 | Ga0501039_0318257 | 3300049575 | Bacteria | 1223 |
| 602 | Ga0501039_0378992 | 3300049575 | Bacteria | 1111 |
| 603 | Ga0501039_0762417 | 3300049575 | Bacteria | 755 |
| 604 | Ga0501040_0034358 | 3300049576 | Bacteria | 3435 |
| 605 | Ga0501040_0156972 | 3300049576 | Unclassified | 1607 |
| 606 | Ga0501040_0402107 | 3300049576 | Bacteria | 983 |
| 607 | Ga0501040_0454069 | 3300049576 | Bacteria | 922 |
| 608 | Ga0501041_0137227 | 3300049577 | Bacteria | 1524 |
| 609 | Ga0501041_0285010 | 3300049577 | Bacteria | 1040 |
| 610 | Ga0501041_0330409 | 3300049577 | Unclassified | 962 |
| 611 | Ga0501041_0463001 | 3300049577 | Bacteria | 805 |
| 612 | Ga0501042_0035847 | 3300049578 | Bacteria | 3519 |
| 613 | Ga0501042_0309100 | 3300049578 | Bacteria | 1142 |
| 614 | Ga0501042_0444357 | 3300049578 | Unclassified | 940 |
| 615 | Ga0501043_0812048 | 3300049579 | Unclassified | 676 |
| 616 | Ga0501046_0028053 | 3300049580 | Bacteria | 4588 |
| 617 | Ga0501046_0055514 | 3300049580 | Bacteria | 3112 |
| 618 | Ga0501046_0541311 | 3300049580 | Bacteria | 831 |
| 619 | Ga0501048_0083168 | 3300049582 | Bacteria | 2257 |
| 620 | Ga0501048_0189561 | 3300049582 | Bacteria | 1457 |
| 621 | Ga0501048_0662988 | 3300049582 | Bacteria | 749 |
| 622 | Ga0501068_0032306 | 3300049584 | Bacteria | 3113 |
| 623 | Ga0501071_0000879 | 3300049587 | Bacteria | 16236 |
| 624 | Ga0501071_0071317 | 3300049587 | Bacteria | 2532 |
| 625 | Ga0501071_0469648 | 3300049587 | Bacteria | 964 |
| 626 | Ga0501072_0003042 | 3300049588 | Bacteria | 12653 |
| 627 | Ga0501072_0076283 | 3300049588 | Bacteria | 2652 |
| 628 | Ga0501072_0077852 | 3300049588 | Bacteria | 2626 |
| 629 | Ga0501072_0081610 | 3300049588 | Bacteria | 2563 |
| 630 | Ga0501072_0126733 | 3300049588 | Bacteria | 2034 |
| 631 | Ga0501073_0155271 | 3300049589 | Bacteria | 1586 |
| 632 | Ga0501073_0284449 | 3300049589 | Bacteria | 1141 |
| 633 | Ga0501074_0211108 | 3300049590 | Bacteria | 1383 |
| 634 | Ga0501075_0044465 | 3300049591 | Bacteria | 3332 |
| 635 | Ga0501075_0166662 | 3300049591 | Bacteria | 1681 |
| 636 | Ga0501075_0181147 | 3300049591 | Bacteria | 1607 |
| 637 | Ga0501076_0001168 | 3300049592 | Bacteria | 17374 |
| 638 | Ga0501077_0213297 | 3300049593 | Bacteria | 1227 |
| 639 | Ga0501235_044322 | 3300049669 | Bacteria | 1022 |
| 640 | Ga0501249_034262 | 3300049679 | Bacteria | 1139 |
| 641 | Ga0501079_0002730 | 3300049741 | Bacteria | 12860 |
| 642 | Ga0501079_0041684 | 3300049741 | Bacteria | 3545 |
| 643 | Ga0501079_0358803 | 3300049741 | Bacteria | 1142 |
| 644 | Ga0501080_0058100 | 3300049742 | Bacteria | 3601 |
| 645 | Ga0501081_0013737 | 3300049743 | Bacteria | 5326 |
| 646 | Ga0501273_014629 | 3300049770 | Bacteria | 1012 |
| 647 | Ga0501035_0047672 | 3300049822 | Bacteria | 3845 |
| 648 | Ga0501035_0432495 | 3300049822 | Bacteria | 1091 |
| 649 | Ga0501045_0068835 | 3300049824 | Bacteria | 2601 |
| 650 | Ga0501045_0082061 | 3300049824 | Bacteria | 2377 |
| 651 | nmdc:mga05p37_109_c1 | 3300050507 | Bacteria | 74571 |
| 652 | nmdc:mga05p37_261434_c1 | 3300050507 | Bacteria | 2071 |
| 653 | nmdc:mga05p37_358492_c1 | 3300050507 | Bacteria | 1715 |
| 654 | nmdc:mga05p37_604246_c1 | 3300050507 | Bacteria | 1237 |
| 655 | nmdc:mga05p37_886_c1 | 3300050507 | Bacteria | 33754 |
| 656 | nmdc:mga09592_140748_c1 | 3300050508 | Bacteria | 2080 |
| 657 | nmdc:mga09592_202854_c1 | 3300050508 | Unclassified | 1717 |
| 658 | nmdc:mga09592_2901_c1 | 3300050508 | Bacteria | 13899 |
| 659 | nmdc:mga09592_6868_c1 | 3300050508 | Bacteria | 9261 |
| 660 | nmdc:mga0qj67_1170396_c1 | 3300050509 | Unclassified | 599 |
| 661 | nmdc:mga0qj67_137754_c1 | 3300050509 | Unclassified | 1978 |
| 662 | nmdc:mga0qj67_2700_c1 | 3300050509 | Bacteria | 12721 |
| 663 | nmdc:mga0qj67_27222_c1 | 3300050509 | Bacteria | 4428 |
| 664 | nmdc:mga0qj67_385230_c1 | 3300050509 | Bacteria | 1132 |
| 665 | nmdc:mga0qj67_41917_c1 | 3300050509 | Bacteria | 3603 |
| 666 | nmdc:mga0qj67_422082_c1 | 3300050509 | Bacteria | 1075 |
| 667 | nmdc:mga0qj67_507182_c1 | 3300050509 | Bacteria | 970 |
| 668 | nmdc:mga0qj67_662400_c1 | 3300050509 | Unclassified | 832 |
| 669 | nmdc:mga0qj67_6924_c1 | 3300050509 | Bacteria | 8346 |
| 670 | nmdc:mga06r32_1611305_c1 | 3300050510 | Bacteria | 587 |
| 671 | nmdc:mga06r32_16323_c1 | 3300050510 | Bacteria | 6764 |
| 672 | nmdc:mga06r32_173746_c1 | 3300050510 | Bacteria | 2139 |
| 673 | nmdc:mga06r32_287585_c1 | 3300050510 | Bacteria | 1631 |
| 674 | nmdc:mga06r32_309216_c1 | 3300050510 | Unclassified | 1566 |
| 675 | nmdc:mga06r32_383217_c1 | 3300050510 | Bacteria | 1389 |
| 676 | nmdc:mga06r32_395194_c1 | 3300050510 | Bacteria | 1365 |
| 677 | nmdc:mga08y16_152610_c1 | 3300050511 | Bacteria | 2401 |
| 678 | nmdc:mga08y16_189087_c1 | 3300050511 | Unclassified | 2136 |
| 679 | nmdc:mga08y16_346845_c1 | 3300050511 | Bacteria | 1526 |
| 680 | nmdc:mga08y16_429286_c1 | 3300050511 | Unclassified | 1350 |
| 681 | nmdc:mga08y16_90814_c1 | 3300050511 | Bacteria | 3184 |
| 682 | nmdc:mga0n895_423934_c1 | 3300050512 | Bacteria | 1345 |
| 683 | nmdc:mga0n895_4702_c1 | 3300050512 | Bacteria | 11267 |
| 684 | nmdc:mga0n895_677390_c1 | 3300050512 | Unclassified | 1028 |
| 685 | nmdc:mga0n895_772692_c1 | 3300050512 | Archaea | 952 |
| 686 | nmdc:mga0n895_8407_c1 | 3300050512 | Bacteria | 8937 |
| 687 | nmdc:mga0n895_86_c1 | 3300050512 | Bacteria | 53794 |
| 688 | nmdc:mga0rr50_241822_c1 | 3300050513 | Unclassified | 1496 |
| 689 | nmdc:mga0rr50_3195_c1 | 3300050513 | Bacteria | 9370 |
| 690 | nmdc:mga0rr50_390926_c1 | 3300050513 | Bacteria | 1174 |
| 691 | nmdc:mga0rr50_664_c1 | 3300050513 | Bacteria | 18446 |
| 692 | nmdc:mga08x19_11713_c1 | 3300050514 | Bacteria | 5282 |
| 693 | nmdc:mga08x19_138253_c1 | 3300050514 | Bacteria | 1644 |
| 694 | nmdc:mga08x19_20408_c1 | 3300050514 | Bacteria | 4079 |
| 695 | nmdc:mga08x19_4656_c1 | 3300050514 | Bacteria | 8139 |
| 696 | nmdc:mga08x19_557910_c1 | 3300050514 | Bacteria | 811 |
| 697 | nmdc:mga08x19_6463_c1 | 3300050514 | Bacteria | 6938 |
| 698 | nmdc:mga08x19_70089_c1 | 3300050514 | Bacteria | 2284 |
| 699 | nmdc:mga08x19_758067_c1 | 3300050514 | Unclassified | 689 |
| 700 | nmdc:mga0a205_281873_c1 | 3300050515 | Bacteria | 1537 |
| 701 | nmdc:mga0a205_31489_c1 | 3300050515 | Bacteria | 5081 |
| 702 | nmdc:mga0a205_385096_c1 | 3300050515 | Unclassified | 1267 |
| 703 | nmdc:mga0a205_505_c1 | 3300050515 | Bacteria | 30610 |
| 704 | Ga0495601_0000862 | 3300053077 | Bacteria | 16539 |
| 705 | Ga0495601_0018854 | 3300053077 | Bacteria | 4203 |
| 706 | Ga0495601_0029688 | 3300053077 | Bacteria | 3393 |
| 707 | Ga0495601_0153551 | 3300053077 | Bacteria | 1503 |
| 708 | Ga0495601_0254334 | 3300053077 | Bacteria | 1147 |
| 709 | Ga0495595_0008449 | 3300053084 | Bacteria | 4225 |
| 710 | Ga0495595_0523631 | 3300053084 | Bacteria | 605 |
| 711 | Ga0495619_0034504 | 3300053085 | Bacteria | 3289 |
| 712 | Ga0495619_0108655 | 3300053085 | Unclassified | 1893 |
| 713 | Ga0501084_0047735 | 3300054114 | Bacteria | 3586 |
| 714 | Ga0501084_0096251 | 3300054114 | Bacteria | 2486 |
| 715 | Ga0501084_0544486 | 3300054114 | Bacteria | 981 |
| 716 | Ga0590075_057417 | 3300059424 | Bacteria | 1002 |
| 717 | Ga0501082_0237309 | 3300060353 | Bacteria | 1587 |
| 718 | Ga0501082_0744156 | 3300060353 | Bacteria | 858 |
| 719 | Ga0530510_0001231 | 3300061734 | Bacteria | 17086 |
| 720 | Ga0530510_0215943 | 3300061734 | Bacteria | 1425 |
| 721 | Ga0530510_0220211 | 3300061734 | Unclassified | 1411 |
| 722 | Ga0530510_1022899 | 3300061734 | Bacteria | 632 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005345 | Ga0070692_10303448 | Ga0070692_103034482 | 130 |
| 2 | 3300005985 | Ga0081539_10000233 | Ga0081539_1000023391 | 147 |
| 3 | 3300005440 | Ga0070705_100234559 | Ga0070705_1002345592 | 148 |
| 4 | 3300005545 | Ga0070695_100004474 | Ga0070695_1000044744 | 148 |
