F477403
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 722 | 388 | 1444 | 142 |
Family's Representative Sequence
| Representative Sequence | 3300005347|Ga0070668_100177547|Ga0070668_1001775472 |
| Length | 163 |
| Sequence | MGGGQQMARGLGRELGEGWKAMAKKIEGYINLQVPAGQANPSPPIGPALGQRGLAIMEFCKQFNAKSKDLEQGAPIPVKITVYSDRSFTFEMRTPPASHLLKKAAKINGGSKEPGRASAGTITMAQVREVAKVKMKDLNTDDLDAAVKTLAGSARSMGLQVVE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 3 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 38 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 44 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 51 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 52 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 53 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 54 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 55 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 56 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 57 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 58 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 59 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 60 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 61 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 62 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 63 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 64 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 66 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 67 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 69 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 70 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 71 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 72 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 73 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 74 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 75 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 76 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 77 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 79 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 80 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 102 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 144 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 147 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 148 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 149 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 150 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 151 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 152 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 153 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 154 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 155 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 156 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 157 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 158 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 159 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 160 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 161 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 162 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 163 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 164 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 165 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 166 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 167 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 168 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 169 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 170 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 171 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 172 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 173 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 174 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 175 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 176 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 177 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 178 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 179 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 180 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 181 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 182 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 183 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 184 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 185 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 186 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 187 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 188 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 189 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 190 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 191 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 192 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 193 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 220 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 221 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 222 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 223 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 224 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 225 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 226 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 227 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 228 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 229 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 230 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 231 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 232 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 233 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 234 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 235 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 236 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 270 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 271 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 272 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 273 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 274 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 275 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 276 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 291 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 292 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 293 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 294 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 296 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 297 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 298 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 300 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 301 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 302 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 303 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 304 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 305 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 306 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 307 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 308 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 309 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 310 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 311 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 312 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 313 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 314 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 315 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 316 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 317 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 318 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 319 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 320 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 321 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 322 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 323 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 324 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 325 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 326 | 2906610324 | |||
| 327 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 328 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 329 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 330 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 331 | 2922425934 | |||
| 332 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 333 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 334 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 335 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 336 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 337 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 338 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 339 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 340 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 341 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 342 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 343 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 344 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 345 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 346 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 347 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 348 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 349 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 350 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 351 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 352 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 353 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 354 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 355 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 356 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 357 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 358 