| 5 | 3300006871 | Ga0075434_101813977 | Ga0075434_1018139771 | 148 |
| 6 | 3300050514 | nmdc:mga08x19_138253_c1 | nmdc:mga08x19_138253_c1_1126_1611 | 148 |
| 7 | 3300035086 | Ga0373934_0147300 | Ga0373934_0147300_44_580 | 150 |
| 8 | 3300035111 | Ga0373923_0005638 | Ga0373923_0005638_3119_3655 | 150 |
| 9 | 3300035117 | Ga0373953_0020872 | Ga0373953_0020872_1823_2359 | 150 |
| 10 | 3300035118 | Ga0373954_0013456 | Ga0373954_0013456_1114_1650 | 150 |
| 11 | 3300035119 | Ga0373956_0008076 | Ga0373956_0008076_2078_2614 | 150 |
| 12 | 3300035120 | Ga0373957_0010655 | Ga0373957_0010655_577_1113 | 150 |
| 13 | 3300035120 | Ga0373957_0209768 | Ga0373957_0209768_185_721 | 150 |
| 14 | 3300035172 | Ga0373955_0008526 | Ga0373955_0008526_2482_3018 | 150 |
| 15 | 3300035410 | Ga0373924_0011800 | Ga0373924_0011800_749_1285 | 150 |
| 16 | 3300035692 | Ga0373935_0010129 | Ga0373935_0010129_4999_5535 | 150 |
| 17 | 3300035692 | Ga0373935_0937556 | Ga0373935_0937556_24_560 | 150 |
| 18 | 3300035724 | Ga0373933_0023497 | Ga0373933_0023497_903_1439 | 150 |
| 19 | 3300035724 | Ga0373933_0248342 | Ga0373933_0248342_308_844 | 150 |
| 20 | 3300035725 | Ga0373947_0188465 | Ga0373947_0188465_44_580 | 150 |
| 21 | 3300046454 | Ga0495592_0044598 | Ga0495592_0044598_903_1439 | 150 |
| 22 | 3300046461 | Ga0495641_0010332 | Ga0495641_0010332_3215_3751 | 150 |
| 23 | 3300046475 | Ga0495639_0030059 | Ga0495639_0030059_69_605 | 150 |
| 24 | 3300046476 | Ga0495662_0017552 | Ga0495662_0017552_44_580 | 150 |
| 25 | 3300046499 | Ga0495594_0304706 | Ga0495594_0304706_155_691 | 150 |
| 26 | 3300046511 | Ga0495608_0047424 | Ga0495608_0047424_1768_2304 | 150 |
| 27 | 3300046511 | Ga0495608_0150098 | Ga0495608_0150098_241_777 | 150 |
| 28 | 3300046514 | Ga0495618_0230766 | Ga0495618_0230766_521_1057 | 150 |
| 29 | 3300046516 | Ga0495628_0024530 | Ga0495628_0024530_301_837 | 150 |
| 30 | 3300046517 | Ga0495630_0055939 | Ga0495630_0055939_1205_1741 | 150 |
| 31 | 3300046517 | Ga0495630_0081150 | Ga0495630_0081150_1747_2283 | 150 |
| 32 | 3300046535 | Ga0495586_0176346 | Ga0495586_0176346_575_1111 | 150 |
| 33 | 3300046535 | Ga0495586_0203553 | Ga0495586_0203553_542_1078 | 150 |
| 34 | 3300046536 | Ga0495587_0058727 | Ga0495587_0058727_1684_2220 | 150 |
| 35 | 3300046536 | Ga0495587_0167599 | Ga0495587_0167599_497_1033 | 150 |
| 36 | 3300046559 | Ga0495667_0083269 | Ga0495667_0083269_602_1138 | 150 |
| 37 | 3300046559 | Ga0495667_0118538 | Ga0495667_0118538_1009_1545 | 150 |
| 38 | 3300046559 | Ga0495667_0736911 | Ga0495667_0736911_16_552 | 150 |
| 39 | 3300046642 | Ga0495634_0022467 | Ga0495634_0022467_2162_2698 | 150 |
| 40 | 3300046642 | Ga0495634_0068049 | Ga0495634_0068049_1743_2279 | 150 |
| 41 | 3300046675 | Ga0495657_0014522 | Ga0495657_0014522_1653_2189 | 150 |
| 42 | 3300046678 | Ga0495599_0022846 | Ga0495599_0022846_249_785 | 150 |
| 43 | 3300046681 | Ga0495647_0310225 | Ga0495647_0310225_82_618 | 150 |
| 44 | 3300046683 | Ga0495658_0036547 | Ga0495658_0036547_874_1410 | 150 |
| 45 | 3300046689 | Ga0495613_0024505 | Ga0495613_0024505_1233_1769 | 150 |
| 46 | 3300046690 | Ga0495624_0231645 | Ga0495624_0231645_82_618 | 150 |
| 47 | 3300046809 | Ga0495600_0009220 | Ga0495600_0009220_2114_2650 | 150 |
| 48 | 3300047317 | Ga0495604_0011098 | Ga0495604_0011098_2042_2578 | 150 |
| 49 | 3300047319 | Ga0495674_0080284 | Ga0495674_0080284_1567_2103 | 150 |
| 50 | 3300047319 | Ga0495674_0084033 | Ga0495674_0084033_50_586 | 150 |
| 51 | 3300047322 | Ga0495680_0101042 | Ga0495680_0101042_732_1268 | 150 |
| 52 | 3300047471 | Ga0495684_0025957 | Ga0495684_0025957_2473_3009 | 150 |
| 53 | 3300047471 | Ga0495684_0096567 | Ga0495684_0096567_510_1046 | 150 |
| 54 | 3300047471 | Ga0495684_0700763 | Ga0495684_0700763_93_629 | 150 |
| 55 | 3300048089 | Ga0495614_0164452 | Ga0495614_0164452_184_720 | 150 |
| 56 | 3300053077 | Ga0495601_0153551 | Ga0495601_0153551_601_1137 | 150 |
| 57 | 3300053084 | Ga0495595_0008449 | Ga0495595_0008449_3293_3829 | 150 |
| 58 | 3300053085 | Ga0495619_0034504 | Ga0495619_0034504_912_1448 | 150 |
| 59 | 3300053085 | Ga0495619_0108655 | Ga0495619_0108655_166_702 | 150 |
| 60 | 3300005546 | Ga0070696_100036360 | Ga0070696_1000363604 | 151 |
| 61 | 3300006846 | Ga0075430_100164839 | Ga0075430_1001648392 | 151 |
| 62 | 3300035692 | Ga0373935_0226679 | Ga0373935_0226679_613_1149 | 151 |
| 63 | 3300042435 | Ga0439434_0012556 | Ga0439434_0012556_1012_1578 | 151 |
| 64 | 3300046528 | Ga0495642_0239912 | Ga0495642_0239912_35_574 | 151 |
| 65 | 3300049570 | Ga0501033_0030094 | Ga0501033_0030094_992_1450 | 151 |
| 66 | 3300049574 | Ga0501038_0305991 | Ga0501038_0305991_253_711 | 151 |
| 67 | 3300049575 | Ga0501039_0318257 | Ga0501039_0318257_117_575 | 151 |
| 68 | 3300049576 | Ga0501040_0402107 | Ga0501040_0402107_197_655 | 151 |
| 69 | 3300049577 | Ga0501041_0463001 | Ga0501041_0463001_78_536 | 151 |
| 70 | 3300049580 | Ga0501046_0055514 | Ga0501046_0055514_906_1364 | 151 |
| 71 | 3300049588 | Ga0501072_0126733 | Ga0501072_0126733_879_1337 | 151 |
| 72 | 3300049824 | Ga0501045_0068835 | Ga0501045_0068835_1460_1918 | 151 |
| 73 | 3300050510 | nmdc:mga06r32_395194_c1 | nmdc:mga06r32_395194_c1_86_625 | 151 |
| 74 | 3300050511 | nmdc:mga08y16_429286_c1 | nmdc:mga08y16_429286_c1_110_649 | 151 |
| 75 | 3300061734 | Ga0530510_1022899 | Ga0530510_1022899_54_512 | 151 |
| 76 | 3300005336 | Ga0070680_101115375 | Ga0070680_1011153752 | 153 |
| 77 | 3300025917 | Ga0207660_10914922 | Ga0207660_109149222 | 153 |
| 78 | 3300034957 | Ga0373938_0040440 | Ga0373938_0040440_70_537 | 153 |
| 79 | 3300046473 | Ga0495582_0012388 | Ga0495582_0012388_289_825 | 153 |
| 80 | 3300005545 | Ga0070695_100465393 | Ga0070695_1004653932 | 154 |
| 81 | 3300005546 | Ga0070696_100039245 | Ga0070696_1000392452 | 154 |
| 82 | 3300006844 | Ga0075428_100097885 | Ga0075428_1000978854 | 154 |
| 83 | 3300006846 | Ga0075430_100023346 | Ga0075430_1000233466 | 154 |
| 84 | 3300006846 | Ga0075430_100058324 | Ga0075430_1000583243 | 154 |
| 85 | 3300006847 | Ga0075431_100101199 | Ga0075431_1001011994 | 154 |
| 86 | 3300006871 | Ga0075434_100047891 | Ga0075434_1000478915 | 154 |
| 87 | 3300006880 | Ga0075429_100052460 | Ga0075429_1000524603 | 154 |
| 88 | 3300009147 | Ga0114129_10210929 | Ga0114129_102109292 | 154 |
| 89 | 3300026116 | Ga0207674_10481037 | Ga0207674_104810372 | 154 |
| 90 | 3300027360 | Ga0209969_1021320 | Ga0209969_10213202 | 154 |
| 91 | 3300027378 | Ga0209981_1012236 | Ga0209981_10122362 | 154 |
| 92 | 3300027526 | Ga0209968_1014172 | Ga0209968_10141722 | 154 |
| 93 | 3300032002 | Ga0307416_100450787 | Ga0307416_1004507872 | 154 |
| 94 | 3300035241 | Ga0373961_0053627 | Ga0373961_0053627_557_1036 | 154 |
| 95 | 3300042001 | Ga0439441_028188 | Ga0439441_028188_413_895 | 154 |
| 96 | 3300042436 | Ga0439435_0009299 | Ga0439435_0009299_1448_1984 | 154 |
| 97 | 3300042436 | Ga0439435_0072329 | Ga0439435_0072329_212_694 | 154 |
| 98 | 3300042437 | Ga0439444_0018510 | Ga0439444_0018510_61_597 | 154 |
| 99 | 3300042437 | Ga0439444_0020499 | Ga0439444_0020499_283_765 | 154 |
| 100 | 3300042461 | Ga0439460_0002845 | Ga0439460_0002845_1736_2218 | 154 |
| 101 | 3300042532 | Ga0450893_0010142 | Ga0450893_0010142_138_620 | 154 |
| 102 | 3300046689 | Ga0495613_0031717 | Ga0495613_0031717_1768_2238 | 154 |
| 103 | 3300049576 | Ga0501040_0156972 | Ga0501040_0156972_523_1005 | 154 |
| 104 | 3300049577 | Ga0501041_0330409 | Ga0501041_0330409_359_853 | 154 |
| 105 | 3300050508 | nmdc:mga09592_140748_c1 | nmdc:mga09592_140748_c1_487_1023 | 154 |
| 106 | 3300050509 | nmdc:mga0qj67_27222_c1 | nmdc:mga0qj67_27222_c1_3115_3597 | 154 |
| 107 | 3300050509 | nmdc:mga0qj67_507182_c1 | nmdc:mga0qj67_507182_c1_410_946 | 154 |
| 108 | 3300050510 | nmdc:mga06r32_173746_c1 | nmdc:mga06r32_173746_c1_1522_2058 | 154 |
| 109 | 3300050512 | nmdc:mga0n895_423934_c1 | nmdc:mga0n895_423934_c1_354_824 | 154 |
| 110 | 3300050512 | nmdc:mga0n895_86_c1 | nmdc:mga0n895_86_c1_28062_28529 | 154 |
| 111 | 3300050513 | nmdc:mga0rr50_664_c1 | nmdc:mga0rr50_664_c1_15498_15965 | 154 |
| 112 | 3300050514 | nmdc:mga08x19_557910_c1 | nmdc:mga08x19_557910_c1_332_799 | 154 |
| 113 | 3300061734 | Ga0530510_0220211 | Ga0530510_0220211_193_675 | 154 |
| 114 | 3300005329 | Ga0070683_100103896 | Ga0070683_1001038962 | 155 |
| 115 | 3300005336 | Ga0070680_100118801 | Ga0070680_1001188012 | 155 |
| 116 | 3300005336 | Ga0070680_100132431 | Ga0070680_1001324312 | 155 |
| 117 | 3300005340 | Ga0070689_100097747 | Ga0070689_1000977473 | 155 |
| 118 | 3300005340 | Ga0070689_100701409 | Ga0070689_1007014091 | 155 |
| 119 | 3300005343 | Ga0070687_100232332 | Ga0070687_1002323322 | 155 |
| 120 | 3300005365 | Ga0070688_101090354 | Ga0070688_1010903541 | 155 |
| 121 | 3300005366 | Ga0070659_101147652 | Ga0070659_1011476521 | 155 |
| 122 | 3300005436 | Ga0070713_100195808 | Ga0070713_1001958082 | 155 |
| 123 | 3300005439 | Ga0070711_100422986 | Ga0070711_1004229861 | 155 |
| 124 | 3300005441 | Ga0070700_101036391 | Ga0070700_1010363911 | 155 |
| 125 | 3300005444 | Ga0070694_100102411 | Ga0070694_1001024112 | 155 |
| 126 | 3300005444 | Ga0070694_100240387 | Ga0070694_1002403872 | 155 |
| 127 | 3300005458 | Ga0070681_10035955 | Ga0070681_100359554 | 155 |
| 128 | 3300005459 | Ga0068867_101254362 | Ga0068867_1012543622 | 155 |
| 129 | 3300005518 | Ga0070699_100234972 | Ga0070699_1002349723 | 155 |
| 130 | 3300005530 | Ga0070679_100112749 | Ga0070679_1001127492 | 155 |
| 131 | 3300005530 | Ga0070679_100256385 | Ga0070679_1002563852 | 155 |
| 132 | 3300005535 | Ga0070684_100212309 | Ga0070684_1002123092 | 155 |
| 133 | 3300005544 | Ga0070686_100429094 | Ga0070686_1004290941 | 155 |
| 134 | 3300005544 | Ga0070686_100434628 | Ga0070686_1004346282 | 155 |
| 135 | 3300005544 | Ga0070686_101194839 | Ga0070686_1011948391 | 155 |
| 136 | 3300005546 | Ga0070696_100461964 | Ga0070696_1004619641 | 155 |
| 137 | 3300005549 | Ga0070704_100622522 | Ga0070704_1006225221 | 155 |
| 138 | 3300005618 | Ga0068864_100319590 | Ga0068864_1003195902 | 155 |
| 139 | 3300006237 | Ga0097621_100016034 | Ga0097621_1000160344 | 155 |
| 140 | 3300006358 | Ga0068871_100012220 | Ga0068871_1000122205 | 155 |
| 141 | 3300006844 | Ga0075428_100253105 | Ga0075428_1002531052 | 155 |
| 142 | 3300006844 | Ga0075428_100530864 | Ga0075428_1005308642 | 155 |
| 143 | 3300006871 | Ga0075434_102044309 | Ga0075434_1020443091 | 155 |
| 144 | 3300006914 | Ga0075436_100127289 | Ga0075436_1001272892 | 155 |
| 145 | 3300009094 | Ga0111539_10226278 | Ga0111539_102262783 | 155 |
| 146 | 3300009094 | Ga0111539_11293948 | Ga0111539_112939482 | 155 |
| 147 | 3300009147 | Ga0114129_10298916 | Ga0114129_102989161 | 155 |
| 148 | 3300009147 | Ga0114129_10710863 | Ga0114129_107108632 | 155 |
| 149 | 3300009147 | Ga0114129_10897341 | Ga0114129_108973412 | 155 |
| 150 | 3300009176 | Ga0105242_10258541 | Ga0105242_102585412 | 155 |
| 151 | 3300013297 | Ga0157378_10686009 | Ga0157378_106860092 | 155 |
| 152 | 3300014326 | Ga0157380_10106095 | Ga0157380_101060954 | 155 |
| 153 | 3300014968 | Ga0157379_10978035 | Ga0157379_109780352 | 155 |
| 154 | 3300014969 | Ga0157376_10022959 | Ga0157376_100229592 | 155 |
| 155 | 3300025912 | Ga0207707_10028946 | Ga0207707_100289463 | 155 |
| 156 | 3300025912 | Ga0207707_10476037 | Ga0207707_104760372 | 155 |
| 157 | 3300025917 | Ga0207660_10047673 | Ga0207660_100476733 | 155 |
| 158 | 3300025917 | Ga0207660_10155707 | Ga0207660_101557072 | 155 |
| 159 | 3300025918 | Ga0207662_10039730 | Ga0207662_100397302 | 155 |
| 160 | 3300025921 | Ga0207652_10088081 | Ga0207652_100880812 | 155 |
| 161 | 3300025934 | Ga0207686_11024912 | Ga0207686_110249122 | 155 |
| 162 | 3300025936 | Ga0207670_10594479 | Ga0207670_105944792 | 155 |
| 163 | 3300025942 | Ga0207689_10229664 | Ga0207689_102296643 | 155 |
| 164 | 3300025944 | Ga0207661_10010666 | Ga0207661_100106668 | 155 |
| 165 | 3300026075 | Ga0207708_10076932 | Ga0207708_100769322 | 155 |
| 166 | 3300026089 | Ga0207648_10280594 | Ga0207648_102805942 | 155 |
| 167 | 3300027907 | Ga0207428_10225761 | Ga0207428_102257612 | 155 |
| 168 | 3300031548 | Ga0307408_100009977 | Ga0307408_1000099774 | 155 |
| 169 | 3300031911 | Ga0307412_10623669 | Ga0307412_106236691 | 155 |
| 170 | 3300032002 | Ga0307416_100014510 | Ga0307416_1000145103 | 155 |
| 171 | 3300032002 | Ga0307416_100146913 | Ga0307416_1001469132 | 155 |
| 172 | 3300032005 | Ga0307411_10079222 | Ga0307411_100792221 | 155 |
| 173 | 3300035085 | Ga0373929_0029314 | Ga0373929_0029314_490_963 | 155 |
| 174 | 3300035085 | Ga0373929_0067608 | Ga0373929_0067608_301_783 | 155 |
| 175 | 3300035092 | Ga0373952_0052459 | Ga0373952_0052459_361_843 | 155 |
| 176 | 3300035114 | Ga0373939_0015372 | Ga0373939_0015372_211_693 | 155 |
| 177 | 3300035115 | Ga0373941_0034851 | Ga0373941_0034851_372_854 | 155 |
| 178 | 3300035117 | Ga0373953_0106868 | Ga0373953_0106868_71_544 | 155 |
| 179 | 3300035121 | Ga0373960_0129364 | Ga0373960_0129364_233_706 | 155 |
| 180 | 3300035172 | Ga0373955_0778866 | Ga0373955_0778866_101_574 | 155 |
| 181 | 3300035207 | Ga0373942_0192844 | Ga0373942_0192844_40_513 | 155 |
| 182 | 3300035691 | Ga0373931_0017425 | Ga0373931_0017425_1449_1931 | 155 |
| 183 | 3300035691 | Ga0373931_0099167 | Ga0373931_0099167_49_522 | 155 |
| 184 | 3300036401 | Ga0373937_0092999 | Ga0373937_0092999_1320_1793 | 155 |
| 185 | 3300038996 | Ga0242420_023185 | Ga0242420_023185_173_697 | 155 |
| 186 | 3300041486 | Ga0451807_1028620 | Ga0451807_1028620_590_1063 | 155 |
| 187 | 3300041512 | Ga0451853_4099157 | Ga0451853_4099157_294_770 | 155 |
| 188 | 3300045051 | Ga0451576_0177885 | Ga0451576_0177885_35_508 | 155 |
| 189 | 3300046454 | Ga0495592_0057151 | Ga0495592_0057151_1127_1600 | 155 |
| 190 | 3300046459 | Ga0495629_0476902 | Ga0495629_0476902_328_801 | 155 |
| 191 | 3300046461 | Ga0495641_0058502 | Ga0495641_0058502_514_987 | 155 |
| 192 | 3300046462 | Ga0495651_0376261 | Ga0495651_0376261_84_557 | 155 |
| 193 | 3300046463 | Ga0495653_0190250 | Ga0495653_0190250_154_627 | 155 |
| 194 | 3300046476 | Ga0495662_0005966 | Ga0495662_0005966_4778_5251 | 155 |
| 195 | 3300046476 | Ga0495662_0026785 | Ga0495662_0026785_595_1068 | 155 |
| 196 | 3300046511 | Ga0495608_0072742 | Ga0495608_0072742_779_1252 | 155 |
| 197 | 3300046511 | Ga0495608_0337276 | Ga0495608_0337276_382_855 | 155 |
| 198 | 3300046514 | Ga0495618_0033479 | Ga0495618_0033479_1541_2014 | 155 |
| 199 | 3300046516 | Ga0495628_0200299 | Ga0495628_0200299_35_508 | 155 |
| 200 | 3300046517 | Ga0495630_0032665 | Ga0495630_0032665_2426_2899 | 155 |
| 201 | 3300046523 | Ga0495644_0111494 | Ga0495644_0111494_358_834 | 155 |
| 202 | 3300046525 | Ga0495663_0159817 | Ga0495663_0159817_74_553 | 155 |
| 203 | 3300046526 | Ga0495666_0033095 | Ga0495666_0033095_1044_1517 | 155 |
| 204 | 3300046533 | Ga0495640_0018156 | Ga0495640_0018156_2816_3289 | 155 |
| 205 | 3300046533 | Ga0495640_0044954 | Ga0495640_0044954_1317_1790 | 155 |
| 206 | 3300046535 | Ga0495586_0008518 | Ga0495586_0008518_4207_4680 | 155 |
| 207 | 3300046536 | Ga0495587_0024137 | Ga0495587_0024137_1641_2114 | 155 |
| 208 | 3300046537 | Ga0495598_0054186 | Ga0495598_0054186_192_689 | 155 |
| 209 | 3300046537 | Ga0495598_0132401 | Ga0495598_0132401_370_843 | 155 |
| 210 | 3300046543 | Ga0495645_0078290 | Ga0495645_0078290_1245_1718 | 155 |
| 211 | 3300046559 | Ga0495667_0064884 | Ga0495667_0064884_495_968 | 155 |
| 212 | 3300046642 | Ga0495634_0012351 | Ga0495634_0012351_1807_2280 | 155 |
| 213 | 3300046663 | Ga0495635_0056142 | Ga0495635_0056142_2194_2667 | 155 |
| 214 | 3300046663 | Ga0495635_0182715 | Ga0495635_0182715_659_1132 | 155 |
| 215 | 3300046664 | Ga0495659_0196544 | Ga0495659_0196544_165_662 | 155 |
| 216 | 3300046683 | Ga0495658_0519895 | Ga0495658_0519895_231_704 | 155 |
| 217 | 3300046809 | Ga0495600_0036340 | Ga0495600_0036340_1154_1627 | 155 |