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 359 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 360 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 361 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 362 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 363 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 364 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 365 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 366 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 367 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 368 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 369 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 370 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 371 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 372 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 373 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 374 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 375 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 376 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 377 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 378 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 379 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 380 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 381 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 382 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 383 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 384 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 385 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 386 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 387 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 388 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.94 |
| Metatranscriptomes | 0.97 |
| Isolates | 12.08 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.4 |
| Nodule | 10.66 |
| Rhizoplane | 8.86 |
| Rhizosphere | 72.71 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070668_100177547 | 3300005347 | Bacteria | 1737 |
| 2 | JGI25404J52841_10013039 | 3300003659 | Bacteria | 1803 |
| 3 | Ga0070690_100207609 | 3300005330 | Bacteria | 1366 |
| 4 | Ga0070670_100953842 | 3300005331 | Bacteria | 779 |
| 5 | Ga0068869_100017207 | 3300005334 | Bacteria | 4895 |
| 6 | Ga0068869_100347269 | 3300005334 | Bacteria | 1209 |
| 7 | Ga0070666_10866435 | 3300005335 | Bacteria | 667 |
| 8 | Ga0070680_100003246 | 3300005336 | Bacteria | 12104 |
| 9 | Ga0070680_100012371 | 3300005336 | Bacteria | 6626 |
| 10 | Ga0070682_100039845 | 3300005337 | Bacteria | 2888 |
| 11 | Ga0070682_101132594 | 3300005337 | Bacteria | 657 |
| 12 | Ga0070660_100011063 | 3300005339 | Bacteria | 6397 |
| 13 | Ga0070689_100938919 | 3300005340 | Bacteria | 767 |
| 14 | Ga0070691_10016888 | 3300005341 | Bacteria | 3357 |
| 15 | Ga0070691_10066283 | 3300005341 | Bacteria | 1745 |
| 16 | Ga0070687_100168920 | 3300005343 | Bacteria | 1300 |
| 17 | Ga0070661_100056615 | 3300005344 | Bacteria | 2873 |
| 18 | Ga0070661_100596075 | 3300005344 | Bacteria | 893 |
| 19 | Ga0070692_10054754 | 3300005345 | Bacteria | 2084 |
| 20 | Ga0070668_100846874 | 3300005347 | Bacteria | 815 |
| 21 | Ga0070668_100863339 | 3300005347 | Bacteria | 807 |
| 22 | Ga0070675_100393686 | 3300005354 | Bacteria | 1235 |
| 23 | Ga0070671_100916296 | 3300005355 | Bacteria | 766 |
| 24 | Ga0070688_100059674 | 3300005365 | Bacteria | 2407 |
| 25 | Ga0070659_100036234 | 3300005366 | Bacteria | 3845 |
| 26 | Ga0070659_101633101 | 3300005366 | Bacteria | 576 |
| 27 | Ga0070667_100641913 | 3300005367 | Bacteria | 980 |
| 28 | Ga0070701_10005417 | 3300005438 | Bacteria | 5267 |
| 29 | Ga0070705_100006514 | 3300005440 | Bacteria | 5729 |
| 30 | Ga0070705_100006625 | 3300005440 | Bacteria | 5689 |
| 31 | Ga0070705_100369103 | 3300005440 | Bacteria | 1052 |
| 32 | Ga0070700_100010147 | 3300005441 | Bacteria | 5189 |
| 33 | Ga0070700_100065299 | 3300005441 | Bacteria | 2307 |
| 34 | Ga0070700_100119275 | 3300005441 | Bacteria | 1765 |
| 35 | Ga0070700_100297258 | 3300005441 | Bacteria | 1177 |
| 36 | Ga0070700_101203048 | 3300005441 | Bacteria | 633 |
| 37 | Ga0070694_100007558 | 3300005444 | Bacteria | 6634 |
| 38 | Ga0070694_100793719 | 3300005444 | Bacteria | 776 |
| 39 | Ga0070694_101069482 | 3300005444 | Bacteria | 672 |
| 40 | Ga0070694_101168248 | 3300005444 | Bacteria | 644 |
| 41 | Ga0070708_100050222 | 3300005445 | Bacteria | 3692 |
| 42 | Ga0070663_100011644 | 3300005455 | Bacteria | 5529 |
| 43 | Ga0070663_100016160 | 3300005455 | Bacteria | 4837 |
| 44 | Ga0070663_100358023 | 3300005455 | Bacteria | 1183 |
| 45 | Ga0070663_100852641 | 3300005455 | Bacteria | 784 |
| 46 | Ga0070678_100141450 | 3300005456 | Bacteria | 1926 |
| 47 | Ga0070678_100676193 | 3300005456 | Bacteria | 928 |
| 48 | Ga0070662_100293724 | 3300005457 | Bacteria | 1318 |
| 49 | Ga0070681_10011583 | 3300005458 | Bacteria | 8729 |
| 50 | Ga0070681_10088487 | 3300005458 | Bacteria | 3048 |
| 51 | Ga0068867_100505778 | 3300005459 | Bacteria | 1039 |
| 52 | Ga0070685_10263439 | 3300005466 | Bacteria | 1147 |
| 53 | Ga0070685_10836668 | 3300005466 | Bacteria | 681 |
| 54 | Ga0070706_100367797 | 3300005467 | Bacteria | 1340 |
| 55 | Ga0070707_100175421 | 3300005468 | Bacteria | 2089 |
| 56 | Ga0070707_100202029 | 3300005468 | Bacteria | 1937 |
| 57 | Ga0070707_100231769 | 3300005468 | Bacteria | 1797 |
| 58 | Ga0070698_100206881 | 3300005471 | Bacteria | 1897 |
| 59 | Ga0070698_100416867 | 3300005471 | Bacteria | 1277 |
| 60 | Ga0070699_100002571 | 3300005518 | Bacteria | 16279 |
| 61 | Ga0070699_100200880 | 3300005518 | Bacteria | 1772 |
| 62 | Ga0070679_100049281 | 3300005530 | Bacteria | 4195 |
| 63 | Ga0070679_100184324 | 3300005530 | Bacteria | 2059 |
| 64 | Ga0070697_100119057 | 3300005536 | Bacteria | 2207 |
| 65 | Ga0070697_100239221 | 3300005536 | Bacteria | 1550 |
| 66 | Ga0068853_100040534 | 3300005539 | Bacteria | 3974 |
| 67 | Ga0070686_100461855 | 3300005544 | Bacteria | 978 |
| 68 | Ga0070686_101170219 | 3300005544 | Bacteria | 638 |
| 69 | Ga0070686_101457915 | 3300005544 | Bacteria | 576 |
| 70 | Ga0070695_100001778 | 3300005545 | Bacteria | 12130 |
| 71 | Ga0070695_100018719 | 3300005545 | Bacteria | 4207 |
| 72 | Ga0070695_100058175 | 3300005545 | Bacteria | 2499 |
| 73 | Ga0070696_100008610 | 3300005546 | Bacteria | 6824 |
| 74 | Ga0070696_100022490 | 3300005546 | Bacteria | 4284 |
| 75 | Ga0070693_100002809 | 3300005547 | Bacteria | 8014 |
| 76 | Ga0070693_100079822 | 3300005547 | Bacteria | 1948 |
| 77 | Ga0070704_100057353 | 3300005549 | Bacteria | 2769 |
| 78 | Ga0070704_100088993 | 3300005549 | Bacteria | 2295 |
| 79 | Ga0070704_100097286 | 3300005549 | Bacteria | 2208 |
| 80 | Ga0070704_101088317 | 3300005549 | Bacteria | 726 |
| 81 | Ga0068855_100091602 | 3300005563 | Bacteria | 3507 |
| 82 | Ga0070664_100046396 | 3300005564 | Bacteria | 3670 |
| 83 | Ga0068857_100162572 | 3300005577 | Bacteria | 2026 |
| 84 | Ga0068856_100129197 | 3300005614 | Bacteria | 2531 |
| 85 | Ga0070702_100097041 | 3300005615 | Bacteria | 1800 |
| 86 | Ga0068852_100159356 | 3300005616 | Bacteria | 2106 |
| 87 | Ga0068859_100065425 | 3300005617 | Bacteria | 3670 |
| 88 | Ga0068859_100640820 | 3300005617 | Bacteria | 1155 |
| 89 | Ga0068859_101210556 | 3300005617 | Bacteria | 832 |
| 90 | Ga0068864_100006580 | 3300005618 | Bacteria | 9512 |
| 91 | Ga0068864_101629155 | 3300005618 | Bacteria | 650 |
| 92 | Ga0068864_101667966 | 3300005618 | Bacteria | 642 |
| 93 | Ga0068861_100079500 | 3300005719 | Bacteria | 2564 |
| 94 | Ga0068861_100265776 | 3300005719 | Bacteria | 1471 |
| 95 | Ga0068861_101508435 | 3300005719 | Bacteria | 660 |
| 96 | Ga0068870_10022374 | 3300005840 | Bacteria | 3106 |
| 97 | Ga0068863_100437090 | 3300005841 | Bacteria | 1283 |
| 98 | Ga0068863_100545102 | 3300005841 | Bacteria | 1145 |
| 99 | Ga0068863_100970397 | 3300005841 | Bacteria | 852 |
| 100 | Ga0068863_101703929 | 3300005841 | Bacteria | 640 |
| 101 | Ga0068858_100159505 | 3300005842 | Bacteria | 2124 |
| 102 | Ga0068858_100439137 | 3300005842 | Bacteria | 1257 |
| 103 | Ga0068860_100010003 | 3300005843 | Bacteria | 9402 |
| 104 | Ga0068860_100027772 | 3300005843 | Bacteria | 5450 |
| 105 | Ga0068860_100172720 | 3300005843 | Bacteria | 2088 |
| 106 | Ga0068860_100197112 | 3300005843 | Bacteria | 1951 |
| 107 | Ga0068860_100854376 | 3300005843 | Bacteria | 925 |
| 108 | Ga0068860_101631456 | 3300005843 | Bacteria | 667 |
| 109 | Ga0068862_100002462 | 3300005844 | Bacteria | 16405 |
| 110 | Ga0068862_100048738 | 3300005844 | Bacteria | 3617 |
| 111 | Ga0068862_100117287 | 3300005844 | Bacteria | 2343 |
| 112 | Ga0068862_101363967 | 3300005844 | Bacteria | 712 |
| 113 | Ga0068862_101953986 | 3300005844 | Bacteria | 597 |
| 114 | Ga0081455_10004292 | 3300005937 | Bacteria | 16046 |
| 115 | Ga0081540_1001954 | 3300005983 | Bacteria | 17230 |
| 116 | Ga0081540_1194546 | 3300005983 | Bacteria | 744 |
| 117 | Ga0081539_10050840 | 3300005985 | Bacteria | 2341 |
| 118 | Ga0081539_10153925 | 3300005985 | Bacteria | 1103 |
| 119 | Ga0075365_10075468 | 3300006038 | Bacteria | 2275 |
| 120 | Ga0075365_10395002 | 3300006038 | Bacteria | 976 |
| 121 | Ga0075365_10459969 | 3300006038 | Bacteria | 899 |
| 122 | Ga0075368_10002966 | 3300006042 | Bacteria | 5603 |
| 123 | Ga0075363_100055511 | 3300006048 | Bacteria | 2122 |
| 124 | Ga0075363_100127531 | 3300006048 | Bacteria | 1425 |
| 125 | Ga0075363_100144396 | 3300006048 | Bacteria | 1341 |
| 126 | Ga0075364_10011733 | 3300006051 | Bacteria | 5333 |
| 127 | Ga0070715_10040617 | 3300006163 | Bacteria | 1945 |
| 128 | Ga0070715_10625488 | 3300006163 | Bacteria | 634 |
| 129 | Ga0075362_10065919 | 3300006177 | Bacteria | 1645 |
| 130 | Ga0075362_10550676 | 3300006177 | Bacteria | 593 |
| 131 | Ga0075367_10032301 | 3300006178 | Bacteria | 3011 |
| 132 | Ga0075367_10371469 | 3300006178 | Bacteria | 903 |
| 133 | Ga0075367_10431717 | 3300006178 | Bacteria | 834 |
| 134 | Ga0097621_100782396 | 3300006237 | Bacteria | 883 |
| 135 | Ga0075370_10302785 | 3300006353 | Bacteria | 951 |
| 136 | Ga0075428_100012165 | 3300006844 | Bacteria | 9571 |