| 218 | 3300047315 | Ga0495581_0683956 | Ga0495581_0683956_20_493 | 155 |
| 219 | 3300047317 | Ga0495604_0015663 | Ga0495604_0015663_2542_3015 | 155 |
| 220 | 3300047318 | Ga0495636_0002166 | Ga0495636_0002166_5722_6195 | 155 |
| 221 | 3300047322 | Ga0495680_0032475 | Ga0495680_0032475_725_1198 | 155 |
| 222 | 3300047322 | Ga0495680_0170505 | Ga0495680_0170505_845_1318 | 155 |
| 223 | 3300047471 | Ga0495684_0320692 | Ga0495684_0320692_463_936 | 155 |
| 224 | 3300049515 | Ga0501292_119558 | Ga0501292_119558_10_486 | 155 |
| 225 | 3300049575 | Ga0501039_0762417 | Ga0501039_0762417_174_644 | 155 |
| 226 | 3300049578 | Ga0501042_0444357 | Ga0501042_0444357_394_864 | 155 |
| 227 | 3300050507 | nmdc:mga05p37_261434_c1 | nmdc:mga05p37_261434_c1_309_785 | 155 |
| 228 | 3300050507 | nmdc:mga05p37_358492_c1 | nmdc:mga05p37_358492_c1_240_713 | 155 |
| 229 | 3300050509 | nmdc:mga0qj67_385230_c1 | nmdc:mga0qj67_385230_c1_44_517 | 155 |
| 230 | 3300050510 | nmdc:mga06r32_1611305_c1 | nmdc:mga06r32_1611305_c1_37_513 | 155 |
| 231 | 3300050511 | nmdc:mga08y16_346845_c1 | nmdc:mga08y16_346845_c1_696_1169 | 155 |
| 232 | 3300050512 | nmdc:mga0n895_4702_c1 | nmdc:mga0n895_4702_c1_5182_5661 | 155 |
| 233 | 3300050512 | nmdc:mga0n895_772692_c1 | nmdc:mga0n895_772692_c1_28_504 | 155 |
| 234 | 3300050513 | nmdc:mga0rr50_390926_c1 | nmdc:mga0rr50_390926_c1_70_564 | 155 |
| 235 | 3300050514 | nmdc:mga08x19_20408_c1 | nmdc:mga08x19_20408_c1_1448_1924 | 155 |
| 236 | 3300053077 | Ga0495601_0029688 | Ga0495601_0029688_1375_1848 | 155 |
| 237 | 3300053084 | Ga0495595_0523631 | Ga0495595_0523631_41_514 | 155 |
| 238 | 3300054114 | Ga0501084_0544486 | Ga0501084_0544486_152_658 | 155 |
| 239 | 3300005435 | Ga0070714_100100787 | Ga0070714_1001007872 | 156 |
| 240 | 3300005437 | Ga0070710_10152865 | Ga0070710_101528652 | 156 |
| 241 | 3300005444 | Ga0070694_100754982 | Ga0070694_1007549822 | 156 |
| 242 | 3300005444 | Ga0070694_100915354 | Ga0070694_1009153542 | 156 |
| 243 | 3300005458 | Ga0070681_10229224 | Ga0070681_102292242 | 156 |
| 244 | 3300005518 | Ga0070699_101002427 | Ga0070699_1010024271 | 156 |
| 245 | 3300005545 | Ga0070695_100226764 | Ga0070695_1002267642 | 156 |
| 246 | 3300005546 | Ga0070696_100218371 | Ga0070696_1002183712 | 156 |
| 247 | 3300005615 | Ga0070702_100595670 | Ga0070702_1005956702 | 156 |
| 248 | 3300005617 | Ga0068859_100345673 | Ga0068859_1003456733 | 156 |
| 249 | 3300005844 | Ga0068862_100132940 | Ga0068862_1001329405 | 156 |
| 250 | 3300005981 | Ga0081538_10125963 | Ga0081538_101259632 | 156 |
| 251 | 3300006173 | Ga0070716_100059116 | Ga0070716_1000591162 | 156 |
| 252 | 3300006237 | Ga0097621_100167247 | Ga0097621_1001672472 | 156 |
| 253 | 3300006844 | Ga0075428_101074348 | Ga0075428_1010743482 | 156 |
| 254 | 3300006846 | Ga0075430_100004392 | Ga0075430_1000043928 | 156 |
| 255 | 3300006846 | Ga0075430_100147024 | Ga0075430_1001470242 | 156 |
| 256 | 3300006847 | Ga0075431_100014374 | Ga0075431_1000143743 | 156 |
| 257 | 3300006852 | Ga0075433_10071751 | Ga0075433_100717513 | 156 |
| 258 | 3300006871 | Ga0075434_100000006 | Ga0075434_1000000069 | 156 |
| 259 | 3300006914 | Ga0075436_100009225 | Ga0075436_1000092252 | 156 |
| 260 | 3300006914 | Ga0075436_100466701 | Ga0075436_1004667012 | 156 |
| 261 | 3300006931 | Ga0097620_100345671 | Ga0097620_1003456712 | 156 |
| 262 | 3300007076 | Ga0075435_100039691 | Ga0075435_1000396915 | 156 |
| 263 | 3300007265 | Ga0099794_10501479 | Ga0099794_105014791 | 156 |
| 264 | 3300009092 | Ga0105250_10375435 | Ga0105250_103754352 | 156 |
| 265 | 3300009094 | Ga0111539_10663354 | Ga0111539_106633542 | 156 |
| 266 | 3300009098 | Ga0105245_10048544 | Ga0105245_100485442 | 156 |
| 267 | 3300009098 | Ga0105245_10536166 | Ga0105245_105361662 | 156 |
| 268 | 3300009098 | Ga0105245_11794603 | Ga0105245_117946032 | 156 |
| 269 | 3300009176 | Ga0105242_10039137 | Ga0105242_100391372 | 156 |
| 270 | 3300009176 | Ga0105242_11735615 | Ga0105242_117356151 | 156 |
| 271 | 3300013307 | Ga0157372_11048349 | Ga0157372_110483491 | 156 |
| 272 | 3300025898 | Ga0207692_10117272 | Ga0207692_101172722 | 156 |
| 273 | 3300025927 | Ga0207687_10027525 | Ga0207687_100275252 | 156 |
| 274 | 3300025929 | Ga0207664_10036885 | Ga0207664_100368852 | 156 |
| 275 | 3300025934 | Ga0207686_10016405 | Ga0207686_100164052 | 156 |
| 276 | 3300025939 | Ga0207665_10081009 | Ga0207665_100810093 | 156 |
| 277 | 3300025941 | Ga0207711_11559720 | Ga0207711_115597201 | 156 |
| 278 | 3300026089 | Ga0207648_10098142 | Ga0207648_100981423 | 156 |
| 279 | 3300026118 | Ga0207675_100776432 | Ga0207675_1007764322 | 156 |
| 280 | 3300027360 | Ga0209969_1003506 | Ga0209969_10035062 | 156 |
| 281 | 3300027364 | Ga0209967_1000357 | Ga0209967_10003578 | 156 |
| 282 | 3300027378 | Ga0209981_1008074 | Ga0209981_10080742 | 156 |
| 283 | 3300027462 | Ga0210000_1000809 | Ga0210000_10008095 | 156 |
| 284 | 3300027471 | Ga0209995_1002187 | Ga0209995_10021873 | 156 |
| 285 | 3300027526 | Ga0209968_1028151 | Ga0209968_10281511 | 156 |
| 286 | 3300027665 | Ga0209983_1007574 | Ga0209983_10075742 | 156 |
| 287 | 3300028380 | Ga0268265_10127613 | Ga0268265_101276135 | 156 |
| 288 | 3300035084 | Ga0373928_0106030 | Ga0373928_0106030_51_527 | 156 |
| 289 | 3300035086 | Ga0373934_0059617 | Ga0373934_0059617_621_1097 | 156 |
| 290 | 3300035117 | Ga0373953_0029634 | Ga0373953_0029634_392_868 | 156 |
| 291 | 3300035118 | Ga0373954_0000020 | Ga0373954_0000020_53642_54118 | 156 |
| 292 | 3300035120 | Ga0373957_0103267 | Ga0373957_0103267_334_810 | 156 |
| 293 | 3300035121 | Ga0373960_0126494 | Ga0373960_0126494_39_611 | 156 |
| 294 | 3300035172 | Ga0373955_0045973 | Ga0373955_0045973_869_1345 | 156 |
| 295 | 3300035241 | Ga0373961_0110463 | Ga0373961_0110463_319_858 | 156 |
| 296 | 3300035410 | Ga0373924_0034126 | Ga0373924_0034126_1007_1483 | 156 |
| 297 | 3300035692 | Ga0373935_0007432 | Ga0373935_0007432_715_1191 | 156 |
| 298 | 3300035695 | Ga0373927_0342917 | Ga0373927_0342917_274_750 | 156 |
| 299 | 3300035724 | Ga0373933_0010314 | Ga0373933_0010314_113_589 | 156 |
| 300 | 3300035724 | Ga0373933_0089132 | Ga0373933_0089132_534_1010 | 156 |
| 301 | 3300036401 | Ga0373937_0005040 | Ga0373937_0005040_6898_7374 | 156 |
| 302 | 3300036401 | Ga0373937_0044614 | Ga0373937_0044614_2002_2478 | 156 |
| 303 | 3300036401 | Ga0373937_0047468 | Ga0373937_0047468_96_572 | 156 |
| 304 | 3300036401 | Ga0373937_0619215 | Ga0373937_0619215_209_685 | 156 |
| 305 | 3300037068 | Ga0373925_0284174 | Ga0373925_0284174_477_953 | 156 |
| 306 | 3300041406 | Ga0439439_0042570 | Ga0439439_0042570_401_877 | 156 |
| 307 | 3300041410 | Ga0439461_0002846 | Ga0439461_0002846_929_1495 | 156 |
| 308 | 3300041413 | Ga0439465_0151432 | Ga0439465_0151432_123_659 | 156 |
| 309 | 3300042015 | Ga0439462_0063660 | Ga0439462_0063660_10_486 | 156 |
| 310 | 3300042156 | Ga0439446_0027521 | Ga0439446_0027521_629_1195 | 156 |
| 311 | 3300042436 | Ga0439435_0026661 | Ga0439435_0026661_44_610 | 156 |
| 312 | 3300042876 | Ga0451577_0810099 | Ga0451577_0810099_245_778 | 156 |
| 313 | 3300044706 | Ga0466964_0040288 | Ga0466964_0040288_32_562 | 156 |
| 314 | 3300044842 | Ga0466957_0047747 | Ga0466957_0047747_1281_1811 | 156 |
| 315 | 3300045976 | Ga0466967_0164773 | Ga0466967_0164773_1248_1778 | 156 |
| 316 | 3300046462 | Ga0495651_0176623 | Ga0495651_0176623_825_1301 | 156 |
| 317 | 3300046511 | Ga0495608_0178831 | Ga0495608_0178831_128_604 | 156 |
| 318 | 3300046516 | Ga0495628_0355832 | Ga0495628_0355832_477_953 | 156 |
| 319 | 3300046528 | Ga0495642_0031610 | Ga0495642_0031610_658_1179 | 156 |
| 320 | 3300046529 | Ga0495652_0146302 | Ga0495652_0146302_592_1068 | 156 |
| 321 | 3300046529 | Ga0495652_0298567 | Ga0495652_0298567_182_658 | 156 |
| 322 | 3300046664 | Ga0495659_0125174 | Ga0495659_0125174_269_790 | 156 |
| 323 | 3300046675 | Ga0495657_0116727 | Ga0495657_0116727_115_591 | 156 |