| 137 | Ga0075428_100111245 | 3300006844 | Bacteria | 2984 |
| 138 | Ga0075428_100135033 | 3300006844 | Bacteria | 2683 |
| 139 | Ga0075428_100255326 | 3300006844 | Bacteria | 1888 |
| 140 | Ga0075428_100931920 | 3300006844 | Bacteria | 921 |
| 141 | Ga0075430_100075551 | 3300006846 | Bacteria | 2825 |
| 142 | Ga0075430_100551215 | 3300006846 | Bacteria | 951 |
| 143 | Ga0075430_100832358 | 3300006846 | Bacteria | 760 |
| 144 | Ga0075430_101437425 | 3300006846 | Bacteria | 567 |
| 145 | Ga0075431_100024490 | 3300006847 | Bacteria | 6186 |
| 146 | Ga0075431_100080320 | 3300006847 | Bacteria | 3367 |
| 147 | Ga0075431_100174899 | 3300006847 | Bacteria | 2205 |
| 148 | Ga0075431_100227684 | 3300006847 | Bacteria | 1900 |
| 149 | Ga0075431_100297926 | 3300006847 | Bacteria | 1630 |
| 150 | Ga0075433_10195674 | 3300006852 | Bacteria | 1798 |
| 151 | Ga0075433_10250798 | 3300006852 | Bacteria | 1570 |
| 152 | Ga0075433_10742806 | 3300006852 | Bacteria | 858 |
| 153 | Ga0075433_11574617 | 3300006852 | Bacteria | 567 |
| 154 | Ga0075434_100040464 | 3300006871 | Bacteria | 4615 |
| 155 | Ga0075434_100062343 | 3300006871 | Bacteria | 3711 |
| 156 | Ga0075434_100203790 | 3300006871 | Bacteria | 1998 |
| 157 | Ga0075429_100219257 | 3300006880 | Bacteria | 1667 |
| 158 | Ga0075429_100387625 | 3300006880 | Bacteria | 1223 |
| 159 | Ga0068865_100677427 | 3300006881 | Bacteria | 879 |
| 160 | Ga0075436_100982911 | 3300006914 | Bacteria | 633 |
| 161 | Ga0097620_100065425 | 3300006931 | Bacteria | 3670 |
| 162 | Ga0097620_100640805 | 3300006931 | Bacteria | 1155 |
| 163 | Ga0097620_101210553 | 3300006931 | Bacteria | 832 |
| 164 | Ga0075435_100018160 | 3300007076 | Bacteria | 5339 |
| 165 | Ga0075435_100742246 | 3300007076 | Bacteria | 854 |
| 166 | Ga0099795_10040854 | 3300007788 | Bacteria | 1649 |
| 167 | Ga0111539_10006608 | 3300009094 | Bacteria | 14940 |
| 168 | Ga0111539_10017896 | 3300009094 | Bacteria | 8778 |
| 169 | Ga0111539_10058172 | 3300009094 | Bacteria | 4587 |
| 170 | Ga0111539_10278767 | 3300009094 | Bacteria | 1945 |
| 171 | Ga0111539_10342289 | 3300009094 | Bacteria | 1741 |
| 172 | Ga0111539_10391169 | 3300009094 | Bacteria | 1619 |
| 173 | Ga0111539_10837204 | 3300009094 | Bacteria | 1070 |
| 174 | Ga0105245_10036863 | 3300009098 | Bacteria | 4346 |
| 175 | Ga0105245_10135230 | 3300009098 | Bacteria | 2316 |
| 176 | Ga0105245_11170772 | 3300009098 | Bacteria | 816 |
| 177 | Ga0105247_10348247 | 3300009101 | Bacteria | 1041 |
| 178 | Ga0105247_10602056 | 3300009101 | Bacteria | 815 |
| 179 | Ga0114129_10057856 | 3300009147 | Bacteria | 5424 |
| 180 | Ga0114129_10391109 | 3300009147 | Bacteria | 1834 |
| 181 | Ga0114129_10702845 | 3300009147 | Bacteria | 1299 |
| 182 | Ga0114129_10803790 | 3300009147 | Bacteria | 1199 |
| 183 | Ga0114129_11244173 | 3300009147 | Bacteria | 925 |
| 184 | Ga0114129_13219384 | 3300009147 | Bacteria | 530 |
| 185 | Ga0105243_10028727 | 3300009148 | Bacteria | 4271 |
| 186 | Ga0105243_10728075 | 3300009148 | Bacteria | 970 |
| 187 | Ga0105243_10776325 | 3300009148 | Bacteria | 942 |
| 188 | Ga0105242_10551877 | 3300009176 | Bacteria | 1105 |
| 189 | Ga0105248_10967282 | 3300009177 | Bacteria | 961 |
| 190 | Ga0105248_11316311 | 3300009177 | Bacteria | 817 |
| 191 | Ga0105237_10018592 | 3300009545 | Bacteria | 7190 |
| 192 | Ga0105238_10130927 | 3300009551 | Bacteria | 2487 |
| 193 | Ga0105249_10013294 | 3300009553 | Bacteria | 7267 |
| 194 | Ga0105249_10780662 | 3300009553 | Bacteria | 1019 |
| 195 | Ga0105249_11953063 | 3300009553 | Bacteria | 659 |
| 196 | Ga0105249_12019405 | 3300009553 | Bacteria | 649 |
| 197 | Ga0105239_11351728 | 3300010375 | Bacteria | 822 |
| 198 | Ga0105246_11170539 | 3300011119 | Bacteria | 706 |
| 199 | Ga0157370_10641961 | 3300013104 | Bacteria | 970 |
| 200 | Ga0157369_10398692 | 3300013105 | Bacteria | 1427 |
| 201 | Ga0157378_10040081 | 3300013297 | Bacteria | 4154 |
| 202 | Ga0157378_11722719 | 3300013297 | Bacteria | 674 |
| 203 | Ga0163162_10310482 | 3300013306 | Bacteria | 1709 |
| 204 | Ga0163162_10525496 | 3300013306 | Bacteria | 1313 |
| 205 | Ga0157375_10047041 | 3300013308 | Bacteria | 4210 |
| 206 | Ga0157375_10073534 | 3300013308 | Bacteria | 3437 |
| 207 | Ga0157375_11063063 | 3300013308 | Bacteria | 946 |
| 208 | Ga0157380_10185573 | 3300014326 | Bacteria | 1831 |
| 209 | Ga0157380_10246770 | 3300014326 | Bacteria | 1613 |
| 210 | Ga0157380_10390461 | 3300014326 | Bacteria | 1317 |
| 211 | Ga0157380_10579920 | 3300014326 | Bacteria | 1106 |
| 212 | Ga0157379_10085624 | 3300014968 | Bacteria | 2825 |
| 213 | Ga0157379_10386304 | 3300014968 | Bacteria | 1285 |
| 214 | Ga0157379_11711526 | 3300014968 | Bacteria | 616 |
| 215 | Ga0157376_10410533 | 3300014969 | Bacteria | 1312 |
| 216 | Ga0163161_10409437 | 3300017792 | Bacteria | 1089 |
| 217 | Ga0163161_10640657 | 3300017792 | Bacteria | 880 |
| 218 | Ga0206356_10381984 | 3300020070 | Bacteria | 614 |
| 219 | Ga0207682_10010123 | 3300025893 | Bacteria | 3701 |
| 220 | Ga0207642_10490562 | 3300025899 | Bacteria | 751 |
| 221 | Ga0207710_10226116 | 3300025900 | Bacteria | 930 |
| 222 | Ga0207680_10554644 | 3300025903 | Bacteria | 820 |
| 223 | Ga0207647_10017465 | 3300025904 | Bacteria | 4877 |
| 224 | Ga0207647_10033997 | 3300025904 | Bacteria | 3258 |
| 225 | Ga0207685_10754860 | 3300025905 | Bacteria | 533 |
| 226 | Ga0207645_11002160 | 3300025907 | Bacteria | 566 |
| 227 | Ga0207684_11089209 | 3300025910 | Bacteria | 665 |
| 228 | Ga0207707_10011417 | 3300025912 | Bacteria | 7736 |
| 229 | Ga0207671_10033313 | 3300025914 | Bacteria | 3833 |
| 230 | Ga0207660_10008218 | 3300025917 | Bacteria | 6753 |
| 231 | Ga0207660_10010703 | 3300025917 | Bacteria | 5961 |
| 232 | Ga0207662_10090791 | 3300025918 | Bacteria | 1878 |
| 233 | Ga0207662_10105148 | 3300025918 | Bacteria | 1754 |
| 234 | Ga0207657_10017375 | 3300025919 | Bacteria | 6901 |
| 235 | Ga0207657_10797034 | 3300025919 | Bacteria | 730 |
| 236 | Ga0207649_10084482 | 3300025920 | Bacteria | 2064 |
| 237 | Ga0207652_10046567 | 3300025921 | Bacteria | 3700 |
| 238 | Ga0207652_10228862 | 3300025921 | Bacteria | 1675 |
| 239 | Ga0207646_10092622 | 3300025922 | Bacteria | 2705 |
| 240 | Ga0207646_10138234 | 3300025922 | Bacteria | 2194 |
| 241 | Ga0207646_10954169 | 3300025922 | Bacteria | 759 |
| 242 | Ga0207694_10023053 | 3300025924 | Bacteria | 4725 |
| 243 | Ga0207650_11082479 | 3300025925 | Bacteria | 682 |
| 244 | Ga0207659_11072044 | 3300025926 | Bacteria | 693 |
| 245 | Ga0207687_10039500 | 3300025927 | Bacteria | 3232 |
| 246 | Ga0207686_10459411 | 3300025934 | Bacteria | 981 |
| 247 | Ga0207709_10029931 | 3300025935 | Bacteria | 3163 |
| 248 | Ga0207709_10108617 | 3300025935 | Bacteria | 1850 |
| 249 | Ga0207709_10152056 | 3300025935 | Bacteria | 1604 |
| 250 | Ga0207711_11414723 | 3300025941 | Bacteria | 638 |
| 251 | Ga0207689_10107639 | 3300025942 | Bacteria | 2291 |
| 252 | Ga0207689_10278862 | 3300025942 | Bacteria | 1384 |
| 253 | Ga0207689_10381907 | 3300025942 | Bacteria | 1173 |
| 254 | Ga0207689_10840206 | 3300025942 | Bacteria | 775 |
| 255 | Ga0207679_10050613 | 3300025945 | Bacteria | 3037 |
| 256 | Ga0207712_10002234 | 3300025961 | Bacteria | 12602 |
| 257 | Ga0207668_10217050 | 3300025972 | Bacteria | 1533 |
| 258 | Ga0207668_10436338 | 3300025972 | Bacteria | 1115 |
| 259 | Ga0207640_10547666 | 3300025981 | Bacteria | 971 |
| 260 | Ga0207640_11212248 | 3300025981 | Bacteria | 671 |
| 261 | Ga0207658_10205325 | 3300025986 | Bacteria | 1648 |
| 262 | Ga0207677_10046600 | 3300026023 | Bacteria | 2904 |
| 263 | Ga0207703_10096381 | 3300026035 | Bacteria | 2498 |
| 264 | Ga0207703_10444567 | 3300026035 | Bacteria | 1210 |
| 265 | Ga0207703_10616064 | 3300026035 | Bacteria | 1028 |
| 266 | Ga0207639_10029939 | 3300026041 | Bacteria | 3990 |
| 267 | Ga0207678_10000118 | 3300026067 | Bacteria | 65608 |
| 268 | Ga0207678_10034068 | 3300026067 | Bacteria | 4435 |
| 269 | Ga0207678_10164622 | 3300026067 | Bacteria | 1894 |
| 270 | Ga0207708_10016120 | 3300026075 | Bacteria | 5613 |
| 271 | Ga0207708_10022034 | 3300026075 | Bacteria | 4809 |
| 272 | Ga0207708_10123889 | 3300026075 | Bacteria | 2016 |
| 273 | Ga0207708_10267685 | 3300026075 | Bacteria | 1381 |
| 274 | Ga0207708_10319101 | 3300026075 | Bacteria | 1267 |
| 275 | Ga0207708_11171454 | 3300026075 | Bacteria | 671 |
| 276 | Ga0207702_10076598 | 3300026078 | Bacteria | 2891 |
| 277 | Ga0207641_10193783 | 3300026088 | Bacteria | 1869 |
| 278 | Ga0207676_10381975 | 3300026095 | Bacteria | 1311 |
| 279 | Ga0207676_10517364 | 3300026095 | Bacteria | 1136 |
| 280 | Ga0207674_10184695 | 3300026116 | Bacteria | 2036 |
| 281 | Ga0207675_100028558 | 3300026118 | Bacteria | 5194 |
| 282 | Ga0207675_100034087 | 3300026118 | Bacteria | 4745 |
| 283 | Ga0207675_100067569 | 3300026118 | Bacteria | 3341 |
| 284 | Ga0207675_100150669 | 3300026118 | Bacteria | 2213 |
| 285 | Ga0207683_10035272 | 3300026121 | Bacteria | 4349 |
| 286 | Ga0207683_10433261 | 3300026121 | Bacteria | 1211 |
| 287 | Ga0209813_10008787 | 3300027866 | Bacteria | 2562 |
| 288 | Ga0209813_10060135 | 3300027866 | Bacteria | 1211 |
| 289 | Ga0207428_10008077 | 3300027907 | Bacteria | 9546 |
| 290 | Ga0207428_10019254 | 3300027907 | Bacteria | 5820 |
| 291 | Ga0207428_10261969 | 3300027907 | Bacteria | 1287 |
| 292 | Ga0207428_10481845 | 3300027907 | Bacteria | 902 |
| 293 | Ga0268265_10138589 | 3300028380 | Bacteria | 2033 |
| 294 | Ga0268265_10665476 | 3300028380 | Bacteria | 1002 |
| 295 | Ga0268264_10005854 | 3300028381 | Bacteria | 10409 |
| 296 | Ga0268264_10034682 | 3300028381 | Bacteria | 4152 |
| 297 | Ga0268264_10173935 | 3300028381 | Bacteria | 1950 |
| 298 | Ga0268264_10825641 | 3300028381 | Bacteria | 927 |
| 299 | Ga0268264_11641533 | 3300028381 | Bacteria | 653 |
| 300 | Ga0265340_10032122 | 3300031247 | Bacteria | 2622 |
| 301 | Ga0265316_10095094 | 3300031344 | Bacteria | 2270 |
| 302 | Ga0307408_100071207 | 3300031548 | Bacteria | 2570 |
| 303 | Ga0316575_10358619 | 3300031665 | Bacteria | 622 |
| 304 | Ga0316576_10023973 | 3300031727 | Bacteria | 4258 |
| 305 | Ga0316578_10213872 | 3300031728 | Bacteria | 1159 |
| 306 | Ga0307405_10078680 | 3300031731 | Bacteria | 2147 |
| 307 | Ga0307413_10260354 | 3300031824 | Bacteria | 1293 |
| 308 | Ga0307410_10649297 | 3300031852 | Bacteria | 885 |
| 309 | Ga0307409_100198315 | 3300031995 | Bacteria | 1793 |
| 310 | Ga0307416_100478881 | 3300032002 | Bacteria | 1304 |
| 311 | Ga0307411_10036612 | 3300032005 | Bacteria | 3077 |
| 312 | Ga0307415_101182778 | 3300032126 | Bacteria | 720 |
| 313 | Ga0316586_1007657 | 3300033527 | Bacteria | 1580 |
| 314 | Ga0316588_1037631 | 3300033528 | Bacteria | 1151 |
| 315 | Ga0316596_1001444 | 3300033541 | Bacteria | 4798 |
| 316 | Ga0373958_0007762 | 3300034819 | Bacteria | 1719 |
| 317 | Ga0373938_0005076 | 3300034957 | Bacteria | 2225 |
| 318 | Ga0373934_0069895 | 3300035086 | Bacteria | 1404 |
| 319 | Ga0373940_0000987 | 3300035088 | Bacteria | 4856 |
| 320 | Ga0373949_0149587 | 3300035090 | Bacteria | 674 |
| 321 | Ga0373952_0007818 | 3300035092 | Bacteria | 2014 |
| 322 | Ga0373952_0034555 | 3300035092 | Bacteria | 1140 |
| 323 | Ga0373923_0160862 | 3300035111 | Bacteria | 1024 |
| 324 | Ga0373923_0362289 | 3300035111 | Bacteria | 694 |
| 325 | Ga0373932_0090783 | 3300035112 | Bacteria | 979 |
| 326 | Ga0373939_0002313 | 3300035114 | Bacteria | 4507 |
| 327 | Ga0373953_0004766 | 3300035117 | Bacteria | 4350 |
| 328 | Ga0373954_0028040 | 3300035118 | Bacteria | 2587 |
| 329 | Ga0373954_0309950 | 3300035118 | Bacteria | 779 |
| 330 | Ga0373956_0010844 | 3300035119 | Bacteria | 3745 |
| 331 | Ga0373957_0051784 | 3300035120 | Bacteria | 1571 |
| 332 | Ga0373955_0077990 | 3300035172 | Bacteria | 1866 |
| 333 | Ga0373942_0016431 | 3300035207 | Bacteria | 1815 |
| 334 | Ga0373961_0008792 | 3300035241 | Bacteria | 2460 |
| 335 | Ga0316574_0268202 | 3300035398 | Bacteria | 1089 |
| 336 | Ga0316574_0316988 | 3300035398 | Bacteria | 990 |
| 337 | Ga0373931_0000685 | 3300035691 | Bacteria | 14057 |
| 338 | Ga0373931_0008373 | 3300035691 | Bacteria | 4902 |
| 339 | Ga0373927_0743414 | 3300035695 | Bacteria | 648 |
| 340 | Ga0373947_0111676 | 3300035725 | Bacteria | 1728 |
| 341 | Ga0373937_0615671 | 3300036401 | Bacteria | 1030 |
| 342 | Ga0316582_0262595 | 3300036647 | Bacteria | 1184 |
| 343 | Ga0316584_0031109 | 3300036712 | Bacteria | 3946 |
| 344 | Ga0395905_0000002 | 3300037471 | Bacteria | 1356358 |
| 345 | Ga0400486_32257 | 3300038742 | Bacteria | 1124 |
| 346 | Ga0400487_44160 | 3300039110 | Bacteria | 3629 |
| 347 | Ga0436365_0741969 | 3300039437 | Bacteria | 953 |
| 348 | Ga0436363_0062250 | 3300039450 | Bacteria | 530 |
| 349 | Ga0436363_0270409 | 3300039450 | Bacteria | 619 |
| 350 | Ga0436362_1178884 | 3300039453 | Bacteria | 2961 |
| 351 | Ga0453683_0443351 | 3300044673 | Bacteria | 839 |
| 352 | Ga0453684_0445324 | 3300044712 | Bacteria | 1443 |
| 353 | Ga0495617_098917 | 3300046452 | Bacteria | 949 |
| 354 | Ga0495592_0331962 | 3300046454 | Bacteria | 980 |
| 355 | Ga0495603_0025882 | 3300046455 | Bacteria | 3547 |
| 356 | Ga0495638_0420545 | 3300046460 | Bacteria | 689 |
| 357 | Ga0495653_0575345 | 3300046463 | Bacteria | 695 |
| 358 | Ga0495664_0540742 | 3300046477 | Bacteria | 694 |
| 359 | Ga0495608_0257843 | 3300046511 | Bacteria | 1086 |
| 360 | Ga0495618_0233070 | 3300046514 | Bacteria | 1159 |
| 361 | Ga0495628_0201429 | 3300046516 | Bacteria | 1500 |
| 362 | Ga0495652_0317586 | 3300046529 | Bacteria | 1126 |
| 363 | Ga0495645_0361513 | 3300046543 | Bacteria | 933 |
| 364 | Ga0495633_0126077 | 3300046558 | Bacteria | 1185 |
| 365 | Ga0495667_0071936 | 3300046559 | Bacteria | 2255 |
| 366 | Ga0495656_0444313 | 3300046615 | Bacteria | 683 |
| 367 | Ga0495625_0128806 | 3300046660 | Bacteria | 1716 |
| 368 | Ga0495625_0152947 | 3300046660 | Bacteria | 1550 |
| 369 | Ga0495625_0389362 | 3300046660 | Bacteria | 873 |
| 370 | Ga0495625_0400847 | 3300046660 | Bacteria | 857 |
| 371 | Ga0495635_0892186 | 3300046663 | Bacteria | 570 |
| 372 | Ga0495657_0337742 | 3300046675 | Bacteria | 893 |
| 373 | Ga0495658_0250139 | 3300046683 | Bacteria | 1115 |
| 374 | Ga0495658_0250931 | 3300046683 | Bacteria | 1113 |
| 375 | Ga0495649_0115869 | 3300046694 | Bacteria | 1419 |
| 376 | Ga0495600_0645807 | 3300046809 | Bacteria | 640 |
| 377 | Ga0495604_0159833 | 3300047317 | Bacteria | 1593 |
| 378 | Ga0495674_0438943 | 3300047319 | Bacteria | 1050 |
| 379 | Ga0495672_0093550 | 3300047320 | Bacteria | 1646 |
| 380 | Ga0495675_0104893 | 3300047444 | Bacteria | 1767 |
| 381 | Ga0495602_0092704 | 3300048088 | Bacteria | 2501 |
| 382 | Ga0495615_0062628 | 3300048090 | Bacteria | 985 |
| 383 | Ga0496100_0020609 | 3300048903 | Bacteria | 3956 |
| 384 | Ga0496100_0035344 | 3300048903 | Bacteria | 3142 |
| 385 | Ga0496101_0006539 | 3300048904 | Bacteria | 7507 |
| 386 | Ga0496101_0024585 | 3300048904 | Bacteria | 4170 |
| 387 | Ga0496101_0188547 | 3300048904 | Bacteria | 1591 |
| 388 | Ga0496102_0008953 | 3300048905 | Bacteria | 8586 |
| 389 | Ga0496102_0025641 | 3300048905 | Bacteria | 5251 |
| 390 | Ga0496102_0138502 | 3300048905 | Bacteria | 2281 |
| 391 | Ga0496102_0356934 | 3300048905 | Bacteria | 1376 |
| 392 | Ga0496102_0559746 | 3300048905 | Bacteria | 1066 |
| 393 | Ga0496102_0649976 | 3300048905 | Bacteria | 978 |
| 394 | Ga0496103_0023955 | 3300048906 | Bacteria | 3682 |
| 395 | Ga0496103_0284503 | 3300048906 | Bacteria | 1063 |
| 396 | Ga0496104_0000216 | 3300048907 | Bacteria | 50674 |
| 397 | Ga0496104_0095241 | 3300048907 | Bacteria | 2848 |
| 398 | Ga0496104_0225123 | 3300048907 | Bacteria | 1788 |
| 399 | Ga0496104_0270537 | 3300048907 | Bacteria | 1612 |
| 400 | Ga0496104_0375934 | 3300048907 | Bacteria | 1333 |
| 401 | Ga0496104_0820865 | 3300048907 | Bacteria | 836 |
| 402 | Ga0496105_0072606 | 3300048908 | Bacteria | 2844 |
| 403 | Ga0496105_0236024 | 3300048908 | Bacteria | 1485 |
| 404 | Ga0496105_0511263 | 3300048908 | Bacteria | 942 |
| 405 | Ga0496105_0608655 | 3300048908 | Bacteria | 847 |
| 406 | Ga0496105_0659401 | 3300048908 | Bacteria | 807 |
| 407 | Ga0496106_0007414 | 3300048909 | Bacteria | 8107 |
| 408 | Ga0496106_0008312 | 3300048909 | Bacteria | 7680 |
| 409 | Ga0496106_0107769 | 3300048909 | Bacteria | 2167 |
| 410 | Ga0496106_0126584 | 3300048909 | Bacteria | 2001 |
| 411 | Ga0496107_0009695 | 3300048910 | Bacteria | 6676 |
| 412 | Ga0496107_0065436 | 3300048910 | Bacteria | 2635 |
| 413 | Ga0496107_0464494 | 3300048910 | Bacteria | 940 |
| 414 | Ga0496107_0527942 | 3300048910 | Bacteria | 875 |
| 415 | Ga0496108_0011283 | 3300048911 | Bacteria | 7258 |
| 416 | Ga0496108_0202215 | 3300048911 | Bacteria | 1724 |
| 417 | Ga0496108_1109627 | 3300048911 | Bacteria | 672 |
| 418 | Ga0496109_0033418 | 3300048912 | Bacteria | 4627 |
| 419 | Ga0496109_0280252 | 3300048912 | Bacteria | 1571 |
| 420 | Ga0496109_0576459 | 3300048912 | Bacteria | 1061 |
| 421 | Ga0496109_0947992 | 3300048912 | Bacteria | 798 |
| 422 | Ga0496110_0000957 | 3300048913 | Bacteria | 20216 |
| 423 | Ga0496110_0034389 | 3300048913 | Bacteria | 4390 |
| 424 | Ga0496110_0148815 | 3300048913 | Bacteria | 2119 |
| 425 | Ga0496110_0648584 | 3300048913 | Bacteria | 955 |
| 426 | Ga0496110_1031465 | 3300048913 | Bacteria | 730 |
| 427 | Ga0496111_0123557 | 3300048914 | Bacteria | 1913 |
| 428 | Ga0496111_0160560 | 3300048914 | Bacteria | 1668 |
| 429 | Ga0496111_0168577 | 3300048914 | Bacteria | 1627 |
| 430 | Ga0496111_0371201 | 3300048914 | Bacteria | 1058 |
| 431 | Ga0496111_1348283 | 3300048914 | Bacteria | 501 |
| 432 | Ga0496112_0020950 | 3300048915 | Bacteria | 6208 |
| 433 | Ga0496112_0557778 | 3300048915 | Bacteria | 1079 |
| 434 | Ga0496112_0710527 | 3300048915 | Bacteria | 933 |
| 435 | Ga0496113_0004691 | 3300048916 | Bacteria | 8433 |
| 436 | Ga0496113_0544249 | 3300048916 | Bacteria | 931 |
| 437 | Ga0496114_0032687 | 3300048917 | Bacteria | 4284 |
| 438 | Ga0496114_0526604 | 3300048917 | Bacteria | 1045 |
| 439 | Ga0496114_0595315 | 3300048917 | Bacteria | 975 |
| 440 | Ga0496114_1252425 | 3300048917 | Bacteria | 628 |
| 441 | Ga0496115_0010086 | 3300048918 | Bacteria | 7043 |
| 442 | Ga0496115_0049897 | 3300048918 | Bacteria | 3351 |
| 443 | Ga0496115_0320733 | 3300048918 | Bacteria | 1267 |
| 444 | Ga0496115_0564875 | 3300048918 | Bacteria | 908 |
| 445 | Ga0496115_1267349 | 3300048918 | Bacteria | 551 |
| 446 | Ga0496124_0584017 | 3300048927 | Bacteria | 730 |
| 447 | Ga0501031_0045435 | 3300049568 | Bacteria | 2865 |
| 448 | Ga0501032_0205650 | 3300049569 | Bacteria | 1284 |
| 449 | Ga0501033_0020839 | 3300049570 | Bacteria | 4949 |
| 450 | Ga0501033_0386197 | 3300049570 | Bacteria | 978 |
| 451 | Ga0501034_0035297 | 3300049571 | Bacteria | 5070 |
| 452 | Ga0501034_0130903 | 3300049571 | Bacteria | 2492 |
| 453 | Ga0501034_0525015 | 3300049571 | Bacteria | 1095 |
| 454 | Ga0501034_0552590 | 3300049571 | Bacteria | 1061 |
| 455 | Ga0501034_0950622 | 3300049571 | Bacteria | 745 |
| 456 | Ga0501036_0000753 | 3300049572 | Bacteria | 23993 |
| 457 | Ga0501036_0050604 | 3300049572 | Bacteria | 3518 |
| 458 | Ga0501036_0260737 | 3300049572 | Bacteria | 1452 |
| 459 | Ga0501036_0260826 | 3300049572 | Bacteria | 1452 |
| 460 | Ga0501036_0416150 | 3300049572 | Bacteria | 1121 |
| 461 | Ga0501037_0029678 | 3300049573 | Bacteria | 4040 |
| 462 | Ga0501038_0058198 | 3300049574 | Bacteria | 3314 |
| 463 | Ga0501038_0160415 | 3300049574 | Bacteria | 1828 |
| 464 | Ga0501038_0280267 | 3300049574 | Bacteria | 1312 |
| 465 | Ga0501038_0336183 | 3300049574 | Bacteria | 1179 |
| 466 | Ga0501039_0067744 | 3300049575 | Bacteria | 2772 |
| 467 | Ga0501039_0156539 | 3300049575 | Bacteria | 1790 |
| 468 | Ga0501039_0264958 | 3300049575 | Bacteria | 1350 |
| 469 | Ga0501039_0295099 | 3300049575 | Bacteria | 1274 |
| 470 | Ga0501040_0018714 | 3300049576 | Bacteria | 4600 |
| 471 | Ga0501040_0400159 | 3300049576 | Bacteria | 986 |
| 472 | Ga0501041_0071840 | 3300049577 | Bacteria | 2125 |
| 473 | Ga0501041_0119870 | 3300049577 | Bacteria | 1635 |
| 474 | Ga0501041_0121868 | 3300049577 | Bacteria | 1621 |
| 475 | Ga0501042_0091459 | 3300049578 | Bacteria | 2184 |
| 476 | Ga0501042_0188123 | 3300049578 | Bacteria | 1489 |