| 324 | 3300046675 | Ga0495657_0180204 | Ga0495657_0180204_619_1095 | 156 |
| 325 | 3300046680 | Ga0495646_0156587 | Ga0495646_0156587_686_1162 | 156 |
| 326 | 3300046684 | Ga0495669_0033260 | Ga0495669_0033260_579_1100 | 156 |
| 327 | 3300047322 | Ga0495680_0056542 | Ga0495680_0056542_1237_1713 | 156 |
| 328 | 3300049589 | Ga0501073_0155271 | Ga0501073_0155271_248_724 | 156 |
| 329 | 3300049589 | Ga0501073_0284449 | Ga0501073_0284449_42_518 | 156 |
| 330 | 3300049591 | Ga0501075_0166662 | Ga0501075_0166662_846_1352 | 156 |
| 331 | 3300049593 | Ga0501077_0213297 | Ga0501077_0213297_58_537 | 156 |
| 332 | 3300050509 | nmdc:mga0qj67_137754_c1 | nmdc:mga0qj67_137754_c1_967_1443 | 156 |
| 333 | 3300050509 | nmdc:mga0qj67_2700_c1 | nmdc:mga0qj67_2700_c1_8939_9415 | 156 |
| 334 | 3300050510 | nmdc:mga06r32_16323_c1 | nmdc:mga06r32_16323_c1_1572_2048 | 156 |
| 335 | 3300050514 | nmdc:mga08x19_11713_c1 | nmdc:mga08x19_11713_c1_276_809 | 156 |
| 336 | 3300050515 | nmdc:mga0a205_31489_c1 | nmdc:mga0a205_31489_c1_4284_4760 | 156 |
| 337 | 3300060353 | Ga0501082_0744156 | Ga0501082_0744156_268_744 | 156 |
| 338 | 3300005295 | Ga0065707_10020436 | Ga0065707_100204362 | 157 |
| 339 | 3300005295 | Ga0065707_10104294 | Ga0065707_101042943 | 157 |
| 340 | 3300005328 | Ga0070676_10060495 | Ga0070676_100604954 | 157 |
| 341 | 3300005329 | Ga0070683_101282509 | Ga0070683_1012825092 | 157 |
| 342 | 3300005330 | Ga0070690_100000398 | Ga0070690_1000003984 | 157 |
| 343 | 3300005330 | Ga0070690_100138389 | Ga0070690_1001383892 | 157 |
| 344 | 3300005334 | Ga0068869_100001796 | Ga0068869_1000017968 | 157 |
| 345 | 3300005334 | Ga0068869_100034494 | Ga0068869_1000344944 | 157 |
| 346 | 3300005336 | Ga0070680_100001167 | Ga0070680_10000116713 | 157 |
| 347 | 3300005336 | Ga0070680_100098560 | Ga0070680_1000985602 | 157 |
| 348 | 3300005337 | Ga0070682_100001096 | Ga0070682_1000010964 | 157 |
| 349 | 3300005338 | Ga0068868_100005562 | Ga0068868_1000055628 | 157 |
| 350 | 3300005340 | Ga0070689_100000188 | Ga0070689_10000018831 | 157 |
| 351 | 3300005340 | Ga0070689_100024102 | Ga0070689_1000241024 | 157 |
| 352 | 3300005340 | Ga0070689_100109570 | Ga0070689_1001095702 | 157 |
| 353 | 3300005341 | Ga0070691_10022630 | Ga0070691_100226304 | 157 |
| 354 | 3300005343 | Ga0070687_100000069 | Ga0070687_10000006925 | 157 |
| 355 | 3300005345 | Ga0070692_10010076 | Ga0070692_100100769 | 157 |
| 356 | 3300005347 | Ga0070668_100022871 | Ga0070668_1000228719 | 157 |
| 357 | 3300005353 | Ga0070669_100013309 | Ga0070669_1000133092 | 157 |
| 358 | 3300005353 | Ga0070669_100364818 | Ga0070669_1003648182 | 157 |
| 359 | 3300005354 | Ga0070675_100230481 | Ga0070675_1002304813 | 157 |
| 360 | 3300005355 | Ga0070671_100579148 | Ga0070671_1005791481 | 157 |
| 361 | 3300005364 | Ga0070673_100269484 | Ga0070673_1002694842 | 157 |
| 362 | 3300005364 | Ga0070673_100461768 | Ga0070673_1004617681 | 157 |
| 363 | 3300005365 | Ga0070688_100146232 | Ga0070688_1001462322 | 157 |
| 364 | 3300005365 | Ga0070688_100214206 | Ga0070688_1002142062 | 157 |
| 365 | 3300005367 | Ga0070667_100761048 | Ga0070667_1007610482 | 157 |
| 366 | 3300005406 | Ga0070703_10083362 | Ga0070703_100833622 | 157 |
| 367 | 3300005438 | Ga0070701_10000603 | Ga0070701_100006034 | 157 |
| 368 | 3300005440 | Ga0070705_100001149 | Ga0070705_1000011495 | 157 |
| 369 | 3300005440 | Ga0070705_100010469 | Ga0070705_1000104691 | 157 |
| 370 | 3300005440 | Ga0070705_100024627 | Ga0070705_1000246273 | 157 |
| 371 | 3300005440 | Ga0070705_100168798 | Ga0070705_1001687982 | 157 |
| 372 | 3300005441 | Ga0070700_100008466 | Ga0070700_1000084666 | 157 |
| 373 | 3300005441 | Ga0070700_100023110 | Ga0070700_1000231107 | 157 |
| 374 | 3300005444 | Ga0070694_100001966 | Ga0070694_1000019669 | 157 |
| 375 | 3300005444 | Ga0070694_100038605 | Ga0070694_1000386052 | 157 |
| 376 | 3300005444 | Ga0070694_100154825 | Ga0070694_1001548252 | 157 |
| 377 | 3300005444 | Ga0070694_100319385 | Ga0070694_1003193852 | 157 |
| 378 | 3300005444 | Ga0070694_100519864 | Ga0070694_1005198642 | 157 |
| 379 | 3300005445 | Ga0070708_100623349 | Ga0070708_1006233492 | 157 |
| 380 | 3300005458 | Ga0070681_10120479 | Ga0070681_101204793 | 157 |
| 381 | 3300005459 | Ga0068867_100000296 | Ga0068867_10000029617 | 157 |
| 382 | 3300005459 | Ga0068867_100011080 | Ga0068867_1000110807 | 157 |
| 383 | 3300005459 | Ga0068867_100899274 | Ga0068867_1008992741 | 157 |
| 384 | 3300005467 | Ga0070706_100768166 | Ga0070706_1007681662 | 157 |
| 385 | 3300005467 | Ga0070706_101373514 | Ga0070706_1013735141 | 157 |
| 386 | 3300005468 | Ga0070707_100573127 | Ga0070707_1005731272 | 157 |
| 387 | 3300005471 | Ga0070698_100052274 | Ga0070698_1000522742 | 157 |
| 388 | 3300005471 | Ga0070698_100092149 | Ga0070698_1000921494 | 157 |
| 389 | 3300005471 | Ga0070698_100490415 | Ga0070698_1004904152 | 157 |
| 390 | 3300005518 | Ga0070699_100100337 | Ga0070699_1001003372 | 157 |
| 391 | 3300005518 | Ga0070699_100690030 | Ga0070699_1006900302 | 157 |
| 392 | 3300005530 | Ga0070679_100003737 | Ga0070679_10000373716 | 157 |
| 393 | 3300005536 | Ga0070697_100009252 | Ga0070697_1000092529 | 157 |
| 394 | 3300005536 | Ga0070697_100396270 | Ga0070697_1003962702 | 157 |
| 395 | 3300005539 | Ga0068853_100072412 | Ga0068853_1000724122 | 157 |
| 396 | 3300005543 | Ga0070672_101561865 | Ga0070672_1015618651 | 157 |
| 397 | 3300005544 | Ga0070686_100000090 | Ga0070686_10000009042 | 157 |
| 398 | 3300005544 | Ga0070686_100267793 | Ga0070686_1002677932 | 157 |
| 399 | 3300005544 | Ga0070686_100358380 | Ga0070686_1003583802 | 157 |
| 400 | 3300005545 | Ga0070695_100000188 | Ga0070695_1000001888 | 157 |
| 401 | 3300005545 | Ga0070695_100022517 | Ga0070695_1000225175 | 157 |
| 402 | 3300005545 | Ga0070695_100119152 | Ga0070695_1001191522 | 157 |
| 403 | 3300005545 | Ga0070695_100443880 | Ga0070695_1004438801 | 157 |
| 404 | 3300005546 | Ga0070696_100000719 | Ga0070696_10000071912 | 157 |
| 405 | 3300005546 | Ga0070696_100002632 | Ga0070696_1000026329 | 157 |
| 406 | 3300005547 | Ga0070693_100000525 | Ga0070693_10000052513 | 157 |
| 407 | 3300005549 | Ga0070704_100000168 | Ga0070704_1000001689 | 157 |
| 408 | 3300005549 | Ga0070704_100000545 | Ga0070704_10000054518 | 157 |
| 409 | 3300005549 | Ga0070704_100006984 | Ga0070704_10000698410 | 157 |
| 410 | 3300005549 | Ga0070704_100037205 | Ga0070704_1000372052 | 157 |
| 411 | 3300005549 | Ga0070704_100099034 | Ga0070704_1000990342 | 157 |
| 412 | 3300005549 | Ga0070704_100466991 | Ga0070704_1004669912 | 157 |
| 413 | 3300005549 | Ga0070704_101053583 | Ga0070704_1010535832 | 157 |
| 414 | 3300005563 | Ga0068855_100000833 | Ga0068855_10000083328 | 157 |
| 415 | 3300005578 | Ga0068854_100000657 | Ga0068854_10000065710 | 157 |
| 416 | 3300005578 | Ga0068854_100764757 | Ga0068854_1007647572 | 157 |
| 417 | 3300005614 | Ga0068856_100003103 | Ga0068856_10000310312 | 157 |
| 418 | 3300005615 | Ga0070702_100000002 | Ga0070702_10000000217 | 157 |
| 419 | 3300005615 | Ga0070702_100004543 | Ga0070702_1000045432 | 157 |
| 420 | 3300005616 | Ga0068852_100439119 | Ga0068852_1004391192 | 157 |
| 421 | 3300005617 | Ga0068859_100000195 | Ga0068859_10000019513 | 157 |
| 422 | 3300005617 | Ga0068859_100115984 | Ga0068859_1001159843 | 157 |
| 423 | 3300005617 | Ga0068859_100719125 | Ga0068859_1007191251 | 157 |
| 424 | 3300005618 | Ga0068864_100666633 | Ga0068864_1006666332 | 157 |
| 425 | 3300005718 | Ga0068866_10002071 | Ga0068866_100020718 | 157 |
| 426 | 3300005718 | Ga0068866_10089292 | Ga0068866_100892923 | 157 |
| 427 | 3300005719 | Ga0068861_100000043 | Ga0068861_10000004353 | 157 |
| 428 | 3300005719 | Ga0068861_100062821 | Ga0068861_1000628212 | 157 |
| 429 | 3300005842 | Ga0068858_100005138 | Ga0068858_10000513813 | 157 |
| 430 | 3300005842 | Ga0068858_100199292 | Ga0068858_1001992922 | 157 |
| 431 | 3300005843 | Ga0068860_100002559 | Ga0068860_10000255911 | 157 |