| 477 | Ga0501042_0691500 | 3300049578 | Bacteria | 742 |
| 478 | Ga0501042_0714740 | 3300049578 | Bacteria | 729 |
| 479 | Ga0501043_0087216 | 3300049579 | Bacteria | 2452 |
| 480 | Ga0501043_0392807 | 3300049579 | Bacteria | 1049 |
| 481 | Ga0501046_0002625 | 3300049580 | Bacteria | 16787 |
| 482 | Ga0501046_0022425 | 3300049580 | Bacteria | 5202 |
| 483 | Ga0501046_0707133 | 3300049580 | Bacteria | 710 |
| 484 | Ga0501046_0769214 | 3300049580 | Bacteria | 676 |
| 485 | Ga0501046_1144787 | 3300049580 | Bacteria | 536 |
| 486 | Ga0501047_0032813 | 3300049581 | Bacteria | 5013 |
| 487 | Ga0501047_0119021 | 3300049581 | Bacteria | 2523 |
| 488 | Ga0501047_0242118 | 3300049581 | Bacteria | 1654 |
| 489 | Ga0501047_0250003 | 3300049581 | Bacteria | 1621 |
| 490 | Ga0501048_0089793 | 3300049582 | Bacteria | 2168 |
| 491 | Ga0501067_0006205 | 3300049583 | Bacteria | 6625 |
| 492 | Ga0501067_0063219 | 3300049583 | Bacteria | 2049 |
| 493 | Ga0501067_0214117 | 3300049583 | Bacteria | 1073 |
| 494 | Ga0501068_0114573 | 3300049584 | Bacteria | 1678 |
| 495 | Ga0501068_0681371 | 3300049584 | Bacteria | 672 |
| 496 | Ga0501069_0011030 | 3300049585 | Bacteria | 4791 |
| 497 | Ga0501069_0076967 | 3300049585 | Bacteria | 1876 |
| 498 | Ga0501070_0000242 | 3300049586 | Bacteria | 51302 |
| 499 | Ga0501070_0166494 | 3300049586 | Bacteria | 1816 |
| 500 | Ga0501070_0850966 | 3300049586 | Bacteria | 714 |
| 501 | Ga0501070_1294268 | 3300049586 | Bacteria | 557 |
| 502 | Ga0501071_0233860 | 3300049587 | Bacteria | 1385 |
| 503 | Ga0501071_0277685 | 3300049587 | Bacteria | 1268 |
| 504 | Ga0501072_0002118 | 3300049588 | Bacteria | 14789 |
| 505 | Ga0501072_0345630 | 3300049588 | Bacteria | 1181 |
| 506 | Ga0501073_0014097 | 3300049589 | Bacteria | 5807 |
| 507 | Ga0501073_0116148 | 3300049589 | Bacteria | 1855 |
| 508 | Ga0501073_0307400 | 3300049589 | Bacteria | 1094 |
| 509 | Ga0501073_0360559 | 3300049589 | Bacteria | 1004 |
| 510 | Ga0501073_0449644 | 3300049589 | Bacteria | 891 |
| 511 | Ga0501073_0829991 | 3300049589 | Bacteria | 637 |
| 512 | Ga0501073_0988083 | 3300049589 | Bacteria | 579 |
| 513 | Ga0501074_0031472 | 3300049590 | Bacteria | 3843 |
| 514 | Ga0501074_0066986 | 3300049590 | Bacteria | 2582 |
| 515 | Ga0501074_0127774 | 3300049590 | Bacteria | 1819 |
| 516 | Ga0501074_0661334 | 3300049590 | Bacteria | 738 |
| 517 | Ga0501075_0054908 | 3300049591 | Bacteria | 2997 |
| 518 | Ga0501075_0287045 | 3300049591 | Bacteria | 1254 |
| 519 | Ga0501076_0046867 | 3300049592 | Bacteria | 3416 |
| 520 | Ga0501076_0276965 | 3300049592 | Bacteria | 1374 |
| 521 | Ga0501076_0599120 | 3300049592 | Bacteria | 909 |
| 522 | Ga0501077_0085729 | 3300049593 | Bacteria | 1997 |
| 523 | Ga0501077_0086136 | 3300049593 | Bacteria | 1992 |
| 524 | Ga0501077_0175183 | 3300049593 | Bacteria | 1363 |
| 525 | Ga0501077_0490270 | 3300049593 | Bacteria | 788 |
| 526 | Ga0501079_0025203 | 3300049741 | Bacteria | 4562 |
| 527 | Ga0501079_0028532 | 3300049741 | Bacteria | 4283 |
| 528 | Ga0501079_0050032 | 3300049741 | Bacteria | 3226 |
| 529 | Ga0501079_0152010 | 3300049741 | Bacteria | 1804 |
| 530 | Ga0501079_0165712 | 3300049741 | Bacteria | 1723 |
| 531 | Ga0501079_0378312 | 3300049741 | Bacteria | 1110 |
| 532 | Ga0501080_0043318 | 3300049742 | Bacteria | 4191 |
| 533 | Ga0501080_0259611 | 3300049742 | Bacteria | 1583 |
| 534 | Ga0501080_0367925 | 3300049742 | Bacteria | 1296 |
| 535 | Ga0501081_0020823 | 3300049743 | Bacteria | 4375 |
| 536 | Ga0501081_0046910 | 3300049743 | Bacteria | 2971 |
| 537 | Ga0501081_1074571 | 3300049743 | Bacteria | 609 |
| 538 | Ga0501083_0272856 | 3300049744 | Bacteria | 1100 |
| 539 | Ga0501083_0700156 | 3300049744 | Bacteria | 659 |
| 540 | Ga0501035_0026524 | 3300049822 | Bacteria | 5300 |
| 541 | Ga0501035_0028545 | 3300049822 | Bacteria | 5093 |
| 542 | Ga0501035_0032808 | 3300049822 | Bacteria | 4723 |
| 543 | Ga0501035_0040419 | 3300049822 | Bacteria | 4214 |
| 544 | Ga0501035_1376196 | 3300049822 | Bacteria | 542 |
| 545 | Ga0501044_0020500 | 3300049823 | Bacteria | 7059 |
| 546 | Ga0501044_0104370 | 3300049823 | Bacteria | 2848 |
| 547 | Ga0501044_0140506 | 3300049823 | Bacteria | 2404 |
| 548 | Ga0501044_0235118 | 3300049823 | Bacteria | 1778 |
| 549 | Ga0501044_0573827 | 3300049823 | Bacteria | 1023 |
| 550 | Ga0501045_0083439 | 3300049824 | Bacteria | 2357 |
| 551 | Ga0501045_0218344 | 3300049824 | Bacteria | 1420 |
| 552 | Ga0501045_0295963 | 3300049824 | Bacteria | 1204 |
| 553 | Ga0501045_0313591 | 3300049824 | Bacteria | 1167 |
| 554 | Ga0501045_0517761 | 3300049824 | Bacteria | 886 |
| 555 | nmdc:mga03683_232921_c1 | 3300050489 | Bacteria | 852 |
| 556 | nmdc:mga03n38_137873_c1 | 3300050490 | Bacteria | 1216 |
| 557 | nmdc:mga03n38_199602_c1 | 3300050490 | Bacteria | 1035 |
| 558 | nmdc:mga03n38_42067_c1 | 3300050490 | Bacteria | 1995 |
| 559 | nmdc:mga03n38_8350_c1 | 3300050490 | Bacteria | 3714 |
| 560 | nmdc:mga00v17_33594_c1 | 3300050491 | Bacteria | 3041 |
| 561 | nmdc:mga0yw44_12993_c2 | 3300050492 | Bacteria | 3661 |
| 562 | nmdc:mga0yw44_284159_c1 | 3300050492 | Bacteria | 1106 |
| 563 | nmdc:mga0yw44_323961_c1 | 3300050492 | Bacteria | 1035 |
| 564 | nmdc:mga0yw44_706644_c1 | 3300050492 | Bacteria | 685 |
| 565 | nmdc:mga06z11_111959_c1 | 3300050494 | Bacteria | 1513 |
| 566 | nmdc:mga06z11_78831_c1 | 3300050494 | Bacteria | 1762 |
| 567 | nmdc:mga06z11_8359_c1 | 3300050494 | Bacteria | 4312 |
| 568 | nmdc:mga04h51_121999_c1 | 3300050495 | Bacteria | 972 |
| 569 | nmdc:mga04h51_71683_c1 | 3300050495 | Bacteria | 1211 |
| 570 | nmdc:mga07m45_261671_c1 | 3300050496 | Bacteria | 1006 |
| 571 | nmdc:mga05p37_137270_c1 | 3300050507 | Bacteria | 2997 |
| 572 | nmdc:mga05p37_1731230_c1 | 3300050507 | Bacteria | 607 |
| 573 | nmdc:mga05p37_1841647_c1 | 3300050507 | Bacteria | 581 |
| 574 | nmdc:mga05p37_293864_c1 | 3300050507 | Bacteria | 1933 |
| 575 | nmdc:mga05p37_41170_c1 | 3300050507 | Bacteria | 5673 |
| 576 | nmdc:mga05p37_539785_c1 | 3300050507 | Bacteria | 1330 |
| 577 | nmdc:mga09592_226779_c1 | 3300050508 | Bacteria | 1619 |
| 578 | nmdc:mga09592_325121_c1 | 3300050508 | Bacteria | 1332 |
| 579 | nmdc:mga09592_857266_c1 | 3300050508 | Bacteria | 766 |
| 580 | nmdc:mga0qj67_31040_c1 | 3300050509 | Bacteria | 4161 |
| 581 | nmdc:mga0qj67_35451_c1 | 3300050509 | Bacteria | 3901 |
| 582 | nmdc:mga0qj67_884256_c1 | 3300050509 | Bacteria | 704 |
| 583 | nmdc:mga06r32_162165_c1 | 3300050510 | Bacteria | 2218 |
| 584 | nmdc:mga06r32_3927_c1 | 3300050510 | Bacteria | 13335 |
| 585 | nmdc:mga06r32_434603_c2 | 3300050510 | Bacteria | 629 |
| 586 | nmdc:mga06r32_571836_c1 | 3300050510 | Bacteria | 1103 |
| 587 | nmdc:mga06r32_579776_c1 | 3300050510 | Bacteria | 1094 |
| 588 | nmdc:mga06r32_77661_c1 | 3300050510 | Bacteria | 3226 |
| 589 | nmdc:mga08y16_102827_c1 | 3300050511 | Bacteria | 2974 |
| 590 | nmdc:mga08y16_116401_c1 | 3300050511 | Bacteria | 2783 |
| 591 | nmdc:mga08y16_223420_c1 | 3300050511 | Bacteria | 1949 |
| 592 | nmdc:mga08y16_31062_c1 | 3300050511 | Bacteria | 5619 |
| 593 | nmdc:mga08y16_32052_c1 | 3300050511 | Bacteria | 5526 |
| 594 | nmdc:mga08y16_654842_c1 | 3300050511 | Bacteria | 1054 |
| 595 | nmdc:mga0n895_1044781_c1 | 3300050512 | Bacteria | 796 |
| 596 | nmdc:mga0n895_148336_c1 | 3300050512 | Bacteria | 2375 |
| 597 | nmdc:mga0n895_1509380_c1 | 3300050512 | Bacteria | 638 |
| 598 | nmdc:mga0n895_183616_c1 | 3300050512 | Bacteria | 2123 |
| 599 | nmdc:mga0n895_54152_c1 | 3300050512 | Bacteria | 3945 |
| 600 | nmdc:mga0rr50_13998_c1 | 3300050513 | Bacteria | 5244 |
| 601 | nmdc:mga0rr50_274232_c1 | 3300050513 | Bacteria | 1406 |
| 602 | nmdc:mga0rr50_34732_c1 | 3300050513 | Bacteria | 3613 |
| 603 | nmdc:mga08x19_593133_c1 | 3300050514 | Bacteria | 785 |
| 604 | nmdc:mga0a205_1161341_c1 | 3300050515 | Bacteria | 620 |
| 605 | nmdc:mga0a205_8892_c1 | 3300050515 | Bacteria | 9153 |
| 606 | Ga0495601_0141330 | 3300053077 | Bacteria | 1570 |
| 607 | Ga0495612_0022836 | 3300053078 | Bacteria | 2508 |
| 608 | Ga0495655_0313520 | 3300053083 | Bacteria | 542 |
| 609 | Ga0495595_0129100 | 3300053084 | Bacteria | 1234 |
| 610 | Ga0495619_0032928 | 3300053085 | Bacteria | 3364 |
| 611 | Ga0495619_0388935 | 3300053085 | Bacteria | 964 |
| 612 | Ga0500595_016892 | 3300053119 | Bacteria | 2709 |
| 613 | Ga0500616_0001777 | 3300053153 | Bacteria | 19704 |
| 614 | Ga0500616_0023732 | 3300053153 | Bacteria | 3414 |
| 615 | Ga0500616_0064122 | 3300053153 | Bacteria | 1893 |
| 616 | Ga0500616_0240723 | 3300053153 | Bacteria | 778 |
| 617 | Ga0500620_272549 | 3300053155 | Bacteria | 557 |
| 618 | Ga0500624_003122 | 3300053157 | Bacteria | 2184 |
| 619 | Ga0501084_0024059 | 3300054114 | Bacteria | 5079 |
| 620 | Ga0501084_0027792 | 3300054114 | Bacteria | 4727 |
| 621 | Ga0501084_0140436 | 3300054114 | Bacteria | 2034 |
| 622 | Ga0501084_1680323 | 3300054114 | Bacteria | 531 |
| 623 | Ga0587077_174194 | 3300059493 | Bacteria | 578 |
| 624 | Ga0587071_061658 | 3300060344 | Bacteria | 798 |
| 625 | Ga0587111_0071714 | 3300060346 | Bacteria | 810 |
| 626 | Ga0501082_0119060 | 3300060353 | Bacteria | 2288 |
| 627 | Ga0501082_0320960 | 3300060353 | Bacteria | 1349 |
| 628 | Ga0501082_0352413 | 3300060353 | Bacteria | 1283 |
| 629 | Ga0501082_0425684 | 3300060353 | Bacteria | 1159 |
| 630 | Ga0501082_1183145 | 3300060353 | Bacteria | 668 |
| 631 | Ga0530510_0053728 | 3300061734 | Bacteria | 2910 |
| 632 | Ga0530510_0097227 | 3300061734 | Bacteria | 2152 |
| 633 | Ga0530510_0621811 | 3300061734 | Bacteria | 822 |
| 634 | 2507509797 | 2507262055 | Bacteria | 8048963 |
| 635 | 2508543813 | 2508501009 | Bacteria | 7784016 |
| 636 | 2508698399 | 2508501042 | Bacteria | 8719808 |
| 637 | 2513679088 | 2513237098 | Bacteria | 9902361 |
| 638 | 2513695960 | 2513237101 | Bacteria | 7952346 |
| 639 | 2513857554 | 2513237137 | Bacteria | 9558895 |
| 640 | 2515629991 | 2515154112 | Bacteria | 8294334 |
| 641 | 2517893506 | 2517572143 | Bacteria | 9484767 |
| 642 | 2524469954 | 2524023210 | Bacteria | 9029266 |
| 643 | 2644287934 | 2643221651 | Bacteria | 4798932 |
| 644 | 2671118142 | 2667528175 | Bacteria | 7532676 |