| 432 | 3300005843 | Ga0068860_100083022 | Ga0068860_1000830222 | 157 |
| 433 | 3300005844 | Ga0068862_100002188 | Ga0068862_10000218815 | 157 |
| 434 | 3300005844 | Ga0068862_100070855 | Ga0068862_1000708552 | 157 |
| 435 | 3300005844 | Ga0068862_101635017 | Ga0068862_1016350172 | 157 |
| 436 | 3300006163 | Ga0070715_10050628 | Ga0070715_100506283 | 157 |
| 437 | 3300006173 | Ga0070716_100007311 | Ga0070716_1000073112 | 157 |
| 438 | 3300006237 | Ga0097621_100000045 | Ga0097621_10000004563 | 157 |
| 439 | 3300006237 | Ga0097621_100350612 | Ga0097621_1003506122 | 157 |
| 440 | 3300006358 | Ga0068871_100000040 | Ga0068871_10000004023 | 157 |
| 441 | 3300006844 | Ga0075428_100000047 | Ga0075428_10000004710 | 157 |
| 442 | 3300006844 | Ga0075428_100043245 | Ga0075428_1000432454 | 157 |
| 443 | 3300006844 | Ga0075428_100050115 | Ga0075428_1000501153 | 157 |
| 444 | 3300006846 | Ga0075430_100018834 | Ga0075430_1000188346 | 157 |
| 445 | 3300006847 | Ga0075431_100120534 | Ga0075431_1001205343 | 157 |
| 446 | 3300006847 | Ga0075431_100237297 | Ga0075431_1002372972 | 157 |
| 447 | 3300006852 | Ga0075433_10000605 | Ga0075433_100006054 | 157 |
| 448 | 3300006871 | Ga0075434_100000554 | Ga0075434_10000055424 | 157 |
| 449 | 3300006871 | Ga0075434_101456026 | Ga0075434_1014560262 | 157 |
| 450 | 3300006880 | Ga0075429_100000008 | Ga0075429_10000000814 | 157 |
| 451 | 3300006880 | Ga0075429_100000067 | Ga0075429_10000006730 | 157 |
| 452 | 3300006880 | Ga0075429_100177709 | Ga0075429_1001777092 | 157 |
| 453 | 3300006880 | Ga0075429_100298831 | Ga0075429_1002988313 | 157 |
| 454 | 3300006880 | Ga0075429_101293697 | Ga0075429_1012936971 | 157 |
| 455 | 3300006881 | Ga0068865_100001956 | Ga0068865_1000019568 | 157 |
| 456 | 3300006914 | Ga0075436_100000174 | Ga0075436_1000001742 | 157 |
| 457 | 3300006914 | Ga0075436_100001082 | Ga0075436_10000108217 | 157 |
| 458 | 3300006914 | Ga0075436_100022044 | Ga0075436_1000220445 | 157 |
| 459 | 3300006914 | Ga0075436_100072304 | Ga0075436_1000723043 | 157 |
| 460 | 3300006914 | Ga0075436_100090296 | Ga0075436_1000902962 | 157 |
| 461 | 3300006914 | Ga0075436_100349398 | Ga0075436_1003493982 | 157 |
| 462 | 3300006931 | Ga0097620_100000195 | Ga0097620_10000019554 | 157 |
| 463 | 3300006931 | Ga0097620_100115982 | Ga0097620_1001159823 | 157 |
| 464 | 3300006931 | Ga0097620_100719110 | Ga0097620_1007191103 | 157 |
| 465 | 3300007076 | Ga0075435_100020896 | Ga0075435_1000208962 | 157 |
| 466 | 3300007076 | Ga0075435_100058248 | Ga0075435_1000582483 | 157 |
| 467 | 3300007076 | Ga0075435_100433430 | Ga0075435_1004334302 | 157 |
| 468 | 3300009092 | Ga0105250_10073498 | Ga0105250_100734982 | 157 |
| 469 | 3300009094 | Ga0111539_10219068 | Ga0111539_102190683 | 157 |
| 470 | 3300009094 | Ga0111539_11002257 | Ga0111539_110022572 | 157 |
| 471 | 3300009094 | Ga0111539_11198955 | Ga0111539_111989552 | 157 |
| 472 | 3300009098 | Ga0105245_10000306 | Ga0105245_1000030648 | 157 |
| 473 | 3300009147 | Ga0114129_10000040 | Ga0114129_1000004054 | 157 |
| 474 | 3300009147 | Ga0114129_10021807 | Ga0114129_100218079 | 157 |
| 475 | 3300009147 | Ga0114129_10981008 | Ga0114129_109810082 | 157 |
| 476 | 3300009147 | Ga0114129_12239374 | Ga0114129_122393742 | 157 |
| 477 | 3300009148 | Ga0105243_10000035 | Ga0105243_10000035141 | 157 |
| 478 | 3300009148 | Ga0105243_10002936 | Ga0105243_1000293610 | 157 |
| 479 | 3300009174 | Ga0105241_10070539 | Ga0105241_100705394 | 157 |
| 480 | 3300009176 | Ga0105242_10004996 | Ga0105242_1000499610 | 157 |
| 481 | 3300009553 | Ga0105249_10007943 | Ga0105249_1000794310 | 157 |
| 482 | 3300009553 | Ga0105249_10055112 | Ga0105249_100551123 | 157 |
| 483 | 3300009553 | Ga0105249_10189440 | Ga0105249_101894404 | 157 |
| 484 | 3300010375 | Ga0105239_10048386 | Ga0105239_100483865 | 157 |
| 485 | 3300012510 | Ga0157316_1019378 | Ga0157316_10193781 | 157 |
| 486 | 3300013297 | Ga0157378_10001996 | Ga0157378_1000199615 | 157 |
| 487 | 3300013306 | Ga0163162_10347688 | Ga0163162_103476882 | 157 |
| 488 | 3300013307 | Ga0157372_11047746 | Ga0157372_110477462 | 157 |
| 489 | 3300013308 | Ga0157375_10133322 | Ga0157375_101333223 | 157 |
| 490 | 3300013308 | Ga0157375_10546244 | Ga0157375_105462442 | 157 |
| 491 | 3300014326 | Ga0157380_10018970 | Ga0157380_100189705 | 157 |
| 492 | 3300014326 | Ga0157380_10154190 | Ga0157380_101541902 | 157 |
| 493 | 3300014326 | Ga0157380_11415728 | Ga0157380_114157281 | 157 |
| 494 | 3300014745 | Ga0157377_10049229 | Ga0157377_100492292 | 157 |
| 495 | 3300014745 | Ga0157377_10286936 | Ga0157377_102869362 | 157 |
| 496 | 3300014969 | Ga0157376_10000403 | Ga0157376_1000040316 | 157 |
| 497 | 3300017792 | Ga0163161_10225180 | Ga0163161_102251803 | 157 |
| 498 | 3300025899 | Ga0207642_10003118 | Ga0207642_100031183 | 157 |
| 499 | 3300025899 | Ga0207642_10052050 | Ga0207642_100520504 | 157 |
| 500 | 3300025905 | Ga0207685_10260991 | Ga0207685_102609912 | 157 |
| 501 | 3300025907 | Ga0207645_10414579 | Ga0207645_104145792 | 157 |
| 502 | 3300025908 | Ga0207643_10044298 | Ga0207643_100442982 | 157 |
| 503 | 3300025908 | Ga0207643_10084606 | Ga0207643_100846062 | 157 |
| 504 | 3300025910 | Ga0207684_10682965 | Ga0207684_106829652 | 157 |
| 505 | 3300025911 | Ga0207654_10034497 | Ga0207654_100344972 | 157 |
| 506 | 3300025912 | Ga0207707_10048467 | Ga0207707_100484672 | 157 |
| 507 | 3300025915 | Ga0207693_10462161 | Ga0207693_104621612 | 157 |
| 508 | 3300025916 | Ga0207663_10133508 | Ga0207663_101335082 | 157 |
| 509 | 3300025917 | Ga0207660_10006506 | Ga0207660_100065067 | 157 |
| 510 | 3300025917 | Ga0207660_10088771 | Ga0207660_100887713 | 157 |
| 511 | 3300025918 | Ga0207662_10000006 | Ga0207662_1000000693 | 157 |
| 512 | 3300025922 | Ga0207646_10280400 | Ga0207646_102804002 | 157 |
| 513 | 3300025923 | Ga0207681_10025231 | Ga0207681_100252316 | 157 |
| 514 | 3300025927 | Ga0207687_10003249 | Ga0207687_100032497 | 157 |
| 515 | 3300025931 | Ga0207644_10540261 | Ga0207644_105402611 | 157 |
| 516 | 3300025934 | Ga0207686_10003499 | Ga0207686_100034998 | 157 |
| 517 | 3300025935 | Ga0207709_10007469 | Ga0207709_100074697 | 157 |
| 518 | 3300025935 | Ga0207709_10015032 | Ga0207709_100150324 | 157 |
| 519 | 3300025936 | Ga0207670_10001617 | Ga0207670_100016178 | 157 |
| 520 | 3300025936 | Ga0207670_10020433 | Ga0207670_100204334 | 157 |
| 521 | 3300025936 | Ga0207670_10117777 | Ga0207670_101177772 | 157 |
| 522 | 3300025937 | Ga0207669_10021023 | Ga0207669_100210232 | 157 |
| 523 | 3300025939 | Ga0207665_10007350 | Ga0207665_100073506 | 157 |
| 524 | 3300025939 | Ga0207665_10663647 | Ga0207665_106636471 | 157 |
| 525 | 3300025941 | Ga0207711_10530941 | Ga0207711_105309412 | 157 |
| 526 | 3300025942 | Ga0207689_10000082 | Ga0207689_1000008213 | 157 |
| 527 | 3300025942 | Ga0207689_10010692 | Ga0207689_100106928 | 157 |
| 528 | 3300025942 | Ga0207689_10097302 | Ga0207689_100973023 | 157 |
| 529 | 3300025949 | Ga0207667_10012981 | Ga0207667_1001298110 | 157 |
| 530 | 3300025960 | Ga0207651_10048965 | Ga0207651_100489654 | 157 |
| 531 | 3300025961 | Ga0207712_10033486 | Ga0207712_100334862 | 157 |
| 532 | 3300025961 | Ga0207712_10096830 | Ga0207712_100968302 | 157 |
| 533 | 3300025981 | Ga0207640_10001404 | Ga0207640_100014044 | 157 |
| 534 | 3300026023 | Ga0207677_10005887 | Ga0207677_100058872 | 157 |
| 535 | 3300026035 | Ga0207703_10017112 | Ga0207703_100171123 | 157 |
| 536 | 3300026035 | Ga0207703_11678154 | Ga0207703_116781541 | 157 |
| 537 | 3300026041 | Ga0207639_10203879 | Ga0207639_102038792 | 157 |
| 538 | 3300026075 | Ga0207708_10000936 | Ga0207708_1000093614 | 157 |
| 539 | 3300026075 | Ga0207708_10005903 | Ga0207708_1000590312 | 157 |
| 540 | 3300026078 | Ga0207702_10014977 | Ga0207702_100149773 | 157 |
| 541 | 3300026089 | Ga0207648_10000316 | Ga0207648_100003168 | 157 |
| 542 | 3300026089 | Ga0207648_10012170 | Ga0207648_1001217012 | 157 |