| 645 | 2723846189 | 2721755755 | Bacteria | 8322773 |
| 646 | 2728747731 | 2728368998 | Bacteria | 8720350 |
| 647 | 2849080435 | 2849076700 | Bacteria | 7039503 |
| 648 | 2874595094 | 2874590934 | Bacteria | 8299676 |
| 649 | 2874610896 | 2874604998 | Bacteria | 7834745 |
| 650 | 2874632670 | 2874628541 | Bacteria | 8630250 |
| 651 | 2874650955 | 2874645413 | Bacteria | 8214782 |
| 652 | 2876775030 | 2876771140 | Bacteria | 8287509 |
| 653 | 2876823845 | 2876818435 | Bacteria | 8274608 |
| 654 | 2879080473 | 2879074833 | Bacteria | 8279565 |
| 655 | 2879134921 | 2879127579 | Bacteria | 8294491 |
| 656 | 2879149231 | 2879142872 | Bacteria | 8267021 |
| 657 | 2885380965 | 2885374607 | Bacteria | 8927485 |
| 658 | 2885384464 | 2885383462 | Bacteria | 9473874 |
| 659 | 2888395002 | 2888388044 | Bacteria | 7304136 |
| 660 | 2906610389 | |||
| 661 | 2906628288 | 2906626472 | Bacteria | 8826946 |
| 662 | 2906642807 | 2906635258 | Bacteria | 8601019 |
| 663 | 2906665942 | 2906660503 | Bacteria | 8595048 |
| 664 | 2908778921 | 2908775508 | Bacteria | 8092255 |
| 665 | 2922428972 | |||
| 666 | 2932800422 | 2932794094 | Bacteria | 7915132 |
| 667 | 2932804596 | 2932801729 | Bacteria | 7987968 |
| 668 | 2935611344 | 2935608549 | Bacteria | 8203142 |
| 669 | 2935637765 | 2935630451 | Bacteria | 8169952 |
| 670 | 2935648728 | 2935648319 | Bacteria | 8801166 |
| 671 | 2935657189 | 2935656913 | Bacteria | 8965014 |
| 672 | 2935775281 | 2935769743 | Bacteria | 7878163 |
| 673 | 2935779518 | 2935777560 | Bacteria | 8077691 |
| 674 | 2935791521 | 2935785616 | Bacteria | 7962367 |
| 675 | 2935799833 | 2935793552 | Bacteria | 8012592 |
| 676 | 2935820821 | 2935819856 | Bacteria | 8261050 |
| 677 | 2935850919 | 2935847175 | Bacteria | 8228321 |
| 678 | 2935889789 | 2935883170 | Bacteria | 7964738 |
| 679 | 2935913714 | 2935908558 | Bacteria | 8568796 |
| 680 | 2935920296 | 2935916978 | Bacteria | 9113783 |
| 681 | 2935930635 | 2935926038 | Bacteria | 8601059 |
| 682 | 2935939392 | 2935934488 | Bacteria | 8602579 |
| 683 | 2935946341 | 2935942939 | Bacteria | 8599779 |
| 684 | 2935955820 | 2935951376 | Bacteria | 8602333 |
| 685 | 2935966976 | 2935959822 | Bacteria | 7869783 |
| 686 | 2935972470 | 2935967501 | Bacteria | 8603075 |
| 687 | 2935981699 | 2935975950 | Bacteria | 8347125 |
| 688 | 2935991074 | 2935984226 | Bacteria | 8302647 |
| 689 | 2936011638 | 2936011229 | Bacteria | 8801034 |
| 690 | 2936020233 | 2936019824 | Bacteria | 8804134 |
| 691 | 2936028928 | 2936028420 | Bacteria | 8965941 |
| 692 | 2936046956 | 2936046547 | Bacteria | 8903709 |
| 693 | 2936058164 | 2936055302 | Bacteria | 8785755 |
| 694 | 2941514438 | 2941507105 | Bacteria | 8166816 |
| 695 | 2941522334 | 2941515067 | Bacteria | 8166720 |
| 696 | 2941530147 | 2941523033 | Bacteria | 8169134 |
| 697 | 2941536107 | 2941531003 | Bacteria | 7653939 |
| 698 | 8006964547 | 8006964411 | Bacteria | 8966052 |
| 699 | 8006996053 | 8006994254 | Bacteria | 8309700 |
| 700 | 8016530803 | 8016522445 | Bacteria | 8156687 |
| 701 | 8016536093 | 8016530956 | Bacteria | 8155261 |
| 702 | 8016540375 | 8016539877 | Bacteria | 8155419 |
| 703 | 8016552860 | 8016548790 | Bacteria | 8155074 |
| 704 | 8016574443 | 8016566248 | Bacteria | 8158151 |
| 705 | 8016578538 | 8016575299 | Bacteria | 8154085 |
| 706 | 8016591224 | 8016583857 | Bacteria | 10421953 |
| 707 | 8016599096 | 8016595262 | Bacteria | 8149947 |
| 708 | 8016611955 | 8016603502 | Bacteria | 8731218 |
| 709 | 8016621850 | 8016613128 | Bacteria | 8794220 |
| 710 | 8016628003 | 8016622563 | Bacteria | 7999408 |
| 711 | 8016632326 | 8016630954 | Bacteria | 9217207 |
| 712 | 8019535818 | 8019530166 | Bacteria | 8155624 |
| 713 | 8019543659 | 8019538911 | Bacteria | 7872763 |
| 714 | 8019555116 | 8019547302 | Bacteria | 7996444 |
| 715 | 8019557956 | 8019555841 | Bacteria | 9642137 |
| 716 | 8019567329 | 8019565922 | Bacteria | 9639779 |
| 717 | 8019626802 | 8019619141 | Bacteria | 9218857 |
| 718 | 8019635707 | 8019629233 | Bacteria | 8687553 |
| 719 | 8019643976 | 8019638758 | Bacteria | 9062356 |
| 720 | 8019663505 | 8019659431 | Bacteria | 8577854 |
| 721 | 8019673117 | 8019668869 | Bacteria | 8791617 |
| 722 | 8019688723 | 8019687851 | Bacteria | 8712826 |
| 723 | Ga0070668_100177547 | |||
| 724 | JGI25404J52841_10013039 | |||
| 725 | Ga0070690_100207609 | |||
| 726 | Ga0070670_100953842 | |||
| 727 | Ga0068869_100017207 | |||
| 728 | Ga0068869_100347269 | |||
| 729 | Ga0070666_10866435 | |||
| 730 | Ga0070680_100003246 | |||
| 731 | Ga0070680_100012371 | |||
| 732 | Ga0070682_100039845 | |||
| 733 | Ga0070682_101132594 | |||
| 734 | Ga0070660_100011063 | |||
| 735 | Ga0070689_100938919 | |||
| 736 | Ga0070691_10016888 | |||
| 737 | Ga0070691_10066283 | |||
| 738 | Ga0070687_100168920 | |||
| 739 | Ga0070661_100056615 | |||
| 740 | Ga0070661_100596075 | |||
| 741 | Ga0070692_10054754 | |||
| 742 | Ga0070668_100846874 | |||
| 743 | Ga0070668_100863339 | |||
| 744 | Ga0070675_100393686 | |||
| 745 | Ga0070671_100916296 | |||
| 746 | Ga0070688_100059674 | |||
| 747 | Ga0070659_100036234 | |||
| 748 | Ga0070659_101633101 | |||
| 749 | Ga0070667_100641913 | |||
| 750 | Ga0070701_10005417 | |||
| 751 | Ga0070705_100006514 | |||
| 752 | Ga0070705_100006625 | |||
| 753 | Ga0070705_100369103 | |||
| 754 | Ga0070700_100010147 | |||
| 755 | Ga0070700_100065299 | |||
| 756 | Ga0070700_100119275 | |||
| 757 | Ga0070700_100297258 | |||
| 758 | Ga0070700_101203048 | |||
| 759 | Ga0070694_100007558 | |||
| 760 | Ga0070694_100793719 | |||
| 761 | Ga0070694_101069482 | |||
| 762 | Ga0070694_101168248 | |||
| 763 | Ga0070708_100050222 | |||
| 764 | Ga0070663_100011644 | |||
| 765 | Ga0070663_100016160 | |||
| 766 | Ga0070663_100358023 | |||
| 767 | Ga0070663_100852641 | |||
| 768 | Ga0070678_100141450 | |||
| 769 | Ga0070678_100676193 | |||
| 770 | Ga0070662_100293724 | |||
| 771 | Ga0070681_10011583 | |||
| 772 | Ga0070681_10088487 | |||
| 773 | Ga0068867_100505778 | |||
| 774 | Ga0070685_10263439 | |||
| 775 | Ga0070685_10836668 | |||
| 776 | Ga0070706_100367797 | |||
| 777 | Ga0070707_100175421 | |||
| 778 | Ga0070707_100202029 | |||
| 779 | Ga0070707_100231769 | |||
| 780 | Ga0070698_100206881 | |||
| 781 | Ga0070698_100416867 | |||
| 782 | Ga0070699_100002571 | |||
| 783 | Ga0070699_100200880 | |||
| 784 | Ga0070679_100049281 | |||
| 785 | Ga0070679_100184324 | |||
| 786 | Ga0070697_100119057 | |||
| 787 | Ga0070697_100239221 | |||
| 788 | Ga0068853_100040534 | |||
| 789 | Ga0070686_100461855 | |||
| 790 | Ga0070686_101170219 | |||
| 791 | Ga0070686_101457915 | |||
| 792 | Ga0070695_100001778 | |||
| 793 | Ga0070695_100018719 | |||
| 794 | Ga0070695_100058175 | |||
| 795 | Ga0070696_100008610 | |||
| 796 | Ga0070696_100022490 | |||
| 797 | Ga0070693_100002809 | |||
| 798 | Ga0070693_100079822 | |||
| 799 | Ga0070704_100057353 | |||
| 800 | Ga0070704_100088993 | |||
| 801 | Ga0070704_100097286 | |||
| 802 | Ga0070704_101088317 | |||
| 803 | Ga0068855_100091602 | |||
| 804 | Ga0070664_100046396 | |||
| 805 | Ga0068857_100162572 | |||
| 806 | Ga0068856_100129197 | |||
| 807 | Ga0070702_100097041 | |||
| 808 | Ga0068852_100159356 | |||
| 809 | Ga0068859_100065425 | |||
| 810 | Ga0068859_100640820 | |||
| 811 | Ga0068859_101210556 | |||
| 812 | Ga0068864_100006580 | |||
| 813 | Ga0068864_101629155 | |||
| 814 | Ga0068864_101667966 | |||
| 815 | Ga0068861_100079500 | |||
| 816 | Ga0068861_100265776 | |||
| 817 | Ga0068861_101508435 | |||
| 818 | Ga0068870_10022374 | |||
| 819 | Ga0068863_100437090 | |||
| 820 | Ga0068863_100545102 | |||
| 821 | Ga0068863_100970397 | |||
| 822 | Ga0068863_101703929 | |||
| 823 | Ga0068858_100159505 | |||
| 824 | Ga0068858_100439137 | |||
| 825 | Ga0068860_100010003 | |||
| 826 | Ga0068860_100027772 | |||
| 827 | Ga0068860_100172720 | |||
| 828 | Ga0068860_100197112 | |||
| 829 | Ga0068860_100854376 | |||
| 830 | Ga0068860_101631456 | |||
| 831 | Ga0068862_100002462 | |||
| 832 | Ga0068862_100048738 | |||
| 833 | Ga0068862_100117287 | |||
| 834 | Ga0068862_101363967 | |||
| 835 | Ga0068862_101953986 | |||
| 836 | Ga0081455_10004292 | |||
| 837 | Ga0081540_1001954 | |||
| 838 | Ga0081540_1194546 | |||
| 839 | Ga0081539_10050840 | |||
| 840 | Ga0081539_10153925 | |||
| 841 | Ga0075365_10075468 | |||
| 842 | Ga0075365_10395002 | |||
| 843 | Ga0075365_10459969 | |||
| 844 | Ga0075368_10002966 | |||
| 845 | Ga0075363_100055511 | |||
| 846 | Ga0075363_100127531 | |||
| 847 | Ga0075363_100144396 | |||
| 848 | Ga0075364_10011733 | |||
| 849 | Ga0070715_10040617 | |||
| 850 | Ga0070715_10625488 | |||
| 851 | Ga0075362_10065919 | |||
| 852 | Ga0075362_10550676 | |||
| 853 | Ga0075367_10032301 | |||
| 854 | Ga0075367_10371469 | |||
| 855 | Ga0075367_10431717 | |||
| 856 | Ga0097621_100782396 | |||
| 857 | Ga0075370_10302785 | |||
| 858 | Ga0075428_100012165 | |||
| 859 | Ga0075428_100111245 | |||
| 860 | Ga0075428_100135033 | |||
| 861 | Ga0075428_100255326 | |||
| 862 | Ga0075428_100931920 | |||
| 863 | Ga0075430_100075551 | |||
| 864 | Ga0075430_100551215 | |||
| 865 | Ga0075430_100832358 | |||
| 866 | Ga0075430_101437425 | |||
| 867 | Ga0075431_100024490 | |||
| 868 | Ga0075431_100080320 | |||
| 869 | Ga0075431_100174899 | |||
| 870 | Ga0075431_100227684 | |||
| 871 | Ga0075431_100297926 | |||
| 872 | Ga0075433_10195674 | |||
| 873 | Ga0075433_10250798 | |||
| 874 | Ga0075433_10742806 | |||
| 875 | Ga0075433_11574617 | |||
| 876 | Ga0075434_100040464 | |||
| 877 | Ga0075434_100062343 | |||
| 878 | Ga0075434_100203790 | |||
| 879 | Ga0075429_100219257 | |||
| 880 | Ga0075429_100387625 | |||
| 881 | Ga0068865_100677427 | |||
| 882 | Ga0075436_100982911 | |||
| 883 | Ga0097620_100065425 | |||
| 884 | Ga0097620_100640805 | |||
| 885 | Ga0097620_101210553 | |||
| 886 | Ga0075435_100018160 | |||
| 887 | Ga0075435_100742246 | |||
| 888 | Ga0099795_10040854 | |||
| 889 | Ga0111539_10006608 | |||
| 890 | Ga0111539_10017896 | |||
| 891 | Ga0111539_10058172 | |||
| 892 | Ga0111539_10278767 | |||
| 893 | Ga0111539_10342289 | |||
| 894 | Ga0111539_10391169 | |||
| 895 | Ga0111539_10837204 | |||
| 896 | Ga0105245_10036863 | |||