| 543 | 3300026089 | Ga0207648_10414948 | Ga0207648_104149482 | 157 |
| 544 | 3300026095 | Ga0207676_10036639 | Ga0207676_100366392 | 157 |
| 545 | 3300026095 | Ga0207676_11050539 | Ga0207676_110505391 | 157 |
| 546 | 3300026118 | Ga0207675_100000064 | Ga0207675_10000006472 | 157 |
| 547 | 3300026118 | Ga0207675_100020995 | Ga0207675_1000209952 | 157 |
| 548 | 3300027360 | Ga0209969_1019015 | Ga0209969_10190152 | 157 |
| 549 | 3300027462 | Ga0210000_1010309 | Ga0210000_10103092 | 157 |
| 550 | 3300027462 | Ga0210000_1015146 | Ga0210000_10151462 | 157 |
| 551 | 3300027526 | Ga0209968_1009734 | Ga0209968_10097341 | 157 |
| 552 | 3300027671 | Ga0209588_1019685 | Ga0209588_10196853 | 157 |
| 553 | 3300027671 | Ga0209588_1173135 | Ga0209588_11731352 | 157 |
| 554 | 3300027695 | Ga0209966_1046734 | Ga0209966_10467342 | 157 |
| 555 | 3300027695 | Ga0209966_1100938 | Ga0209966_11009381 | 157 |
| 556 | 3300027717 | Ga0209998_10004757 | Ga0209998_100047573 | 157 |
| 557 | 3300027907 | Ga0207428_10006021 | Ga0207428_100060212 | 157 |
| 558 | 3300027907 | Ga0207428_10323740 | Ga0207428_103237402 | 157 |
| 559 | 3300027907 | Ga0207428_11007083 | Ga0207428_110070832 | 157 |
| 560 | 3300028380 | Ga0268265_10006971 | Ga0268265_100069713 | 157 |
| 561 | 3300028380 | Ga0268265_10014708 | Ga0268265_100147087 | 157 |
| 562 | 3300028381 | Ga0268264_10001394 | Ga0268264_100013945 | 157 |
| 563 | 3300028381 | Ga0268264_10112410 | Ga0268264_101124102 | 157 |
| 564 | 3300031548 | Ga0307408_100197104 | Ga0307408_1001971041 | 157 |
| 565 | 3300031548 | Ga0307408_100899559 | Ga0307408_1008995591 | 157 |
| 566 | 3300031548 | Ga0307408_101239381 | Ga0307408_1012393812 | 157 |
| 567 | 3300031548 | Ga0307408_101396030 | Ga0307408_1013960301 | 157 |
| 568 | 3300032002 | Ga0307416_100701589 | Ga0307416_1007015893 | 157 |
| 569 | 3300032005 | Ga0307411_10277041 | Ga0307411_102770413 | 157 |
| 570 | 3300032005 | Ga0307411_10531564 | Ga0307411_105315642 | 157 |
| 571 | 3300034817 | Ga0373948_0018888 | Ga0373948_0018888_340_813 | 157 |
| 572 | 3300034820 | Ga0373959_0011584 | Ga0373959_0011584_13_486 | 157 |
| 573 | 3300034957 | Ga0373938_0134466 | Ga0373938_0134466_113_586 | 157 |
| 574 | 3300035083 | Ga0373926_0001625 | Ga0373926_0001625_5644_6120 | 157 |
| 575 | 3300035084 | Ga0373928_0048764 | Ga0373928_0048764_298_771 | 157 |
| 576 | 3300035086 | Ga0373934_0000505 | Ga0373934_0000505_11798_12361 | 157 |
| 577 | 3300035088 | Ga0373940_0001144 | Ga0373940_0001144_2293_2766 | 157 |
| 578 | 3300035089 | Ga0373944_0001341 | Ga0373944_0001341_4188_4664 | 157 |
| 579 | 3300035090 | Ga0373949_0047640 | Ga0373949_0047640_308_781 | 157 |
| 580 | 3300035091 | Ga0373951_0009424 | Ga0373951_0009424_231_704 | 157 |
| 581 | 3300035111 | Ga0373923_0359759 | Ga0373923_0359759_38_598 | 157 |
| 582 | 3300035113 | Ga0373936_0063265 | Ga0373936_0063265_1021_1494 | 157 |
| 583 | 3300035114 | Ga0373939_0004598 | Ga0373939_0004598_2244_2717 | 157 |
| 584 | 3300035114 | Ga0373939_0004651 | Ga0373939_0004651_2389_2862 | 157 |
| 585 | 3300035116 | Ga0373945_0009215 | Ga0373945_0009215_1261_1737 | 157 |
| 586 | 3300035118 | Ga0373954_0000592 | Ga0373954_0000592_3025_3585 | 157 |
| 587 | 3300035118 | Ga0373954_0152396 | Ga0373954_0152396_37_600 | 157 |
| 588 | 3300035119 | Ga0373956_0000714 | Ga0373956_0000714_1493_2056 | 157 |
| 589 | 3300035121 | Ga0373960_0096245 | Ga0373960_0096245_332_805 | 157 |
| 590 | 3300035121 | Ga0373960_0096662 | Ga0373960_0096662_85_642 | 157 |
| 591 | 3300035171 | Ga0373946_0005400 | Ga0373946_0005400_1348_1824 | 157 |
| 592 | 3300035172 | Ga0373955_0020377 | Ga0373955_0020377_208_771 | 157 |
| 593 | 3300035207 | Ga0373942_0019335 | Ga0373942_0019335_790_1263 | 157 |
| 594 | 3300035207 | Ga0373942_0104127 | Ga0373942_0104127_297_839 | 157 |
| 595 | 3300035241 | Ga0373961_0013206 | Ga0373961_0013206_495_968 | 157 |
| 596 | 3300035242 | Ga0373962_0023028 | Ga0373962_0023028_363_836 | 157 |
| 597 | 3300035691 | Ga0373931_0003341 | Ga0373931_0003341_2110_2583 | 157 |
| 598 | 3300035691 | Ga0373931_0069470 | Ga0373931_0069470_734_1207 | 157 |
| 599 | 3300035691 | Ga0373931_0145086 | Ga0373931_0145086_697_1173 | 157 |
| 600 | 3300035691 | Ga0373931_0430763 | Ga0373931_0430763_60_617 | 157 |
| 601 | 3300035692 | Ga0373935_0164435 | Ga0373935_0164435_192_668 | 157 |
| 602 | 3300035695 | Ga0373927_0028362 | Ga0373927_0028362_1925_2401 | 157 |
| 603 | 3300035724 | Ga0373933_0001085 | Ga0373933_0001085_1444_2007 | 157 |
| 604 | 3300035725 | Ga0373947_0303141 | Ga0373947_0303141_569_1045 | 157 |
| 605 | 3300036401 | Ga0373937_0011050 | Ga0373937_0011050_7329_7892 | 157 |
| 606 | 3300042001 | Ga0439441_016881 | Ga0439441_016881_292_777 | 157 |
| 607 | 3300042435 | Ga0439434_0029512 | Ga0439434_0029512_482_967 | 157 |
| 608 | 3300042436 | Ga0439435_0109451 | Ga0439435_0109451_83_622 | 157 |
| 609 | 3300042876 | Ga0451577_1191818 | Ga0451577_1191818_179_652 | 157 |
| 610 | 3300044712 | Ga0453684_0364527 | Ga0453684_0364527_1028_1501 | 157 |
| 611 | 3300044901 | Ga0466960_0074678 | Ga0466960_0074678_84_644 | 157 |
| 612 | 3300045051 | Ga0451576_0000822 | Ga0451576_0000822_29331_29804 | 157 |
| 613 | 3300045051 | Ga0451576_0022841 | Ga0451576_0022841_2188_2661 | 157 |
| 614 | 3300045051 | Ga0451576_0029853 | Ga0451576_0029853_2713_3186 | 157 |
| 615 | 3300045051 | Ga0451576_0098737 | Ga0451576_0098737_367_852 | 157 |
| 616 | 3300045051 | Ga0451576_0520242 | Ga0451576_0520242_650_1126 | 157 |
| 617 | 3300046454 | Ga0495592_0000293 | Ga0495592_0000293_27297_27833 | 157 |
| 618 | 3300046454 | Ga0495592_0136588 | Ga0495592_0136588_1028_1588 | 157 |
| 619 | 3300046455 | Ga0495603_0046469 | Ga0495603_0046469_1873_2349 | 157 |
| 620 | 3300046462 | Ga0495651_0011710 | Ga0495651_0011710_141_686 | 157 |
| 621 | 3300046472 | Ga0495580_0087444 | Ga0495580_0087444_1509_1985 | 157 |
| 622 | 3300046475 | Ga0495639_0005058 | Ga0495639_0005058_3990_4466 | 157 |
| 623 | 3300046516 | Ga0495628_0017983 | Ga0495628_0017983_2696_3232 | 157 |
| 624 | 3300046516 | Ga0495628_0080332 | Ga0495628_0080332_754_1314 | 157 |
| 625 | 3300046516 | Ga0495628_0251110 | Ga0495628_0251110_513_1049 | 157 |
| 626 | 3300046526 | Ga0495666_0176120 | Ga0495666_0176120_390_866 | 157 |
| 627 | 3300046529 | Ga0495652_0086237 | Ga0495652_0086237_1947_2483 | 157 |
| 628 | 3300046531 | Ga0495665_0085235 | Ga0495665_0085235_148_624 | 157 |
| 629 | 3300046533 | Ga0495640_0242237 | Ga0495640_0242237_553_1089 | 157 |
| 630 | 3300046538 | Ga0495609_0108116 | Ga0495609_0108116_648_1187 | 157 |
| 631 | 3300046539 | Ga0495621_0060974 | Ga0495621_0060974_753_1292 | 157 |
| 632 | 3300046539 | Ga0495621_0074683 | Ga0495621_0074683_260_745 | 157 |
| 633 | 3300046543 | Ga0495645_0000344 | Ga0495645_0000344_30776_31312 | 157 |
| 634 | 3300046559 | Ga0495667_0018506 | Ga0495667_0018506_3879_4439 | 157 |
| 635 | 3300046674 | Ga0495588_0060033 | Ga0495588_0060033_1037_1513 | 157 |
| 636 | 3300046675 | Ga0495657_0159295 | Ga0495657_0159295_55_618 | 157 |
| 637 | 3300046678 | Ga0495599_0000231 | Ga0495599_0000231_30760_31296 | 157 |
| 638 | 3300046681 | Ga0495647_0004648 | Ga0495647_0004648_2747_3223 | 157 |
| 639 | 3300046683 | Ga0495658_0015526 | Ga0495658_0015526_406_882 | 157 |
| 640 | 3300047315 | Ga0495581_0123335 | Ga0495581_0123335_50_526 | 157 |
| 641 | 3300047321 | Ga0495676_0211726 | Ga0495676_0211726_639_1115 | 157 |
| 642 | 3300047322 | Ga0495680_0079301 | Ga0495680_0079301_1543_2103 | 157 |
| 643 | 3300047471 | Ga0495684_0319093 | Ga0495684_0319093_472_1032 | 157 |
| 644 | 3300049521 | Ga0501298_073631 | Ga0501298_073631_138_677 | 157 |
| 645 | 3300049572 | Ga0501036_0401188 | Ga0501036_0401188_164_646 | 157 |
| 646 | 3300049573 | Ga0501037_0253477 | Ga0501037_0253477_254_820 | 157 |
| 647 | 3300049573 | Ga0501037_0480080 | Ga0501037_0480080_66_548 | 157 |
| 648 | 3300049574 | Ga0501038_0050494 | Ga0501038_0050494_284_850 | 157 |