| 897 | Ga0105245_10135230 | |||
| 898 | Ga0105245_11170772 | |||
| 899 | Ga0105247_10348247 | |||
| 900 | Ga0105247_10602056 | |||
| 901 | Ga0114129_10057856 | |||
| 902 | Ga0114129_10391109 | |||
| 903 | Ga0114129_10702845 | |||
| 904 | Ga0114129_10803790 | |||
| 905 | Ga0114129_11244173 | |||
| 906 | Ga0114129_13219384 | |||
| 907 | Ga0105243_10028727 | |||
| 908 | Ga0105243_10728075 | |||
| 909 | Ga0105243_10776325 | |||
| 910 | Ga0105242_10551877 | |||
| 911 | Ga0105248_10967282 | |||
| 912 | Ga0105248_11316311 | |||
| 913 | Ga0105237_10018592 | |||
| 914 | Ga0105238_10130927 | |||
| 915 | Ga0105249_10013294 | |||
| 916 | Ga0105249_10780662 | |||
| 917 | Ga0105249_11953063 | |||
| 918 | Ga0105249_12019405 | |||
| 919 | Ga0105239_11351728 | |||
| 920 | Ga0105246_11170539 | |||
| 921 | Ga0157370_10641961 | |||
| 922 | Ga0157369_10398692 | |||
| 923 | Ga0157378_10040081 | |||
| 924 | Ga0157378_11722719 | |||
| 925 | Ga0163162_10310482 | |||
| 926 | Ga0163162_10525496 | |||
| 927 | Ga0157375_10047041 | |||
| 928 | Ga0157375_10073534 | |||
| 929 | Ga0157375_11063063 | |||
| 930 | Ga0157380_10185573 | |||
| 931 | Ga0157380_10246770 | |||
| 932 | Ga0157380_10390461 | |||
| 933 | Ga0157380_10579920 | |||
| 934 | Ga0157379_10085624 | |||
| 935 | Ga0157379_10386304 | |||
| 936 | Ga0157379_11711526 | |||
| 937 | Ga0157376_10410533 | |||
| 938 | Ga0163161_10409437 | |||
| 939 | Ga0163161_10640657 | |||
| 940 | Ga0206356_10381984 | |||
| 941 | Ga0207682_10010123 | |||
| 942 | Ga0207642_10490562 | |||
| 943 | Ga0207710_10226116 | |||
| 944 | Ga0207680_10554644 | |||
| 945 | Ga0207647_10017465 | |||
| 946 | Ga0207647_10033997 | |||
| 947 | Ga0207685_10754860 | |||
| 948 | Ga0207645_11002160 | |||
| 949 | Ga0207684_11089209 | |||
| 950 | Ga0207707_10011417 | |||
| 951 | Ga0207671_10033313 | |||
| 952 | Ga0207660_10008218 | |||
| 953 | Ga0207660_10010703 | |||
| 954 | Ga0207662_10090791 | |||
| 955 | Ga0207662_10105148 | |||
| 956 | Ga0207657_10017375 | |||
| 957 | Ga0207657_10797034 | |||
| 958 | Ga0207649_10084482 | |||
| 959 | Ga0207652_10046567 | |||
| 960 | Ga0207652_10228862 | |||
| 961 | Ga0207646_10092622 | |||
| 962 | Ga0207646_10138234 | |||
| 963 | Ga0207646_10954169 | |||
| 964 | Ga0207694_10023053 | |||
| 965 | Ga0207650_11082479 | |||
| 966 | Ga0207659_11072044 | |||
| 967 | Ga0207687_10039500 | |||
| 968 | Ga0207686_10459411 | |||
| 969 | Ga0207709_10029931 | |||
| 970 | Ga0207709_10108617 | |||
| 971 | Ga0207709_10152056 | |||
| 972 | Ga0207711_11414723 | |||
| 973 | Ga0207689_10107639 | |||
| 974 | Ga0207689_10278862 | |||
| 975 | Ga0207689_10381907 | |||
| 976 | Ga0207689_10840206 | |||
| 977 | Ga0207679_10050613 | |||
| 978 | Ga0207712_10002234 | |||
| 979 | Ga0207668_10217050 | |||
| 980 | Ga0207668_10436338 | |||
| 981 | Ga0207640_10547666 | |||
| 982 | Ga0207640_11212248 | |||
| 983 | Ga0207658_10205325 | |||
| 984 | Ga0207677_10046600 | |||
| 985 | Ga0207703_10096381 | |||
| 986 | Ga0207703_10444567 | |||
| 987 | Ga0207703_10616064 | |||
| 988 | Ga0207639_10029939 | |||
| 989 | Ga0207678_10000118 | |||
| 990 | Ga0207678_10034068 | |||
| 991 | Ga0207678_10164622 | |||
| 992 | Ga0207708_10016120 | |||
| 993 | Ga0207708_10022034 | |||
| 994 | Ga0207708_10123889 | |||
| 995 | Ga0207708_10267685 | |||
| 996 | Ga0207708_10319101 | |||
| 997 | Ga0207708_11171454 | |||
| 998 | Ga0207702_10076598 | |||
| 999 | Ga0207641_10193783 | |||
| 1000 | Ga0207676_10381975 | |||
| 1001 | Ga0207676_10517364 | |||
| 1002 | Ga0207674_10184695 | |||
| 1003 | Ga0207675_100028558 | |||
| 1004 | Ga0207675_100034087 | |||
| 1005 | Ga0207675_100067569 | |||
| 1006 | Ga0207675_100150669 | |||
| 1007 | Ga0207683_10035272 | |||
| 1008 | Ga0207683_10433261 | |||
| 1009 | Ga0209813_10008787 | |||
| 1010 | Ga0209813_10060135 | |||
| 1011 | Ga0207428_10008077 | |||
| 1012 | Ga0207428_10019254 | |||
| 1013 | Ga0207428_10261969 | |||
| 1014 | Ga0207428_10481845 | |||
| 1015 | Ga0268265_10138589 | |||
| 1016 | Ga0268265_10665476 | |||
| 1017 | Ga0268264_10005854 | |||
| 1018 | Ga0268264_10034682 | |||
| 1019 | Ga0268264_10173935 | |||
| 1020 | Ga0268264_10825641 | |||
| 1021 | Ga0268264_11641533 | |||
| 1022 | Ga0265340_10032122 | |||
| 1023 | Ga0265316_10095094 | |||
| 1024 | Ga0307408_100071207 | |||
| 1025 | Ga0316575_10358619 | |||
| 1026 | Ga0316576_10023973 | |||
| 1027 | Ga0316578_10213872 | |||
| 1028 | Ga0307405_10078680 | |||
| 1029 | Ga0307413_10260354 | |||
| 1030 | Ga0307410_10649297 | |||
| 1031 | Ga0307409_100198315 | |||
| 1032 | Ga0307416_100478881 | |||
| 1033 | Ga0307411_10036612 | |||
| 1034 | Ga0307415_101182778 | |||
| 1035 | Ga0316586_1007657 | |||
| 1036 | Ga0316588_1037631 | |||
| 1037 | Ga0316596_1001444 | |||
| 1038 | Ga0373958_0007762 | |||
| 1039 | Ga0373938_0005076 | |||
| 1040 | Ga0373934_0069895 | |||
| 1041 | Ga0373940_0000987 | |||
| 1042 | Ga0373949_0149587 | |||
| 1043 | Ga0373952_0007818 | |||
| 1044 | Ga0373952_0034555 | |||
| 1045 | Ga0373923_0160862 | |||
| 1046 | Ga0373923_0362289 | |||
| 1047 | Ga0373932_0090783 | |||
| 1048 | Ga0373939_0002313 | |||
| 1049 | Ga0373953_0004766 | |||
| 1050 | Ga0373954_0028040 | |||
| 1051 | Ga0373954_0309950 | |||
| 1052 | Ga0373956_0010844 | |||
| 1053 | Ga0373957_0051784 | |||
| 1054 | Ga0373955_0077990 | |||
| 1055 | Ga0373942_0016431 | |||
| 1056 | Ga0373961_0008792 | |||
| 1057 | Ga0316574_0268202 | |||
| 1058 | Ga0316574_0316988 | |||
| 1059 | Ga0373931_0000685 | |||
| 1060 | Ga0373931_0008373 | |||
| 1061 | Ga0373927_0743414 | |||
| 1062 | Ga0373947_0111676 | |||
| 1063 | Ga0373937_0615671 | |||
| 1064 | Ga0316582_0262595 | |||
| 1065 | Ga0316584_0031109 | |||
| 1066 | Ga0395905_0000002 | |||
| 1067 | Ga0400486_32257 | |||
| 1068 | Ga0400487_44160 | |||
| 1069 | Ga0436365_0741969 | |||
| 1070 | Ga0436363_0062250 | |||
| 1071 | Ga0436363_0270409 | |||
| 1072 | Ga0436362_1178884 | |||
| 1073 | Ga0453683_0443351 | |||
| 1074 | Ga0453684_0445324 | |||
| 1075 | Ga0495617_098917 | |||
| 1076 | Ga0495592_0331962 | |||
| 1077 | Ga0495603_0025882 | |||
| 1078 | Ga0495638_0420545 | |||
| 1079 | Ga0495653_0575345 | |||
| 1080 | Ga0495664_0540742 | |||
| 1081 | Ga0495608_0257843 | |||
| 1082 | Ga0495618_0233070 | |||
| 1083 | Ga0495628_0201429 | |||
| 1084 | Ga0495652_0317586 | |||
| 1085 | Ga0495645_0361513 | |||
| 1086 | Ga0495633_0126077 | |||
| 1087 | Ga0495667_0071936 | |||
| 1088 | Ga0495656_0444313 | |||
| 1089 | Ga0495625_0128806 | |||
| 1090 | Ga0495625_0152947 | |||
| 1091 | Ga0495625_0389362 | |||
| 1092 | Ga0495625_0400847 | |||
| 1093 | Ga0495635_0892186 | |||
| 1094 | Ga0495657_0337742 | |||
| 1095 | Ga0495658_0250139 | |||
| 1096 | Ga0495658_0250931 | |||
| 1097 | Ga0495649_0115869 | |||
| 1098 | Ga0495600_0645807 | |||
| 1099 | Ga0495604_0159833 | |||
| 1100 | Ga0495674_0438943 | |||
| 1101 | Ga0495672_0093550 | |||
| 1102 | Ga0495675_0104893 | |||
| 1103 | Ga0495602_0092704 | |||
| 1104 | Ga0495615_0062628 | |||
| 1105 | Ga0496100_0020609 | |||
| 1106 | Ga0496100_0035344 | |||
| 1107 | Ga0496101_0006539 | |||
| 1108 | Ga0496101_0024585 | |||
| 1109 | Ga0496101_0188547 | |||
| 1110 | Ga0496102_0008953 | |||
| 1111 | Ga0496102_0025641 | |||
| 1112 | Ga0496102_0138502 | |||
| 1113 | Ga0496102_0356934 | |||
| 1114 | Ga0496102_0559746 | |||
| 1115 | Ga0496102_0649976 | |||
| 1116 | Ga0496103_0023955 | |||
| 1117 | Ga0496103_0284503 | |||
| 1118 | Ga0496104_0000216 | |||
| 1119 | Ga0496104_0095241 | |||
| 1120 | Ga0496104_0225123 | |||
| 1121 | Ga0496104_0270537 | |||
| 1122 | Ga0496104_0375934 | |||
| 1123 | Ga0496104_0820865 | |||
| 1124 | Ga0496105_0072606 | |||
| 1125 | Ga0496105_0236024 | |||
| 1126 | Ga0496105_0511263 | |||
| 1127 | Ga0496105_0608655 | |||
| 1128 | Ga0496105_0659401 | |||
| 1129 | Ga0496106_0007414 | |||
| 1130 | Ga0496106_0008312 | |||
| 1131 | Ga0496106_0107769 | |||
| 1132 | Ga0496106_0126584 | |||
| 1133 | Ga0496107_0009695 | |||
| 1134 | Ga0496107_0065436 | |||
| 1135 | Ga0496107_0464494 | |||
| 1136 | Ga0496107_0527942 | |||
| 1137 | Ga0496108_0011283 | |||
| 1138 | Ga0496108_0202215 | |||
| 1139 | Ga0496108_1109627 | |||
| 1140 | Ga0496109_0033418 | |||
| 1141 | Ga0496109_0280252 | |||
| 1142 | Ga0496109_0576459 | |||
| 1143 | Ga0496109_0947992 | |||
| 1144 | Ga0496110_0000957 | |||
| 1145 | Ga0496110_0034389 | |||
| 1146 | Ga0496110_0148815 | |||
| 1147 | Ga0496110_0648584 | |||
| 1148 | Ga0496110_1031465 | |||
| 1149 | Ga0496111_0123557 | |||
| 1150 | Ga0496111_0160560 | |||
| 1151 | Ga0496111_0168577 | |||
| 1152 | Ga0496111_0371201 | |||
| 1153 | Ga0496111_1348283 | |||
| 1154 | Ga0496112_0020950 | |||
| 1155 | Ga0496112_0557778 | |||
| 1156 | Ga0496112_0710527 | |||
| 1157 | Ga0496113_0004691 | |||
| 1158 | Ga0496113_0544249 | |||
| 1159 | Ga0496114_0032687 | |||
| 1160 | Ga0496114_0526604 | |||
| 1161 | Ga0496114_0595315 | |||
| 1162 | Ga0496114_1252425 | |||
| 1163 | Ga0496115_0010086 | |||
| 1164 | Ga0496115_0049897 | |||
| 1165 | Ga0496115_0320733 | |||
| 1166 | Ga0496115_0564875 | |||
| 1167 | Ga0496115_1267349 | |||
| 1168 | Ga0496124_0584017 | |||
| 1169 | Ga0501031_0045435 | |||
| 1170 | Ga0501032_0205650 | |||
| 1171 | Ga0501033_0020839 | |||
| 1172 | Ga0501033_0386197 | |||
| 1173 | Ga0501034_0035297 | |||
| 1174 | Ga0501034_0130903 | |||
| 1175 | Ga0501034_0525015 | |||
| 1176 | Ga0501034_0552590 | |||
| 1177 | Ga0501034_0950622 | |||
| 1178 | Ga0501036_0000753 | |||
| 1179 | Ga0501036_0050604 | |||
| 1180 | Ga0501036_0260737 | |||
| 1181 | Ga0501036_0260826 | |||
| 1182 | Ga0501036_0416150 | |||
| 1183 | Ga0501037_0029678 | |||
| 1184 | Ga0501038_0058198 | |||
| 1185 | Ga0501038_0160415 | |||
| 1186 | Ga0501038_0280267 | |||
| 1187 | Ga0501038_0336183 | |||
| 1188 | Ga0501039_0067744 | |||
| 1189 | Ga0501039_0156539 | |||
| 1190 | Ga0501039_0264958 | |||
| 1191 | Ga0501039_0295099 | |||
| 1192 | Ga0501040_0018714 | |||
| 1193 | Ga0501040_0400159 | |||
| 1194 | Ga0501041_0071840 | |||
| 1195 | Ga0501041_0119870 | |||
| 1196 | Ga0501041_0121868 | |||
| 1197 | Ga0501042_0091459 | |||
| 1198 | Ga0501042_0188123 | |||
| 1199 | Ga0501042_0691500 | |||
| 1200 | Ga0501042_0714740 | |||
| 1201 | Ga0501043_0087216 | |||
| 1202 | Ga0501043_0392807 | |||
| 1203 | Ga0501046_0002625 | |||
| 1204 | Ga0501046_0022425 | |||
| 1205 | Ga0501046_0707133 | |||
| 1206 | Ga0501046_0769214 | |||
| 1207 | Ga0501046_1144787 | |||
| 1208 | Ga0501047_0032813 | |||
| 1209 | Ga0501047_0119021 | |||
| 1210 | Ga0501047_0242118 | |||
| 1211 | Ga0501047_0250003 | |||
| 1212 | Ga0501048_0089793 | |||
| 1213 | Ga0501067_0006205 | |||
| 1214 | Ga0501067_0063219 | |||
| 1215 | Ga0501067_0214117 | |||
| 1216 | Ga0501068_0114573 | |||
| 1217 | Ga0501068_0681371 | |||
| 1218 | Ga0501069_0011030 | |||
| 1219 | Ga0501069_0076967 | |||
| 1220 | Ga0501070_0000242 | |||
| 1221 | Ga0501070_0166494 | |||
| 1222 | Ga0501070_0850966 | |||
| 1223 | Ga0501070_1294268 | |||
| 1224 | Ga0501071_0233860 | |||
| 1225 | Ga0501071_0277685 | |||
| 1226 | Ga0501072_0002118 | |||
| 1227 | Ga0501072_0345630 | |||
| 1228 | Ga0501073_0014097 | |||
| 1229 | Ga0501073_0116148 | |||
| 1230 | Ga0501073_0307400 | |||
| 1231 | Ga0501073_0360559 | |||
| 1232 | Ga0501073_0449644 | |||
| 1233 | Ga0501073_0829991 | |||
| 1234 | Ga0501073_0988083 | |||
| 1235 | Ga0501074_0031472 | |||
| 1236 | Ga0501074_0066986 | |||
| 1237 | Ga0501074_0127774 | |||
| 1238 | Ga0501074_0661334 | |||
| 1239 | Ga0501075_0054908 | |||
| 1240 | Ga0501075_0287045 | |||
| 1241 | Ga0501076_0046867 | |||
| 1242 | Ga0501076_0276965 | |||
| 1243 | Ga0501076_0599120 | |||
| 1244 | Ga0501077_0085729 | |||
| 1245 | Ga0501077_0086136 | |||
| 1246 | Ga0501077_0175183 | |||
| 1247 | Ga0501077_0490270 | |||
| 1248 | Ga0501079_0025203 | |||
| 1249 | Ga0501079_0028532 | |||
| 1250 | Ga0501079_0050032 | |||
| 1251 | Ga0501079_0152010 | |||
| 1252 | Ga0501079_0165712 | |||
| 1253 | Ga0501079_0378312 | |||
| 1254 | Ga0501080_0043318 | |||
| 1255 | Ga0501080_0259611 | |||
| 1256 | Ga0501080_0367925 | |||
| 1257 | Ga0501081_0020823 | |||
| 1258 | Ga0501081_0046910 | |||
| 1259 | Ga0501081_1074571 | |||
| 1260 | Ga0501083_0272856 | |||
| 1261 | Ga0501083_0700156 | |||
| 1262 | Ga0501035_0026524 | |||
| 1263 | Ga0501035_0028545 | |||
| 1264 | Ga0501035_0032808 | |||
| 1265 | Ga0501035_0040419 | |||
| 1266 | Ga0501035_1376196 | |||
| 1267 | Ga0501044_0020500 | |||
| 1268 | Ga0501044_0104370 | |||
| 1269 | Ga0501044_0140506 | |||
| 1270 | Ga0501044_0235118 | |||
| 1271 | Ga0501044_0573827 | |||
| 1272 | Ga0501045_0083439 | |||
| 1273 | Ga0501045_0218344 | |||
| 1274 | Ga0501045_0295963 | |||
| 1275 | Ga0501045_0313591 | |||
| 1276 | Ga0501045_0517761 | |||
| 1277 | nmdc:mga03683_232921_c1 | |||
| 1278 | nmdc:mga03n38_137873_c1 | |||
| 1279 | nmdc:mga03n38_199602_c1 | |||
| 1280 | nmdc:mga03n38_42067_c1 | |||
| 1281 | nmdc:mga03n38_8350_c1 | |||
| 1282 | nmdc:mga00v17_33594_c1 | |||
| 1283 | nmdc:mga0yw44_12993_c2 | |||
| 1284 | nmdc:mga0yw44_284159_c1 | |||
| 1285 | nmdc:mga0yw44_323961_c1 | |||
| 1286 | nmdc:mga0yw44_706644_c1 | |||
| 1287 | nmdc:mga06z11_111959_c1 | |||
| 1288 | nmdc:mga06z11_78831_c1 | |||
| 1289 | nmdc:mga06z11_8359_c1 | |||
| 1290 | nmdc:mga04h51_121999_c1 | |||
| 1291 | nmdc:mga04h51_71683_c1 | |||
| 1292 | nmdc:mga07m45_261671_c1 | |||
| 1293 | nmdc:mga05p37_137270_c1 | |||
| 1294 | nmdc:mga05p37_1731230_c1 | |||
| 1295 | nmdc:mga05p37_1841647_c1 | |||
| 1296 | nmdc:mga05p37_293864_c1 | |||
| 1297 | nmdc:mga05p37_41170_c1 | |||
| 1298 | nmdc:mga05p37_539785_c1 | |||
| 1299 | nmdc:mga09592_226779_c1 | |||
| 1300 | nmdc:mga09592_325121_c1 | |||
| 1301 | nmdc:mga09592_857266_c1 | |||
| 1302 | nmdc:mga0qj67_31040_c1 | |||
| 1303 | nmdc:mga0qj67_35451_c1 | |||
| 1304 | nmdc:mga0qj67_884256_c1 | |||
| 1305 | nmdc:mga06r32_162165_c1 | |||
| 1306 | nmdc:mga06r32_3927_c1 | |||
| 1307 | nmdc:mga06r32_434603_c2 | |||
| 1308 | nmdc:mga06r32_571836_c1 | |||
| 1309 | nmdc:mga06r32_579776_c1 | |||
| 1310 | nmdc:mga06r32_77661_c1 | |||
| 1311 | nmdc:mga08y16_102827_c1 | |||
| 1312 | nmdc:mga08y16_116401_c1 | |||
| 1313 | nmdc:mga08y16_223420_c1 | |||
| 1314 | nmdc:mga08y16_31062_c1 | |||
| 1315 | nmdc:mga08y16_32052_c1 | |||
| 1316 | nmdc:mga08y16_654842_c1 | |||
| 1317 | nmdc:mga0n895_1044781_c1 | |||
| 1318 | nmdc:mga0n895_148336_c1 | |||
| 1319 | nmdc:mga0n895_1509380_c1 | |||
| 1320 | nmdc:mga0n895_183616_c1 | |||
| 1321 | nmdc:mga0n895_54152_c1 | |||
| 1322 | nmdc:mga0rr50_13998_c1 | |||
| 1323 | nmdc:mga0rr50_274232_c1 | |||
| 1324 | nmdc:mga0rr50_34732_c1 | |||
| 1325 | nmdc:mga08x19_593133_c1 | |||
| 1326 | nmdc:mga0a205_1161341_c1 | |||
| 1327 | nmdc:mga0a205_8892_c1 | |||
| 1328 | Ga0495601_0141330 | |||
| 1329 | Ga0495612_0022836 | |||
| 1330 | Ga0495655_0313520 | |||
| 1331 | Ga0495595_0129100 | |||
| 1332 | Ga0495619_0032928 | |||
| 1333 | Ga0495619_0388935 | |||
| 1334 | Ga0500595_016892 | |||
| 1335 | Ga0500616_0001777 | |||
| 1336 | Ga0500616_0023732 | |||
| 1337 | Ga0500616_0064122 | |||
| 1338 | Ga0500616_0240723 | |||
| 1339 | Ga0500620_272549 | |||
| 1340 | Ga0500624_003122 | |||
| 1341 | Ga0501084_0024059 | |||
| 1342 | Ga0501084_0027792 | |||
| 1343 | Ga0501084_0140436 | |||
| 1344 | Ga0501084_1680323 | |||
| 1345 | Ga0587077_174194 | |||
| 1346 | Ga0587071_061658 | |||
| 1347 | Ga0587111_0071714 | |||
| 1348 | Ga0501082_0119060 | |||
| 1349 | Ga0501082_0320960 | |||
| 1350 | Ga0501082_0352413 | |||
| 1351 | Ga0501082_0425684 | |||
| 1352 | Ga0501082_1183145 | |||
| 1353 | Ga0530510_0053728 | |||
| 1354 | Ga0530510_0097227 | |||
| 1355 | Ga0530510_0621811 | |||
| 1356 | 2507509797 | |||
| 1357 | 2508543813 | |||
| 1358 | 2508698399 | |||
| 1359 | 2513679088 | |||
| 1360 | 2513695960 | |||
| 1361 | 2513857554 | |||
| 1362 | 2515629991 | |||
| 1363 | 2517893506 | |||
| 1364 | 2524469954 | |||
| 1365 | 2644287934 | |||
| 1366 | 2671118142 | |||
| 1367 | 2723846189 | |||
| 1368 | 2728747731 | |||
| 1369 | 2849080435 | |||
| 1370 | 2874595094 | |||
| 1371 | 2874610896 | |||
| 1372 | 2874632670 | |||
| 1373 | 2874650955 | |||
| 1374 | 2876775030 | |||
| 1375 | 2876823845 | |||
| 1376 | 2879080473 | |||
| 1377 | 2879134921 | |||
| 1378 | 2879149231 | |||
| 1379 | 2885380965 | |||
| 1380 | 2885384464 | |||
| 1381 | 2888395002 | |||
| 1382 | 2906610389 | |||
| 1383 | 2906628288 | |||
| 1384 | 2906642807 | |||
| 1385 | 2906665942 | |||
| 1386 | 2908778921 | |||
| 1387 | 2922428972 | |||
| 1388 | 2932800422 | |||
| 1389 | 2932804596 | |||
| 1390 | 2935611344 | |||
| 1391 | 2935637765 | |||
| 1392 | 2935648728 | |||
| 1393 | 2935657189 | |||
| 1394 | 2935775281 | |||
| 1395 | 2935779518 | |||
| 1396 | 2935791521 | |||
| 1397 | 2935799833 | |||
| 1398 | 2935820821 | |||
| 1399 | 2935850919 | |||
| 1400 | 2935889789 | |||
| 1401 | 2935913714 | |||
| 1402 | 2935920296 | |||
| 1403 | 2935930635 | |||
| 1404 | 2935939392 | |||
| 1405 | 2935946341 | |||
| 1406 | 2935955820 | |||
| 1407 | 2935966976 | |||
| 1408 | 2935972470 | |||
| 1409 | 2935981699 | |||
| 1410 | 2935991074 | |||
| 1411 | 2936011638 | |||
| 1412 | 2936020233 | |||
| 1413 | 2936028928 | |||
| 1414 | 2936046956 | |||
| 1415 | 2936058164 | |||
| 1416 | 2941514438 | |||
| 1417 | 2941522334 | |||
| 1418 | 2941530147 | |||
| 1419 | 2941536107 | |||
| 1420 | 8006964547 | |||
| 1421 | 8006996053 | |||
| 1422 | 8016530803 | |||
| 1423 | 8016536093 | |||
| 1424 | 8016540375 | |||
| 1425 | 8016552860 | |||
| 1426 | 8016574443 | |||
| 1427 | 8016578538 | |||
| 1428 | 8016591224 | |||
| 1429 | 8016599096 | |||
| 1430 | 8016611955 | |||
| 1431 | 8016621850 | |||
| 1432 | 8016628003 | |||
| 1433 | 8016632326 | |||
| 1434 | 8019535818 | |||
| 1435 | 8019543659 | |||
| 1436 | 8019555116 | |||
| 1437 | 8019557956 | |||
| 1438 | 8019567329 | |||
| 1439 | 8019626802 | |||
| 1440 | 8019635707 | |||
| 1441 | 8019643976 | |||
| 1442 | 8019663505 | |||
| 1443 | 8019673117 | |||
| 1444 | 8019688723 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3cjt-assembly4.cif.gz_H | ribosomal protein l11 methyltransferase (prma) in complex with dimethylated ribosomal protein l11 | 0.9537 | 3 | 73 |
| 3egv-assembly1.cif.gz_B | ribosomal protein l11 methyltransferase (prma) in complex with trimethylated ribosomal protein l11 | 0.9481 | 3 | 80 |
| 3egv-assembly1.cif.gz_B | ribosomal protein l11 methyltransferase (prma) in complex with trimethylated ribosomal protein l11 | 0.9365 | 3 | 80 |
| 3cjt-assembly4.cif.gz_H | ribosomal protein l11 methyltransferase (prma) in complex with dimethylated ribosomal protein l11 | 0.9284 | 3 | 73 |
| 2bcw-assembly1.cif.gz_A | coordinates of the n-terminal domain of ribosomal protein l11,c-terminal domain of ribosomal protein l7/l12 and a portion of the g' domain of elongation factor g, as fitted into cryo-em map of an escherichia coli 70s*ef-g*gdp*fusidic acid complex | 0.9227 | 9 | 73 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0R4J4M9_4_71_3.30.1550.10 | Alpha Beta;2-Layer Sandwich;Ribosomal protein L11, N-terminal domain;Ribosomal protein L11/L12, N-terminal domain | 0.9831 | 3 | 69 | 3.30.1550.10 |
| af_Q9VFJ2_20_96_3.30.1550.10 | Alpha Beta;2-Layer Sandwich;Ribosomal protein L11, N-terminal domain;Ribosomal protein L11/L12, N-terminal domain | 0.9637 | 6 | 81 | 3.30.1550.10 |
| af_Q8IIQ5_3_68_3.30.1550.10 | Alpha Beta;2-Layer Sandwich;Ribosomal protein L11, N-terminal domain;Ribosomal protein L11/L12, N-terminal domain | 0.9587 | 6 | 70 | 3.30.1550.10 |
| af_A0A0R4J4M9_4_71_3.30.1550.10 | Alpha Beta;2-Layer Sandwich;Ribosomal protein L11, N-terminal domain;Ribosomal protein L11/L12, N-terminal domain | 0.9551 | 3 | 69 | 3.30.1550.10 |
| 3egvB00 | Alpha Beta;2-Layer Sandwich;Ribosomal protein L11, N-terminal domain;Ribosomal protein L11/L12, N-terminal domain | 0.9481 | 3 | 80 | 3.30.1550.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q3RV35-F1-model_v4 | 50S ribosomal protein L11 | 1.002 | 1 | 64 |
GO:0003735
GO:0006412 GO:0022625 GO:0070180 |
| AF-A0A7Y3CRS9-F1-model_v4 | 50S ribosomal protein L11 | 1.001 | 1 | 73 |
GO:0003735
GO:0006412 GO:0022625 GO:0070180 |
| AF-A0A379KAS4-F1-model_v4 | 50S ribosomal protein L11 | 0.9999 | 1 | 73 |
GO:0003735
GO:0006412 GO:0022625 GO:0070180 |
| AF-F4N6J0-F1-model_v4 | 50S ribosomal protein L11 | 0.9972 | 1 | 73 |
GO:0003735
GO:0006412 GO:0022625 GO:0070180 |
| AF-A0A258C299-F1-model_v4 | deleted | 0.9962 | 1 | 77 |
|