| 649 | 3300049575 | Ga0501039_0078134 | Ga0501039_0078134_568_1134 | 157 |
| 650 | 3300049575 | Ga0501039_0378992 | Ga0501039_0378992_117_599 | 157 |
| 651 | 3300049576 | Ga0501040_0034358 | Ga0501040_0034358_208_681 | 157 |
| 652 | 3300049576 | Ga0501040_0454069 | Ga0501040_0454069_16_582 | 157 |
| 653 | 3300049577 | Ga0501041_0137227 | Ga0501041_0137227_254_727 | 157 |
| 654 | 3300049577 | Ga0501041_0285010 | Ga0501041_0285010_481_963 | 157 |
| 655 | 3300049578 | Ga0501042_0035847 | Ga0501042_0035847_1245_1811 | 157 |
| 656 | 3300049578 | Ga0501042_0309100 | Ga0501042_0309100_624_1097 | 157 |
| 657 | 3300049579 | Ga0501043_0812048 | Ga0501043_0812048_45_590 | 157 |
| 658 | 3300049580 | Ga0501046_0028053 | Ga0501046_0028053_3976_4542 | 157 |
| 659 | 3300049580 | Ga0501046_0541311 | Ga0501046_0541311_157_633 | 157 |
| 660 | 3300049582 | Ga0501048_0083168 | Ga0501048_0083168_585_1151 | 157 |
| 661 | 3300049582 | Ga0501048_0189561 | Ga0501048_0189561_660_1133 | 157 |
| 662 | 3300049582 | Ga0501048_0662988 | Ga0501048_0662988_217_699 | 157 |
| 663 | 3300049584 | Ga0501068_0032306 | Ga0501068_0032306_165_647 | 157 |
| 664 | 3300049587 | Ga0501071_0000879 | Ga0501071_0000879_2164_2646 | 157 |
| 665 | 3300049587 | Ga0501071_0071317 | Ga0501071_0071317_1010_1483 | 157 |
| 666 | 3300049587 | Ga0501071_0469648 | Ga0501071_0469648_75_710 | 157 |
| 667 | 3300049588 | Ga0501072_0003042 | Ga0501072_0003042_9697_10263 | 157 |
| 668 | 3300049588 | Ga0501072_0076283 | Ga0501072_0076283_372_938 | 157 |
| 669 | 3300049588 | Ga0501072_0077852 | Ga0501072_0077852_1260_1742 | 157 |
| 670 | 3300049588 | Ga0501072_0081610 | Ga0501072_0081610_1767_2240 | 157 |
| 671 | 3300049590 | Ga0501074_0211108 | Ga0501074_0211108_437_1003 | 157 |
| 672 | 3300049591 | Ga0501075_0044465 | Ga0501075_0044465_867_1433 | 157 |
| 673 | 3300049591 | Ga0501075_0181147 | Ga0501075_0181147_750_1232 | 157 |
| 674 | 3300049592 | Ga0501076_0001168 | Ga0501076_0001168_7960_8526 | 157 |
| 675 | 3300049669 | Ga0501235_044322 | Ga0501235_044322_91_630 | 157 |
| 676 | 3300049679 | Ga0501249_034262 | Ga0501249_034262_330_869 | 157 |
| 677 | 3300049741 | Ga0501079_0002730 | Ga0501079_0002730_3477_4043 | 157 |
| 678 | 3300049741 | Ga0501079_0041684 | Ga0501079_0041684_2172_2645 | 157 |
| 679 | 3300049741 | Ga0501079_0358803 | Ga0501079_0358803_59_541 | 157 |
| 680 | 3300049742 | Ga0501080_0058100 | Ga0501080_0058100_248_814 | 157 |
| 681 | 3300049743 | Ga0501081_0013737 | Ga0501081_0013737_1851_2417 | 157 |
| 682 | 3300049770 | Ga0501273_014629 | Ga0501273_014629_24_581 | 157 |
| 683 | 3300049822 | Ga0501035_0047672 | Ga0501035_0047672_2923_3432 | 157 |
| 684 | 3300049822 | Ga0501035_0432495 | Ga0501035_0432495_399_872 | 157 |
| 685 | 3300049824 | Ga0501045_0082061 | Ga0501045_0082061_523_1089 | 157 |
| 686 | 3300050507 | nmdc:mga05p37_109_c1 | nmdc:mga05p37_109_c1_5471_5956 | 157 |
| 687 | 3300050507 | nmdc:mga05p37_604246_c1 | nmdc:mga05p37_604246_c1_267_776 | 157 |
| 688 | 3300050507 | nmdc:mga05p37_886_c1 | nmdc:mga05p37_886_c1_27478_27951 | 157 |
| 689 | 3300050508 | nmdc:mga09592_202854_c1 | nmdc:mga09592_202854_c1_1001_1537 | 157 |
| 690 | 3300050508 | nmdc:mga09592_2901_c1 | nmdc:mga09592_2901_c1_12035_12520 | 157 |
| 691 | 3300050508 | nmdc:mga09592_6868_c1 | nmdc:mga09592_6868_c1_2735_3208 | 157 |
| 692 | 3300050509 | nmdc:mga0qj67_1170396_c1 | nmdc:mga0qj67_1170396_c1_10_549 | 157 |
| 693 | 3300050509 | nmdc:mga0qj67_41917_c1 | nmdc:mga0qj67_41917_c1_2926_3465 | 157 |
| 694 | 3300050509 | nmdc:mga0qj67_422082_c1 | nmdc:mga0qj67_422082_c1_329_802 | 157 |
| 695 | 3300050509 | nmdc:mga0qj67_662400_c1 | nmdc:mga0qj67_662400_c1_116_592 | 157 |
| 696 | 3300050509 | nmdc:mga0qj67_6924_c1 | nmdc:mga0qj67_6924_c1_6059_6595 | 157 |
| 697 | 3300050510 | nmdc:mga06r32_287585_c1 | nmdc:mga06r32_287585_c1_520_1005 | 157 |
| 698 | 3300050510 | nmdc:mga06r32_309216_c1 | nmdc:mga06r32_309216_c1_268_804 | 157 |
| 699 | 3300050510 | nmdc:mga06r32_383217_c1 | nmdc:mga06r32_383217_c1_511_1050 | 157 |
| 700 | 3300050511 | nmdc:mga08y16_152610_c1 | nmdc:mga08y16_152610_c1_161_646 | 157 |
| 701 | 3300050511 | nmdc:mga08y16_189087_c1 | nmdc:mga08y16_189087_c1_185_658 | 157 |
| 702 | 3300050511 | nmdc:mga08y16_90814_c1 | nmdc:mga08y16_90814_c1_1248_1721 | 157 |
| 703 | 3300050512 | nmdc:mga0n895_677390_c1 | nmdc:mga0n895_677390_c1_92_655 | 157 |
| 704 | 3300050512 | nmdc:mga0n895_8407_c1 | nmdc:mga0n895_8407_c1_5972_6445 | 157 |
| 705 | 3300050513 | nmdc:mga0rr50_241822_c1 | nmdc:mga0rr50_241822_c1_327_812 | 157 |
| 706 | 3300050513 | nmdc:mga0rr50_3195_c1 | nmdc:mga0rr50_3195_c1_1494_1967 | 157 |
| 707 | 3300050514 | nmdc:mga08x19_4656_c1 | nmdc:mga08x19_4656_c1_6397_6870 | 157 |
| 708 | 3300050514 | nmdc:mga08x19_6463_c1 | nmdc:mga08x19_6463_c1_4661_5173 | 157 |
| 709 | 3300050514 | nmdc:mga08x19_70089_c1 | nmdc:mga08x19_70089_c1_858_1421 | 157 |
| 710 | 3300050514 | nmdc:mga08x19_758067_c1 | nmdc:mga08x19_758067_c1_147_656 | 157 |
| 711 | 3300050515 | nmdc:mga0a205_281873_c1 | nmdc:mga0a205_281873_c1_807_1280 | 157 |
| 712 | 3300050515 | nmdc:mga0a205_385096_c1 | nmdc:mga0a205_385096_c1_742_1236 | 157 |
| 713 | 3300050515 | nmdc:mga0a205_505_c1 | nmdc:mga0a205_505_c1_1270_1743 | 157 |
| 714 | 3300053077 | Ga0495601_0000862 | Ga0495601_0000862_14085_14621 | 157 |
| 715 | 3300053077 | Ga0495601_0018854 | Ga0495601_0018854_198_734 | 157 |
| 716 | 3300053077 | Ga0495601_0254334 | Ga0495601_0254334_225_785 | 157 |
| 717 | 3300054114 | Ga0501084_0047735 | Ga0501084_0047735_2933_3406 | 157 |
| 718 | 3300054114 | Ga0501084_0096251 | Ga0501084_0096251_857_1423 | 157 |
| 719 | 3300059424 | Ga0590075_057417 | Ga0590075_057417_219_698 | 157 |
| 720 | 3300060353 | Ga0501082_0237309 | Ga0501082_0237309_1057_1539 | 157 |
| 721 | 3300061734 | Ga0530510_0001231 | Ga0530510_0001231_9496_10062 | 157 |
| 722 | 3300061734 | Ga0530510_0215943 | Ga0530510_0215943_410_883 | 157 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8h2t-assembly1.cif.gz_H | cryo-em structure of iadd/e dioxygenase bound with iaa | 0.9107 | 5 | 147 |
| 3e99-assembly1.cif.gz_A | crystal structure of the beta subunit of the benzoate 1,2-dioxygenase (benb, bmaa0186) from burkholderia mallei atcc 23344 at 1.90 a resolution | 0.8781 | 7 | 144 |
| 3ef8-assembly1.cif.gz_A | crystal structure of putative scytalone dehydratase (yp_496742.1) from novosphingobium aromaticivorans dsm 12444 at 1.50 a resolution | 0.8726 | 5 | 143 |
| 1wql-assembly1.cif.gz_B | cumene dioxygenase (cuma1a2) from pseudomonas fluorescens ip01 | 0.8619 | 1 | 154 |
| 2chc-assembly1.cif.gz_A | structure of rv3472(d26n), a function unknown protein from mycobacterium tuberculosis | 0.858 | 6 | 143 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3e99A00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.87 | 7 | 144 | 3.10.450.50 |
| af_Q47140_1_172_3.10.450.50 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.8658 | 1 | 147 | 3.10.450.50 |
| af_P71754_77_184_3.10.450.50 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.8611 | 80 | 138 | 3.10.450.50 |
| 3ef8B00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.8485 | 3 | 143 | 3.10.450.50 |
| 2b1xB00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.8456 | 5 | 146 | 3.10.450.50 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537C0D0-F1-model_v4 | Aromatic-ring-hydroxylating dioxygenase subunit beta | 0.9549 | 1 | 132 |
GO:0019380
GO:0051213 |
| AF-A0A243SX33-F1-model_v4 | deleted | 0.9521 | 82 | 147 |
|
| AF-A0A536XR34-F1-model_v4 | Aromatic-ring-hydroxylating dioxygenase subunit beta | 0.9496 | 2 | 140 |
GO:0019380
GO:0051213 |
| AF-A0A537C0D0-F1-model_v4 | Aromatic-ring-hydroxylating dioxygenase subunit beta | 0.9411 | 1 | 132 |
GO:0019380
GO:0051213 |
| AF-N9SU72-F1-model_v4 | deleted | 0.939 | 1 | 144 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar