F477403

General Info

Members Datasets Scaffolds Average Seq Length
722 388 1444 142

Family's Representative Sequence

Representative Sequence 3300005347|Ga0070668_100177547|Ga0070668_1001775472
Length 163
Sequence MGGGQQMARGLGRELGEGWKAMAKKIEGYINLQVPAGQANPSPPIGPALGQRGLAIMEFCKQFNAKSKDLEQGAPIPVKITVYSDRSFTFEMRTPPASHLLKKAAKINGGSKEPGRASAGTITMAQVREVAKVKMKDLNTDDLDAAVKTLAGSARSMGLQVVE

Samples

Sample ID Description Type Environment
1 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
62 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
143 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
147 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
148 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
149 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
150 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
151 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
152 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
153 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
154 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
155 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
156 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
157 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
158 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
159 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
163 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
164 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
165 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
166 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
167 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
168 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
169 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
170 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
171 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
172 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
173 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
174 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
175 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
176 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
177 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
178 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
179 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
180 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
181 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
182 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
183 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
184 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
185 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
186 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
187 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
188 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
189 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
190 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
191 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
192 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
193 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
194 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
195 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
196 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
197 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
198 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
199 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
200 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
201 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
202 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
203 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
204 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
205 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
206 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
207 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
208 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
209 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
210 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
211 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
212 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
213 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
214 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
215 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
216 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
217 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
218 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
219 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
220 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
221 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
222 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
223 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
224 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
225 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
226 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
227 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
228 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
229 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
230 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
231 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
232 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
233 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
234 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
235 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
236 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
252 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
253 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
254 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
255 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
256 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
257 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
258 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
259 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
260 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
261 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
262 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
263 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
264 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
265 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
266 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
269 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
270 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
271 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
272 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
273 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
274 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
275 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
276 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
277 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
278 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
279 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
280 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
281 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
282 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
283 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
284 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
285 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
286 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
287 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
288 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
289 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
290 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
291 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
292 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
293 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
294 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
295 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
296 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
297 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
298 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
299 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
300 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
301 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
302 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
303 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
304 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
305 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
306 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
307 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
308 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
309 2643221651 Afipia sp. Root123D2 Isolate Unclassified
310 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
311 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
312 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
313 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
314 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
315 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
316 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
317 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
318 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
319 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
320 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
321 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
322 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
323 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
324 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
325 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
326 2906610324
327 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
328 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
329 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
330 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
331 2922425934
332 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
333 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
334 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
335 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
336 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
337 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
338 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
339 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
340 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
341 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
342 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
343 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
344 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
345 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
346 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
347 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
348 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
349 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
350 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
351 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
352 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
353 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
354 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
355 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
356 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
357 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
358 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
359 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
360 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
361 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
362 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
363 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
364 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
365 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
366 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
367 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
368 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
369 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
370 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
371 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
372 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
373 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
374 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
375 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
376 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
377 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
378 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
379 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
380 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
381 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
382 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
383 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
384 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
385 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
386 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
387 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
388 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 86.94
Metatranscriptomes 0.97
Isolates 12.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.4
Nodule 10.66
Rhizoplane 8.86
Rhizosphere 72.71
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070668_100177547 3300005347 Bacteria 1737
2 JGI25404J52841_10013039 3300003659 Bacteria 1803
3 Ga0070690_100207609 3300005330 Bacteria 1366
4 Ga0070670_100953842 3300005331 Bacteria 779
5 Ga0068869_100017207 3300005334 Bacteria 4895
6 Ga0068869_100347269 3300005334 Bacteria 1209
7 Ga0070666_10866435 3300005335 Bacteria 667
8 Ga0070680_100003246 3300005336 Bacteria 12104
9 Ga0070680_100012371 3300005336 Bacteria 6626
10 Ga0070682_100039845 3300005337 Bacteria 2888
11 Ga0070682_101132594 3300005337 Bacteria 657
12 Ga0070660_100011063 3300005339 Bacteria 6397
13 Ga0070689_100938919 3300005340 Bacteria 767
14 Ga0070691_10016888 3300005341 Bacteria 3357
15 Ga0070691_10066283 3300005341 Bacteria 1745
16 Ga0070687_100168920 3300005343 Bacteria 1300
17 Ga0070661_100056615 3300005344 Bacteria 2873
18 Ga0070661_100596075 3300005344 Bacteria 893
19 Ga0070692_10054754 3300005345 Bacteria 2084
20 Ga0070668_100846874 3300005347 Bacteria 815
21 Ga0070668_100863339 3300005347 Bacteria 807
22 Ga0070675_100393686 3300005354 Bacteria 1235
23 Ga0070671_100916296 3300005355 Bacteria 766
24 Ga0070688_100059674 3300005365 Bacteria 2407
25 Ga0070659_100036234 3300005366 Bacteria 3845
26 Ga0070659_101633101 3300005366 Bacteria 576
27 Ga0070667_100641913 3300005367 Bacteria 980
28 Ga0070701_10005417 3300005438 Bacteria 5267
29 Ga0070705_100006514 3300005440 Bacteria 5729
30 Ga0070705_100006625 3300005440 Bacteria 5689
31 Ga0070705_100369103 3300005440 Bacteria 1052
32 Ga0070700_100010147 3300005441 Bacteria 5189
33 Ga0070700_100065299 3300005441 Bacteria 2307
34 Ga0070700_100119275 3300005441 Bacteria 1765
35 Ga0070700_100297258 3300005441 Bacteria 1177
36 Ga0070700_101203048 3300005441 Bacteria 633
37 Ga0070694_100007558 3300005444 Bacteria 6634
38 Ga0070694_100793719 3300005444 Bacteria 776
39 Ga0070694_101069482 3300005444 Bacteria 672
40 Ga0070694_101168248 3300005444 Bacteria 644
41 Ga0070708_100050222 3300005445 Bacteria 3692
42 Ga0070663_100011644 3300005455 Bacteria 5529
43 Ga0070663_100016160 3300005455 Bacteria 4837
44 Ga0070663_100358023 3300005455 Bacteria 1183
45 Ga0070663_100852641 3300005455 Bacteria 784
46 Ga0070678_100141450 3300005456 Bacteria 1926
47 Ga0070678_100676193 3300005456 Bacteria 928
48 Ga0070662_100293724 3300005457 Bacteria 1318
49 Ga0070681_10011583 3300005458 Bacteria 8729
50 Ga0070681_10088487 3300005458 Bacteria 3048
51 Ga0068867_100505778 3300005459 Bacteria 1039
52 Ga0070685_10263439 3300005466 Bacteria 1147
53 Ga0070685_10836668 3300005466 Bacteria 681
54 Ga0070706_100367797 3300005467 Bacteria 1340
55 Ga0070707_100175421 3300005468 Bacteria 2089
56 Ga0070707_100202029 3300005468 Bacteria 1937
57 Ga0070707_100231769 3300005468 Bacteria 1797
58 Ga0070698_100206881 3300005471 Bacteria 1897
59 Ga0070698_100416867 3300005471 Bacteria 1277
60 Ga0070699_100002571 3300005518 Bacteria 16279
61 Ga0070699_100200880 3300005518 Bacteria 1772
62 Ga0070679_100049281 3300005530 Bacteria 4195
63 Ga0070679_100184324 3300005530 Bacteria 2059
64 Ga0070697_100119057 3300005536 Bacteria 2207
65 Ga0070697_100239221 3300005536 Bacteria 1550
66 Ga0068853_100040534 3300005539 Bacteria 3974
67 Ga0070686_100461855 3300005544 Bacteria 978
68 Ga0070686_101170219 3300005544 Bacteria 638
69 Ga0070686_101457915 3300005544 Bacteria 576
70 Ga0070695_100001778 3300005545 Bacteria 12130
71 Ga0070695_100018719 3300005545 Bacteria 4207
72 Ga0070695_100058175 3300005545 Bacteria 2499
73 Ga0070696_100008610 3300005546 Bacteria 6824
74 Ga0070696_100022490 3300005546 Bacteria 4284
75 Ga0070693_100002809 3300005547 Bacteria 8014
76 Ga0070693_100079822 3300005547 Bacteria 1948
77 Ga0070704_100057353 3300005549 Bacteria 2769
78 Ga0070704_100088993 3300005549 Bacteria 2295
79 Ga0070704_100097286 3300005549 Bacteria 2208
80 Ga0070704_101088317 3300005549 Bacteria 726
81 Ga0068855_100091602 3300005563 Bacteria 3507
82 Ga0070664_100046396 3300005564 Bacteria 3670
83 Ga0068857_100162572 3300005577 Bacteria 2026
84 Ga0068856_100129197 3300005614 Bacteria 2531
85 Ga0070702_100097041 3300005615 Bacteria 1800
86 Ga0068852_100159356 3300005616 Bacteria 2106
87 Ga0068859_100065425 3300005617 Bacteria 3670
88 Ga0068859_100640820 3300005617 Bacteria 1155
89 Ga0068859_101210556 3300005617 Bacteria 832
90 Ga0068864_100006580 3300005618 Bacteria 9512
91 Ga0068864_101629155 3300005618 Bacteria 650
92 Ga0068864_101667966 3300005618 Bacteria 642
93 Ga0068861_100079500 3300005719 Bacteria 2564
94 Ga0068861_100265776 3300005719 Bacteria 1471
95 Ga0068861_101508435 3300005719 Bacteria 660
96 Ga0068870_10022374 3300005840 Bacteria 3106
97 Ga0068863_100437090 3300005841 Bacteria 1283
98 Ga0068863_100545102 3300005841 Bacteria 1145
99 Ga0068863_100970397 3300005841 Bacteria 852
100 Ga0068863_101703929 3300005841 Bacteria 640
101 Ga0068858_100159505 3300005842 Bacteria 2124
102 Ga0068858_100439137 3300005842 Bacteria 1257
103 Ga0068860_100010003 3300005843 Bacteria 9402
104 Ga0068860_100027772 3300005843 Bacteria 5450
105 Ga0068860_100172720 3300005843 Bacteria 2088
106 Ga0068860_100197112 3300005843 Bacteria 1951
107 Ga0068860_100854376 3300005843 Bacteria 925
108 Ga0068860_101631456 3300005843 Bacteria 667
109 Ga0068862_100002462 3300005844 Bacteria 16405
110 Ga0068862_100048738 3300005844 Bacteria 3617
111 Ga0068862_100117287 3300005844 Bacteria 2343
112 Ga0068862_101363967 3300005844 Bacteria 712
113 Ga0068862_101953986 3300005844 Bacteria 597
114 Ga0081455_10004292 3300005937 Bacteria 16046
115 Ga0081540_1001954 3300005983 Bacteria 17230
116 Ga0081540_1194546 3300005983 Bacteria 744
117 Ga0081539_10050840 3300005985 Bacteria 2341
118 Ga0081539_10153925 3300005985 Bacteria 1103
119 Ga0075365_10075468 3300006038 Bacteria 2275
120 Ga0075365_10395002 3300006038 Bacteria 976
121 Ga0075365_10459969 3300006038 Bacteria 899
122 Ga0075368_10002966 3300006042 Bacteria 5603
123 Ga0075363_100055511 3300006048 Bacteria 2122
124 Ga0075363_100127531 3300006048 Bacteria 1425
125 Ga0075363_100144396 3300006048 Bacteria 1341
126 Ga0075364_10011733 3300006051 Bacteria 5333
127 Ga0070715_10040617 3300006163 Bacteria 1945
128 Ga0070715_10625488 3300006163 Bacteria 634
129 Ga0075362_10065919 3300006177 Bacteria 1645
130 Ga0075362_10550676 3300006177 Bacteria 593
131 Ga0075367_10032301 3300006178 Bacteria 3011
132 Ga0075367_10371469 3300006178 Bacteria 903
133 Ga0075367_10431717 3300006178 Bacteria 834
134 Ga0097621_100782396 3300006237 Bacteria 883
135 Ga0075370_10302785 3300006353 Bacteria 951
136 Ga0075428_100012165 3300006844 Bacteria 9571
137 Ga0075428_100111245 3300006844 Bacteria 2984
138 Ga0075428_100135033 3300006844 Bacteria 2683
139 Ga0075428_100255326 3300006844 Bacteria 1888
140 Ga0075428_100931920 3300006844 Bacteria 921
141 Ga0075430_100075551 3300006846 Bacteria 2825
142 Ga0075430_100551215 3300006846 Bacteria 951
143 Ga0075430_100832358 3300006846 Bacteria 760
144 Ga0075430_101437425 3300006846 Bacteria 567
145 Ga0075431_100024490 3300006847 Bacteria 6186
146 Ga0075431_100080320 3300006847 Bacteria 3367
147 Ga0075431_100174899 3300006847 Bacteria 2205
148 Ga0075431_100227684 3300006847 Bacteria 1900
149 Ga0075431_100297926 3300006847 Bacteria 1630
150 Ga0075433_10195674 3300006852 Bacteria 1798
151 Ga0075433_10250798 3300006852 Bacteria 1570
152 Ga0075433_10742806 3300006852 Bacteria 858
153 Ga0075433_11574617 3300006852 Bacteria 567
154 Ga0075434_100040464 3300006871 Bacteria 4615
155 Ga0075434_100062343 3300006871 Bacteria 3711
156 Ga0075434_100203790 3300006871 Bacteria 1998
157 Ga0075429_100219257 3300006880 Bacteria 1667
158 Ga0075429_100387625 3300006880 Bacteria 1223
159 Ga0068865_100677427 3300006881 Bacteria 879
160 Ga0075436_100982911 3300006914 Bacteria 633
161 Ga0097620_100065425 3300006931 Bacteria 3670
162 Ga0097620_100640805 3300006931 Bacteria 1155
163 Ga0097620_101210553 3300006931 Bacteria 832
164 Ga0075435_100018160 3300007076 Bacteria 5339
165 Ga0075435_100742246 3300007076 Bacteria 854
166 Ga0099795_10040854 3300007788 Bacteria 1649
167 Ga0111539_10006608 3300009094 Bacteria 14940
168 Ga0111539_10017896 3300009094 Bacteria 8778
169 Ga0111539_10058172 3300009094 Bacteria 4587
170 Ga0111539_10278767 3300009094 Bacteria 1945
171 Ga0111539_10342289 3300009094 Bacteria 1741
172 Ga0111539_10391169 3300009094 Bacteria 1619
173 Ga0111539_10837204 3300009094 Bacteria 1070
174 Ga0105245_10036863 3300009098 Bacteria 4346
175 Ga0105245_10135230 3300009098 Bacteria 2316
176 Ga0105245_11170772 3300009098 Bacteria 816
177 Ga0105247_10348247 3300009101 Bacteria 1041
178 Ga0105247_10602056 3300009101 Bacteria 815
179 Ga0114129_10057856 3300009147 Bacteria 5424
180 Ga0114129_10391109 3300009147 Bacteria 1834
181 Ga0114129_10702845 3300009147 Bacteria 1299
182 Ga0114129_10803790 3300009147 Bacteria 1199
183 Ga0114129_11244173 3300009147 Bacteria 925
184 Ga0114129_13219384 3300009147 Bacteria 530
185 Ga0105243_10028727 3300009148 Bacteria 4271
186 Ga0105243_10728075 3300009148 Bacteria 970
187 Ga0105243_10776325 3300009148 Bacteria 942
188 Ga0105242_10551877 3300009176 Bacteria 1105
189 Ga0105248_10967282 3300009177 Bacteria 961
190 Ga0105248_11316311 3300009177 Bacteria 817
191 Ga0105237_10018592 3300009545 Bacteria 7190
192 Ga0105238_10130927 3300009551 Bacteria 2487
193 Ga0105249_10013294 3300009553 Bacteria 7267
194 Ga0105249_10780662 3300009553 Bacteria 1019
195 Ga0105249_11953063 3300009553 Bacteria 659
196 Ga0105249_12019405 3300009553 Bacteria 649
197 Ga0105239_11351728 3300010375 Bacteria 822
198 Ga0105246_11170539 3300011119 Bacteria 706
199 Ga0157370_10641961 3300013104 Bacteria 970
200 Ga0157369_10398692 3300013105 Bacteria 1427
201 Ga0157378_10040081 3300013297 Bacteria 4154
202 Ga0157378_11722719 3300013297 Bacteria 674
203 Ga0163162_10310482 3300013306 Bacteria 1709
204 Ga0163162_10525496 3300013306 Bacteria 1313
205 Ga0157375_10047041 3300013308 Bacteria 4210
206 Ga0157375_10073534 3300013308 Bacteria 3437
207 Ga0157375_11063063 3300013308 Bacteria 946
208 Ga0157380_10185573 3300014326 Bacteria 1831
209 Ga0157380_10246770 3300014326 Bacteria 1613
210 Ga0157380_10390461 3300014326 Bacteria 1317
211 Ga0157380_10579920 3300014326 Bacteria 1106
212 Ga0157379_10085624 3300014968 Bacteria 2825
213 Ga0157379_10386304 3300014968 Bacteria 1285
214 Ga0157379_11711526 3300014968 Bacteria 616
215 Ga0157376_10410533 3300014969 Bacteria 1312
216 Ga0163161_10409437 3300017792 Bacteria 1089
217 Ga0163161_10640657 3300017792 Bacteria 880
218 Ga0206356_10381984 3300020070 Bacteria 614
219 Ga0207682_10010123 3300025893 Bacteria 3701
220 Ga0207642_10490562 3300025899 Bacteria 751
221 Ga0207710_10226116 3300025900 Bacteria 930
222 Ga0207680_10554644 3300025903 Bacteria 820
223 Ga0207647_10017465 3300025904 Bacteria 4877
224 Ga0207647_10033997 3300025904 Bacteria 3258
225 Ga0207685_10754860 3300025905 Bacteria 533
226 Ga0207645_11002160 3300025907 Bacteria 566
227 Ga0207684_11089209 3300025910 Bacteria 665
228 Ga0207707_10011417 3300025912 Bacteria 7736
229 Ga0207671_10033313 3300025914 Bacteria 3833
230 Ga0207660_10008218 3300025917 Bacteria 6753
231 Ga0207660_10010703 3300025917 Bacteria 5961
232 Ga0207662_10090791 3300025918 Bacteria 1878
233 Ga0207662_10105148 3300025918 Bacteria 1754
234 Ga0207657_10017375 3300025919 Bacteria 6901
235 Ga0207657_10797034 3300025919 Bacteria 730
236 Ga0207649_10084482 3300025920 Bacteria 2064
237 Ga0207652_10046567 3300025921 Bacteria 3700
238 Ga0207652_10228862 3300025921 Bacteria 1675
239 Ga0207646_10092622 3300025922 Bacteria 2705
240 Ga0207646_10138234 3300025922 Bacteria 2194
241 Ga0207646_10954169 3300025922 Bacteria 759
242 Ga0207694_10023053 3300025924 Bacteria 4725
243 Ga0207650_11082479 3300025925 Bacteria 682
244 Ga0207659_11072044 3300025926 Bacteria 693
245 Ga0207687_10039500 3300025927 Bacteria 3232
246 Ga0207686_10459411 3300025934 Bacteria 981
247 Ga0207709_10029931 3300025935 Bacteria 3163
248 Ga0207709_10108617 3300025935 Bacteria 1850
249 Ga0207709_10152056 3300025935 Bacteria 1604
250 Ga0207711_11414723 3300025941 Bacteria 638
251 Ga0207689_10107639 3300025942 Bacteria 2291
252 Ga0207689_10278862 3300025942 Bacteria 1384
253 Ga0207689_10381907 3300025942 Bacteria 1173
254 Ga0207689_10840206 3300025942 Bacteria 775
255 Ga0207679_10050613 3300025945 Bacteria 3037
256 Ga0207712_10002234 3300025961 Bacteria 12602
257 Ga0207668_10217050 3300025972 Bacteria 1533
258 Ga0207668_10436338 3300025972 Bacteria 1115
259 Ga0207640_10547666 3300025981 Bacteria 971
260 Ga0207640_11212248 3300025981 Bacteria 671
261 Ga0207658_10205325 3300025986 Bacteria 1648
262 Ga0207677_10046600 3300026023 Bacteria 2904
263 Ga0207703_10096381 3300026035 Bacteria 2498
264 Ga0207703_10444567 3300026035 Bacteria 1210
265 Ga0207703_10616064 3300026035 Bacteria 1028
266 Ga0207639_10029939 3300026041 Bacteria 3990
267 Ga0207678_10000118 3300026067 Bacteria 65608
268 Ga0207678_10034068 3300026067 Bacteria 4435
269 Ga0207678_10164622 3300026067 Bacteria 1894
270 Ga0207708_10016120 3300026075 Bacteria 5613
271 Ga0207708_10022034 3300026075 Bacteria 4809
272 Ga0207708_10123889 3300026075 Bacteria 2016
273 Ga0207708_10267685 3300026075 Bacteria 1381
274 Ga0207708_10319101 3300026075 Bacteria 1267
275 Ga0207708_11171454 3300026075 Bacteria 671
276 Ga0207702_10076598 3300026078 Bacteria 2891
277 Ga0207641_10193783 3300026088 Bacteria 1869
278 Ga0207676_10381975 3300026095 Bacteria 1311
279 Ga0207676_10517364 3300026095 Bacteria 1136
280 Ga0207674_10184695 3300026116 Bacteria 2036
281 Ga0207675_100028558 3300026118 Bacteria 5194
282 Ga0207675_100034087 3300026118 Bacteria 4745
283 Ga0207675_100067569 3300026118 Bacteria 3341
284 Ga0207675_100150669 3300026118 Bacteria 2213
285 Ga0207683_10035272 3300026121 Bacteria 4349
286 Ga0207683_10433261 3300026121 Bacteria 1211
287 Ga0209813_10008787 3300027866 Bacteria 2562
288 Ga0209813_10060135 3300027866 Bacteria 1211
289 Ga0207428_10008077 3300027907 Bacteria 9546
290 Ga0207428_10019254 3300027907 Bacteria 5820
291 Ga0207428_10261969 3300027907 Bacteria 1287
292 Ga0207428_10481845 3300027907 Bacteria 902
293 Ga0268265_10138589 3300028380 Bacteria 2033
294 Ga0268265_10665476 3300028380 Bacteria 1002
295 Ga0268264_10005854 3300028381 Bacteria 10409
296 Ga0268264_10034682 3300028381 Bacteria 4152
297 Ga0268264_10173935 3300028381 Bacteria 1950
298 Ga0268264_10825641 3300028381 Bacteria 927
299 Ga0268264_11641533 3300028381 Bacteria 653
300 Ga0265340_10032122 3300031247 Bacteria 2622
301 Ga0265316_10095094 3300031344 Bacteria 2270
302 Ga0307408_100071207 3300031548 Bacteria 2570
303 Ga0316575_10358619 3300031665 Bacteria 622
304 Ga0316576_10023973 3300031727 Bacteria 4258
305 Ga0316578_10213872 3300031728 Bacteria 1159
306 Ga0307405_10078680 3300031731 Bacteria 2147
307 Ga0307413_10260354 3300031824 Bacteria 1293
308 Ga0307410_10649297 3300031852 Bacteria 885
309 Ga0307409_100198315 3300031995 Bacteria 1793
310 Ga0307416_100478881 3300032002 Bacteria 1304
311 Ga0307411_10036612 3300032005 Bacteria 3077
312 Ga0307415_101182778 3300032126 Bacteria 720
313 Ga0316586_1007657 3300033527 Bacteria 1580
314 Ga0316588_1037631 3300033528 Bacteria 1151
315 Ga0316596_1001444 3300033541 Bacteria 4798
316 Ga0373958_0007762 3300034819 Bacteria 1719
317 Ga0373938_0005076 3300034957 Bacteria 2225
318 Ga0373934_0069895 3300035086 Bacteria 1404
319 Ga0373940_0000987 3300035088 Bacteria 4856
320 Ga0373949_0149587 3300035090 Bacteria 674
321 Ga0373952_0007818 3300035092 Bacteria 2014
322 Ga0373952_0034555 3300035092 Bacteria 1140
323 Ga0373923_0160862 3300035111 Bacteria 1024
324 Ga0373923_0362289 3300035111 Bacteria 694
325 Ga0373932_0090783 3300035112 Bacteria 979
326 Ga0373939_0002313 3300035114 Bacteria 4507
327 Ga0373953_0004766 3300035117 Bacteria 4350
328 Ga0373954_0028040 3300035118 Bacteria 2587
329 Ga0373954_0309950 3300035118 Bacteria 779
330 Ga0373956_0010844 3300035119 Bacteria 3745
331 Ga0373957_0051784 3300035120 Bacteria 1571
332 Ga0373955_0077990 3300035172 Bacteria 1866
333 Ga0373942_0016431 3300035207 Bacteria 1815
334 Ga0373961_0008792 3300035241 Bacteria 2460
335 Ga0316574_0268202 3300035398 Bacteria 1089
336 Ga0316574_0316988 3300035398 Bacteria 990
337 Ga0373931_0000685 3300035691 Bacteria 14057
338 Ga0373931_0008373 3300035691 Bacteria 4902
339 Ga0373927_0743414 3300035695 Bacteria 648
340 Ga0373947_0111676 3300035725 Bacteria 1728
341 Ga0373937_0615671 3300036401 Bacteria 1030
342 Ga0316582_0262595 3300036647 Bacteria 1184
343 Ga0316584_0031109 3300036712 Bacteria 3946
344 Ga0395905_0000002 3300037471 Bacteria 1356358
345 Ga0400486_32257 3300038742 Bacteria 1124
346 Ga0400487_44160 3300039110 Bacteria 3629
347 Ga0436365_0741969 3300039437 Bacteria 953
348 Ga0436363_0062250 3300039450 Bacteria 530
349 Ga0436363_0270409 3300039450 Bacteria 619
350 Ga0436362_1178884 3300039453 Bacteria 2961
351 Ga0453683_0443351 3300044673 Bacteria 839
352 Ga0453684_0445324 3300044712 Bacteria 1443
353 Ga0495617_098917 3300046452 Bacteria 949
354 Ga0495592_0331962 3300046454 Bacteria 980
355 Ga0495603_0025882 3300046455 Bacteria 3547
356 Ga0495638_0420545 3300046460 Bacteria 689
357 Ga0495653_0575345 3300046463 Bacteria 695
358 Ga0495664_0540742 3300046477 Bacteria 694
359 Ga0495608_0257843 3300046511 Bacteria 1086
360 Ga0495618_0233070 3300046514 Bacteria 1159
361 Ga0495628_0201429 3300046516 Bacteria 1500
362 Ga0495652_0317586 3300046529 Bacteria 1126
363 Ga0495645_0361513 3300046543 Bacteria 933
364 Ga0495633_0126077 3300046558 Bacteria 1185
365 Ga0495667_0071936 3300046559 Bacteria 2255
366 Ga0495656_0444313 3300046615 Bacteria 683
367 Ga0495625_0128806 3300046660 Bacteria 1716
368 Ga0495625_0152947 3300046660 Bacteria 1550
369 Ga0495625_0389362 3300046660 Bacteria 873
370 Ga0495625_0400847 3300046660 Bacteria 857
371 Ga0495635_0892186 3300046663 Bacteria 570
372 Ga0495657_0337742 3300046675 Bacteria 893
373 Ga0495658_0250139 3300046683 Bacteria 1115
374 Ga0495658_0250931 3300046683 Bacteria 1113
375 Ga0495649_0115869 3300046694 Bacteria 1419
376 Ga0495600_0645807 3300046809 Bacteria 640
377 Ga0495604_0159833 3300047317 Bacteria 1593
378 Ga0495674_0438943 3300047319 Bacteria 1050
379 Ga0495672_0093550 3300047320 Bacteria 1646
380 Ga0495675_0104893 3300047444 Bacteria 1767
381 Ga0495602_0092704 3300048088 Bacteria 2501
382 Ga0495615_0062628 3300048090 Bacteria 985
383 Ga0496100_0020609 3300048903 Bacteria 3956
384 Ga0496100_0035344 3300048903 Bacteria 3142
385 Ga0496101_0006539 3300048904 Bacteria 7507
386 Ga0496101_0024585 3300048904 Bacteria 4170
387 Ga0496101_0188547 3300048904 Bacteria 1591
388 Ga0496102_0008953 3300048905 Bacteria 8586
389 Ga0496102_0025641 3300048905 Bacteria 5251
390 Ga0496102_0138502 3300048905 Bacteria 2281
391 Ga0496102_0356934 3300048905 Bacteria 1376
392 Ga0496102_0559746 3300048905 Bacteria 1066
393 Ga0496102_0649976 3300048905 Bacteria 978
394 Ga0496103_0023955 3300048906 Bacteria 3682
395 Ga0496103_0284503 3300048906 Bacteria 1063
396 Ga0496104_0000216 3300048907 Bacteria 50674
397 Ga0496104_0095241 3300048907 Bacteria 2848
398 Ga0496104_0225123 3300048907 Bacteria 1788
399 Ga0496104_0270537 3300048907 Bacteria 1612
400 Ga0496104_0375934 3300048907 Bacteria 1333
401 Ga0496104_0820865 3300048907 Bacteria 836
402 Ga0496105_0072606 3300048908 Bacteria 2844
403 Ga0496105_0236024 3300048908 Bacteria 1485
404 Ga0496105_0511263 3300048908 Bacteria 942
405 Ga0496105_0608655 3300048908 Bacteria 847
406 Ga0496105_0659401 3300048908 Bacteria 807
407 Ga0496106_0007414 3300048909 Bacteria 8107
408 Ga0496106_0008312 3300048909 Bacteria 7680
409 Ga0496106_0107769 3300048909 Bacteria 2167
410 Ga0496106_0126584 3300048909 Bacteria 2001
411 Ga0496107_0009695 3300048910 Bacteria 6676
412 Ga0496107_0065436 3300048910 Bacteria 2635
413 Ga0496107_0464494 3300048910 Bacteria 940
414 Ga0496107_0527942 3300048910 Bacteria 875
415 Ga0496108_0011283 3300048911 Bacteria 7258
416 Ga0496108_0202215 3300048911 Bacteria 1724
417 Ga0496108_1109627 3300048911 Bacteria 672
418 Ga0496109_0033418 3300048912 Bacteria 4627
419 Ga0496109_0280252 3300048912 Bacteria 1571
420 Ga0496109_0576459 3300048912 Bacteria 1061
421 Ga0496109_0947992 3300048912 Bacteria 798
422 Ga0496110_0000957 3300048913 Bacteria 20216
423 Ga0496110_0034389 3300048913 Bacteria 4390
424 Ga0496110_0148815 3300048913 Bacteria 2119
425 Ga0496110_0648584 3300048913 Bacteria 955
426 Ga0496110_1031465 3300048913 Bacteria 730
427 Ga0496111_0123557 3300048914 Bacteria 1913
428 Ga0496111_0160560 3300048914 Bacteria 1668
429 Ga0496111_0168577 3300048914 Bacteria 1627
430 Ga0496111_0371201 3300048914 Bacteria 1058
431 Ga0496111_1348283 3300048914 Bacteria 501
432 Ga0496112_0020950 3300048915 Bacteria 6208
433 Ga0496112_0557778 3300048915 Bacteria 1079
434 Ga0496112_0710527 3300048915 Bacteria 933
435 Ga0496113_0004691 3300048916 Bacteria 8433
436 Ga0496113_0544249 3300048916 Bacteria 931
437 Ga0496114_0032687 3300048917 Bacteria 4284
438 Ga0496114_0526604 3300048917 Bacteria 1045
439 Ga0496114_0595315 3300048917 Bacteria 975
440 Ga0496114_1252425 3300048917 Bacteria 628
441 Ga0496115_0010086 3300048918 Bacteria 7043
442 Ga0496115_0049897 3300048918 Bacteria 3351
443 Ga0496115_0320733 3300048918 Bacteria 1267
444 Ga0496115_0564875 3300048918 Bacteria 908
445 Ga0496115_1267349 3300048918 Bacteria 551
446 Ga0496124_0584017 3300048927 Bacteria 730
447 Ga0501031_0045435 3300049568 Bacteria 2865
448 Ga0501032_0205650 3300049569 Bacteria 1284
449 Ga0501033_0020839 3300049570 Bacteria 4949
450 Ga0501033_0386197 3300049570 Bacteria 978
451 Ga0501034_0035297 3300049571 Bacteria 5070
452 Ga0501034_0130903 3300049571 Bacteria 2492
453 Ga0501034_0525015 3300049571 Bacteria 1095
454 Ga0501034_0552590 3300049571 Bacteria 1061
455 Ga0501034_0950622 3300049571 Bacteria 745
456 Ga0501036_0000753 3300049572 Bacteria 23993
457 Ga0501036_0050604 3300049572 Bacteria 3518
458 Ga0501036_0260737 3300049572 Bacteria 1452
459 Ga0501036_0260826 3300049572 Bacteria 1452
460 Ga0501036_0416150 3300049572 Bacteria 1121
461 Ga0501037_0029678 3300049573 Bacteria 4040
462 Ga0501038_0058198 3300049574 Bacteria 3314
463 Ga0501038_0160415 3300049574 Bacteria 1828
464 Ga0501038_0280267 3300049574 Bacteria 1312
465 Ga0501038_0336183 3300049574 Bacteria 1179
466 Ga0501039_0067744 3300049575 Bacteria 2772
467 Ga0501039_0156539 3300049575 Bacteria 1790
468 Ga0501039_0264958 3300049575 Bacteria 1350
469 Ga0501039_0295099 3300049575 Bacteria 1274
470 Ga0501040_0018714 3300049576 Bacteria 4600
471 Ga0501040_0400159 3300049576 Bacteria 986
472 Ga0501041_0071840 3300049577 Bacteria 2125
473 Ga0501041_0119870 3300049577 Bacteria 1635
474 Ga0501041_0121868 3300049577 Bacteria 1621
475 Ga0501042_0091459 3300049578 Bacteria 2184
476 Ga0501042_0188123 3300049578 Bacteria 1489
477 Ga0501042_0691500 3300049578 Bacteria 742
478 Ga0501042_0714740 3300049578 Bacteria 729
479 Ga0501043_0087216 3300049579 Bacteria 2452
480 Ga0501043_0392807 3300049579 Bacteria 1049
481 Ga0501046_0002625 3300049580 Bacteria 16787
482 Ga0501046_0022425 3300049580 Bacteria 5202
483 Ga0501046_0707133 3300049580 Bacteria 710
484 Ga0501046_0769214 3300049580 Bacteria 676
485 Ga0501046_1144787 3300049580 Bacteria 536
486 Ga0501047_0032813 3300049581 Bacteria 5013
487 Ga0501047_0119021 3300049581 Bacteria 2523
488 Ga0501047_0242118 3300049581 Bacteria 1654
489 Ga0501047_0250003 3300049581 Bacteria 1621
490 Ga0501048_0089793 3300049582 Bacteria 2168
491 Ga0501067_0006205 3300049583 Bacteria 6625
492 Ga0501067_0063219 3300049583 Bacteria 2049
493 Ga0501067_0214117 3300049583 Bacteria 1073
494 Ga0501068_0114573 3300049584 Bacteria 1678
495 Ga0501068_0681371 3300049584 Bacteria 672
496 Ga0501069_0011030 3300049585 Bacteria 4791
497 Ga0501069_0076967 3300049585 Bacteria 1876
498 Ga0501070_0000242 3300049586 Bacteria 51302
499 Ga0501070_0166494 3300049586 Bacteria 1816
500 Ga0501070_0850966 3300049586 Bacteria 714
501 Ga0501070_1294268 3300049586 Bacteria 557
502 Ga0501071_0233860 3300049587 Bacteria 1385
503 Ga0501071_0277685 3300049587 Bacteria 1268
504 Ga0501072_0002118 3300049588 Bacteria 14789
505 Ga0501072_0345630 3300049588 Bacteria 1181
506 Ga0501073_0014097 3300049589 Bacteria 5807
507 Ga0501073_0116148 3300049589 Bacteria 1855
508 Ga0501073_0307400 3300049589 Bacteria 1094
509 Ga0501073_0360559 3300049589 Bacteria 1004
510 Ga0501073_0449644 3300049589 Bacteria 891
511 Ga0501073_0829991 3300049589 Bacteria 637
512 Ga0501073_0988083 3300049589 Bacteria 579
513 Ga0501074_0031472 3300049590 Bacteria 3843
514 Ga0501074_0066986 3300049590 Bacteria 2582
515 Ga0501074_0127774 3300049590 Bacteria 1819
516 Ga0501074_0661334 3300049590 Bacteria 738
517 Ga0501075_0054908 3300049591 Bacteria 2997
518 Ga0501075_0287045 3300049591 Bacteria 1254
519 Ga0501076_0046867 3300049592 Bacteria 3416
520 Ga0501076_0276965 3300049592 Bacteria 1374
521 Ga0501076_0599120 3300049592 Bacteria 909
522 Ga0501077_0085729 3300049593 Bacteria 1997
523 Ga0501077_0086136 3300049593 Bacteria 1992
524 Ga0501077_0175183 3300049593 Bacteria 1363
525 Ga0501077_0490270 3300049593 Bacteria 788
526 Ga0501079_0025203 3300049741 Bacteria 4562
527 Ga0501079_0028532 3300049741 Bacteria 4283
528 Ga0501079_0050032 3300049741 Bacteria 3226
529 Ga0501079_0152010 3300049741 Bacteria 1804
530 Ga0501079_0165712 3300049741 Bacteria 1723
531 Ga0501079_0378312 3300049741 Bacteria 1110
532 Ga0501080_0043318 3300049742 Bacteria 4191
533 Ga0501080_0259611 3300049742 Bacteria 1583
534 Ga0501080_0367925 3300049742 Bacteria 1296
535 Ga0501081_0020823 3300049743 Bacteria 4375
536 Ga0501081_0046910 3300049743 Bacteria 2971
537 Ga0501081_1074571 3300049743 Bacteria 609
538 Ga0501083_0272856 3300049744 Bacteria 1100
539 Ga0501083_0700156 3300049744 Bacteria 659
540 Ga0501035_0026524 3300049822 Bacteria 5300
541 Ga0501035_0028545 3300049822 Bacteria 5093
542 Ga0501035_0032808 3300049822 Bacteria 4723
543 Ga0501035_0040419 3300049822 Bacteria 4214
544 Ga0501035_1376196 3300049822 Bacteria 542
545 Ga0501044_0020500 3300049823 Bacteria 7059
546 Ga0501044_0104370 3300049823 Bacteria 2848
547 Ga0501044_0140506 3300049823 Bacteria 2404
548 Ga0501044_0235118 3300049823 Bacteria 1778
549 Ga0501044_0573827 3300049823 Bacteria 1023
550 Ga0501045_0083439 3300049824 Bacteria 2357
551 Ga0501045_0218344 3300049824 Bacteria 1420
552 Ga0501045_0295963 3300049824 Bacteria 1204
553 Ga0501045_0313591 3300049824 Bacteria 1167
554 Ga0501045_0517761 3300049824 Bacteria 886
555 nmdc:mga03683_232921_c1 3300050489 Bacteria 852
556 nmdc:mga03n38_137873_c1 3300050490 Bacteria 1216
557 nmdc:mga03n38_199602_c1 3300050490 Bacteria 1035
558 nmdc:mga03n38_42067_c1 3300050490 Bacteria 1995
559 nmdc:mga03n38_8350_c1 3300050490 Bacteria 3714
560 nmdc:mga00v17_33594_c1 3300050491 Bacteria 3041
561 nmdc:mga0yw44_12993_c2 3300050492 Bacteria 3661
562 nmdc:mga0yw44_284159_c1 3300050492 Bacteria 1106
563 nmdc:mga0yw44_323961_c1 3300050492 Bacteria 1035
564 nmdc:mga0yw44_706644_c1 3300050492 Bacteria 685
565 nmdc:mga06z11_111959_c1 3300050494 Bacteria 1513
566 nmdc:mga06z11_78831_c1 3300050494 Bacteria 1762
567 nmdc:mga06z11_8359_c1 3300050494 Bacteria 4312
568 nmdc:mga04h51_121999_c1 3300050495 Bacteria 972
569 nmdc:mga04h51_71683_c1 3300050495 Bacteria 1211
570 nmdc:mga07m45_261671_c1 3300050496 Bacteria 1006
571 nmdc:mga05p37_137270_c1 3300050507 Bacteria 2997
572 nmdc:mga05p37_1731230_c1 3300050507 Bacteria 607
573 nmdc:mga05p37_1841647_c1 3300050507 Bacteria 581
574 nmdc:mga05p37_293864_c1 3300050507 Bacteria 1933
575 nmdc:mga05p37_41170_c1 3300050507 Bacteria 5673
576 nmdc:mga05p37_539785_c1 3300050507 Bacteria 1330
577 nmdc:mga09592_226779_c1 3300050508 Bacteria 1619
578 nmdc:mga09592_325121_c1 3300050508 Bacteria 1332
579 nmdc:mga09592_857266_c1 3300050508 Bacteria 766
580 nmdc:mga0qj67_31040_c1 3300050509 Bacteria 4161
581 nmdc:mga0qj67_35451_c1 3300050509 Bacteria 3901
582 nmdc:mga0qj67_884256_c1 3300050509 Bacteria 704
583 nmdc:mga06r32_162165_c1 3300050510 Bacteria 2218
584 nmdc:mga06r32_3927_c1 3300050510 Bacteria 13335
585 nmdc:mga06r32_434603_c2 3300050510 Bacteria 629
586 nmdc:mga06r32_571836_c1 3300050510 Bacteria 1103
587 nmdc:mga06r32_579776_c1 3300050510 Bacteria 1094
588 nmdc:mga06r32_77661_c1 3300050510 Bacteria 3226
589 nmdc:mga08y16_102827_c1 3300050511 Bacteria 2974
590 nmdc:mga08y16_116401_c1 3300050511 Bacteria 2783
591 nmdc:mga08y16_223420_c1 3300050511 Bacteria 1949
592 nmdc:mga08y16_31062_c1 3300050511 Bacteria 5619
593 nmdc:mga08y16_32052_c1 3300050511 Bacteria 5526
594 nmdc:mga08y16_654842_c1 3300050511 Bacteria 1054
595 nmdc:mga0n895_1044781_c1 3300050512 Bacteria 796
596 nmdc:mga0n895_148336_c1 3300050512 Bacteria 2375
597 nmdc:mga0n895_1509380_c1 3300050512 Bacteria 638
598 nmdc:mga0n895_183616_c1 3300050512 Bacteria 2123
599 nmdc:mga0n895_54152_c1 3300050512 Bacteria 3945
600 nmdc:mga0rr50_13998_c1 3300050513 Bacteria 5244
601 nmdc:mga0rr50_274232_c1 3300050513 Bacteria 1406
602 nmdc:mga0rr50_34732_c1 3300050513 Bacteria 3613
603 nmdc:mga08x19_593133_c1 3300050514 Bacteria 785
604 nmdc:mga0a205_1161341_c1 3300050515 Bacteria 620
605 nmdc:mga0a205_8892_c1 3300050515 Bacteria 9153
606 Ga0495601_0141330 3300053077 Bacteria 1570
607 Ga0495612_0022836 3300053078 Bacteria 2508
608 Ga0495655_0313520 3300053083 Bacteria 542
609 Ga0495595_0129100 3300053084 Bacteria 1234
610 Ga0495619_0032928 3300053085 Bacteria 3364
611 Ga0495619_0388935 3300053085 Bacteria 964
612 Ga0500595_016892 3300053119 Bacteria 2709
613 Ga0500616_0001777 3300053153 Bacteria 19704
614 Ga0500616_0023732 3300053153 Bacteria 3414
615 Ga0500616_0064122 3300053153 Bacteria 1893
616 Ga0500616_0240723 3300053153 Bacteria 778
617 Ga0500620_272549 3300053155 Bacteria 557
618 Ga0500624_003122 3300053157 Bacteria 2184
619 Ga0501084_0024059 3300054114 Bacteria 5079
620 Ga0501084_0027792 3300054114 Bacteria 4727
621 Ga0501084_0140436 3300054114 Bacteria 2034
622 Ga0501084_1680323 3300054114 Bacteria 531
623 Ga0587077_174194 3300059493 Bacteria 578
624 Ga0587071_061658 3300060344 Bacteria 798
625 Ga0587111_0071714 3300060346 Bacteria 810
626 Ga0501082_0119060 3300060353 Bacteria 2288
627 Ga0501082_0320960 3300060353 Bacteria 1349
628 Ga0501082_0352413 3300060353 Bacteria 1283
629 Ga0501082_0425684 3300060353 Bacteria 1159
630 Ga0501082_1183145 3300060353 Bacteria 668
631 Ga0530510_0053728 3300061734 Bacteria 2910
632 Ga0530510_0097227 3300061734 Bacteria 2152
633 Ga0530510_0621811 3300061734 Bacteria 822
634 2507509797 2507262055 Bacteria 8048963
635 2508543813 2508501009 Bacteria 7784016
636 2508698399 2508501042 Bacteria 8719808
637 2513679088 2513237098 Bacteria 9902361
638 2513695960 2513237101 Bacteria 7952346
639 2513857554 2513237137 Bacteria 9558895
640 2515629991 2515154112 Bacteria 8294334
641 2517893506 2517572143 Bacteria 9484767
642 2524469954 2524023210 Bacteria 9029266
643 2644287934 2643221651 Bacteria 4798932
644 2671118142 2667528175 Bacteria 7532676
645 2723846189 2721755755 Bacteria 8322773
646 2728747731 2728368998 Bacteria 8720350
647 2849080435 2849076700 Bacteria 7039503
648 2874595094 2874590934 Bacteria 8299676
649 2874610896 2874604998 Bacteria 7834745
650 2874632670 2874628541 Bacteria 8630250
651 2874650955 2874645413 Bacteria 8214782
652 2876775030 2876771140 Bacteria 8287509
653 2876823845 2876818435 Bacteria 8274608
654 2879080473 2879074833 Bacteria 8279565
655 2879134921 2879127579 Bacteria 8294491
656 2879149231 2879142872 Bacteria 8267021
657 2885380965 2885374607 Bacteria 8927485
658 2885384464 2885383462 Bacteria 9473874
659 2888395002 2888388044 Bacteria 7304136
660 2906610389
661 2906628288 2906626472 Bacteria 8826946
662 2906642807 2906635258 Bacteria 8601019
663 2906665942 2906660503 Bacteria 8595048
664 2908778921 2908775508 Bacteria 8092255
665 2922428972
666 2932800422 2932794094 Bacteria 7915132
667 2932804596 2932801729 Bacteria 7987968
668 2935611344 2935608549 Bacteria 8203142
669 2935637765 2935630451 Bacteria 8169952
670 2935648728 2935648319 Bacteria 8801166
671 2935657189 2935656913 Bacteria 8965014
672 2935775281 2935769743 Bacteria 7878163
673 2935779518 2935777560 Bacteria 8077691
674 2935791521 2935785616 Bacteria 7962367
675 2935799833 2935793552 Bacteria 8012592
676 2935820821 2935819856 Bacteria 8261050
677 2935850919 2935847175 Bacteria 8228321
678 2935889789 2935883170 Bacteria 7964738
679 2935913714 2935908558 Bacteria 8568796
680 2935920296 2935916978 Bacteria 9113783
681 2935930635 2935926038 Bacteria 8601059
682 2935939392 2935934488 Bacteria 8602579
683 2935946341 2935942939 Bacteria 8599779
684 2935955820 2935951376 Bacteria 8602333
685 2935966976 2935959822 Bacteria 7869783
686 2935972470 2935967501 Bacteria 8603075
687 2935981699 2935975950 Bacteria 8347125
688 2935991074 2935984226 Bacteria 8302647
689 2936011638 2936011229 Bacteria 8801034
690 2936020233 2936019824 Bacteria 8804134
691 2936028928 2936028420 Bacteria 8965941
692 2936046956 2936046547 Bacteria 8903709
693 2936058164 2936055302 Bacteria 8785755
694 2941514438 2941507105 Bacteria 8166816
695 2941522334 2941515067 Bacteria 8166720
696 2941530147 2941523033 Bacteria 8169134
697 2941536107 2941531003 Bacteria 7653939
698 8006964547 8006964411 Bacteria 8966052
699 8006996053 8006994254 Bacteria 8309700
700 8016530803 8016522445 Bacteria 8156687
701 8016536093 8016530956 Bacteria 8155261
702 8016540375 8016539877 Bacteria 8155419
703 8016552860 8016548790 Bacteria 8155074
704 8016574443 8016566248 Bacteria 8158151
705 8016578538 8016575299 Bacteria 8154085
706 8016591224 8016583857 Bacteria 10421953
707 8016599096 8016595262 Bacteria 8149947
708 8016611955 8016603502 Bacteria 8731218
709 8016621850 8016613128 Bacteria 8794220
710 8016628003 8016622563 Bacteria 7999408
711 8016632326 8016630954 Bacteria 9217207
712 8019535818 8019530166 Bacteria 8155624
713 8019543659 8019538911 Bacteria 7872763
714 8019555116 8019547302 Bacteria 7996444
715 8019557956 8019555841 Bacteria 9642137
716 8019567329 8019565922 Bacteria 9639779
717 8019626802 8019619141 Bacteria 9218857
718 8019635707 8019629233 Bacteria 8687553
719 8019643976 8019638758 Bacteria 9062356
720 8019663505 8019659431 Bacteria 8577854
721 8019673117 8019668869 Bacteria 8791617
722 8019688723 8019687851 Bacteria 8712826
723 Ga0070668_100177547
724 JGI25404J52841_10013039
725 Ga0070690_100207609
726 Ga0070670_100953842
727 Ga0068869_100017207
728 Ga0068869_100347269
729 Ga0070666_10866435
730 Ga0070680_100003246
731 Ga0070680_100012371
732 Ga0070682_100039845
733 Ga0070682_101132594
734 Ga0070660_100011063
735 Ga0070689_100938919
736 Ga0070691_10016888
737 Ga0070691_10066283
738 Ga0070687_100168920
739 Ga0070661_100056615
740 Ga0070661_100596075
741 Ga0070692_10054754
742 Ga0070668_100846874
743 Ga0070668_100863339
744 Ga0070675_100393686
745 Ga0070671_100916296
746 Ga0070688_100059674
747 Ga0070659_100036234
748 Ga0070659_101633101
749 Ga0070667_100641913
750 Ga0070701_10005417
751 Ga0070705_100006514
752 Ga0070705_100006625
753 Ga0070705_100369103
754 Ga0070700_100010147
755 Ga0070700_100065299
756 Ga0070700_100119275
757 Ga0070700_100297258
758 Ga0070700_101203048
759 Ga0070694_100007558
760 Ga0070694_100793719
761 Ga0070694_101069482
762 Ga0070694_101168248
763 Ga0070708_100050222
764 Ga0070663_100011644
765 Ga0070663_100016160
766 Ga0070663_100358023
767 Ga0070663_100852641
768 Ga0070678_100141450
769 Ga0070678_100676193
770 Ga0070662_100293724
771 Ga0070681_10011583
772 Ga0070681_10088487
773 Ga0068867_100505778
774 Ga0070685_10263439
775 Ga0070685_10836668
776 Ga0070706_100367797
777 Ga0070707_100175421
778 Ga0070707_100202029
779 Ga0070707_100231769
780 Ga0070698_100206881
781 Ga0070698_100416867
782 Ga0070699_100002571
783 Ga0070699_100200880
784 Ga0070679_100049281
785 Ga0070679_100184324
786 Ga0070697_100119057
787 Ga0070697_100239221
788 Ga0068853_100040534
789 Ga0070686_100461855
790 Ga0070686_101170219
791 Ga0070686_101457915
792 Ga0070695_100001778
793 Ga0070695_100018719
794 Ga0070695_100058175
795 Ga0070696_100008610
796 Ga0070696_100022490
797 Ga0070693_100002809
798 Ga0070693_100079822
799 Ga0070704_100057353
800 Ga0070704_100088993
801 Ga0070704_100097286
802 Ga0070704_101088317
803 Ga0068855_100091602
804 Ga0070664_100046396
805 Ga0068857_100162572
806 Ga0068856_100129197
807 Ga0070702_100097041
808 Ga0068852_100159356
809 Ga0068859_100065425
810 Ga0068859_100640820
811 Ga0068859_101210556
812 Ga0068864_100006580
813 Ga0068864_101629155
814 Ga0068864_101667966
815 Ga0068861_100079500
816 Ga0068861_100265776
817 Ga0068861_101508435
818 Ga0068870_10022374
819 Ga0068863_100437090
820 Ga0068863_100545102
821 Ga0068863_100970397
822 Ga0068863_101703929
823 Ga0068858_100159505
824 Ga0068858_100439137
825 Ga0068860_100010003
826 Ga0068860_100027772
827 Ga0068860_100172720
828 Ga0068860_100197112
829 Ga0068860_100854376
830 Ga0068860_101631456
831 Ga0068862_100002462
832 Ga0068862_100048738
833 Ga0068862_100117287
834 Ga0068862_101363967
835 Ga0068862_101953986
836 Ga0081455_10004292
837 Ga0081540_1001954
838 Ga0081540_1194546
839 Ga0081539_10050840
840 Ga0081539_10153925
841 Ga0075365_10075468
842 Ga0075365_10395002
843 Ga0075365_10459969
844 Ga0075368_10002966
845 Ga0075363_100055511
846 Ga0075363_100127531
847 Ga0075363_100144396
848 Ga0075364_10011733
849 Ga0070715_10040617
850 Ga0070715_10625488
851 Ga0075362_10065919
852 Ga0075362_10550676
853 Ga0075367_10032301
854 Ga0075367_10371469
855 Ga0075367_10431717
856 Ga0097621_100782396
857 Ga0075370_10302785
858 Ga0075428_100012165
859 Ga0075428_100111245
860 Ga0075428_100135033
861 Ga0075428_100255326
862 Ga0075428_100931920
863 Ga0075430_100075551
864 Ga0075430_100551215
865 Ga0075430_100832358
866 Ga0075430_101437425
867 Ga0075431_100024490
868 Ga0075431_100080320
869 Ga0075431_100174899
870 Ga0075431_100227684
871 Ga0075431_100297926
872 Ga0075433_10195674
873 Ga0075433_10250798
874 Ga0075433_10742806
875 Ga0075433_11574617
876 Ga0075434_100040464
877 Ga0075434_100062343
878 Ga0075434_100203790
879 Ga0075429_100219257
880 Ga0075429_100387625
881 Ga0068865_100677427
882 Ga0075436_100982911
883 Ga0097620_100065425
884 Ga0097620_100640805
885 Ga0097620_101210553
886 Ga0075435_100018160
887 Ga0075435_100742246
888 Ga0099795_10040854
889 Ga0111539_10006608
890 Ga0111539_10017896
891 Ga0111539_10058172
892 Ga0111539_10278767
893 Ga0111539_10342289
894 Ga0111539_10391169
895 Ga0111539_10837204
896 Ga0105245_10036863
897 Ga0105245_10135230
898 Ga0105245_11170772
899 Ga0105247_10348247
900 Ga0105247_10602056
901 Ga0114129_10057856
902 Ga0114129_10391109
903 Ga0114129_10702845
904 Ga0114129_10803790
905 Ga0114129_11244173
906 Ga0114129_13219384
907 Ga0105243_10028727
908 Ga0105243_10728075
909 Ga0105243_10776325
910 Ga0105242_10551877
911 Ga0105248_10967282
912 Ga0105248_11316311
913 Ga0105237_10018592
914 Ga0105238_10130927
915 Ga0105249_10013294
916 Ga0105249_10780662
917 Ga0105249_11953063
918 Ga0105249_12019405
919 Ga0105239_11351728
920 Ga0105246_11170539
921 Ga0157370_10641961
922 Ga0157369_10398692
923 Ga0157378_10040081
924 Ga0157378_11722719
925 Ga0163162_10310482
926 Ga0163162_10525496
927 Ga0157375_10047041
928 Ga0157375_10073534
929 Ga0157375_11063063
930 Ga0157380_10185573
931 Ga0157380_10246770
932 Ga0157380_10390461
933 Ga0157380_10579920
934 Ga0157379_10085624
935 Ga0157379_10386304
936 Ga0157379_11711526
937 Ga0157376_10410533
938 Ga0163161_10409437
939 Ga0163161_10640657
940 Ga0206356_10381984
941 Ga0207682_10010123
942 Ga0207642_10490562
943 Ga0207710_10226116
944 Ga0207680_10554644
945 Ga0207647_10017465
946 Ga0207647_10033997
947 Ga0207685_10754860
948 Ga0207645_11002160
949 Ga0207684_11089209
950 Ga0207707_10011417
951 Ga0207671_10033313
952 Ga0207660_10008218
953 Ga0207660_10010703
954 Ga0207662_10090791
955 Ga0207662_10105148
956 Ga0207657_10017375
957 Ga0207657_10797034
958 Ga0207649_10084482
959 Ga0207652_10046567
960 Ga0207652_10228862
961 Ga0207646_10092622
962 Ga0207646_10138234
963 Ga0207646_10954169
964 Ga0207694_10023053
965 Ga0207650_11082479
966 Ga0207659_11072044
967 Ga0207687_10039500
968 Ga0207686_10459411
969 Ga0207709_10029931
970 Ga0207709_10108617
971 Ga0207709_10152056
972 Ga0207711_11414723
973 Ga0207689_10107639
974 Ga0207689_10278862
975 Ga0207689_10381907
976 Ga0207689_10840206
977 Ga0207679_10050613
978 Ga0207712_10002234
979 Ga0207668_10217050
980 Ga0207668_10436338
981 Ga0207640_10547666
982 Ga0207640_11212248
983 Ga0207658_10205325
984 Ga0207677_10046600
985 Ga0207703_10096381
986 Ga0207703_10444567
987 Ga0207703_10616064
988 Ga0207639_10029939
989 Ga0207678_10000118
990 Ga0207678_10034068
991 Ga0207678_10164622
992 Ga0207708_10016120
993 Ga0207708_10022034
994 Ga0207708_10123889
995 Ga0207708_10267685
996 Ga0207708_10319101
997 Ga0207708_11171454
998 Ga0207702_10076598
999 Ga0207641_10193783
1000 Ga0207676_10381975
1001 Ga0207676_10517364
1002 Ga0207674_10184695
1003 Ga0207675_100028558
1004 Ga0207675_100034087
1005 Ga0207675_100067569
1006 Ga0207675_100150669
1007 Ga0207683_10035272
1008 Ga0207683_10433261
1009 Ga0209813_10008787
1010 Ga0209813_10060135
1011 Ga0207428_10008077
1012 Ga0207428_10019254
1013 Ga0207428_10261969
1014 Ga0207428_10481845
1015 Ga0268265_10138589
1016 Ga0268265_10665476
1017 Ga0268264_10005854
1018 Ga0268264_10034682
1019 Ga0268264_10173935
1020 Ga0268264_10825641
1021 Ga0268264_11641533
1022 Ga0265340_10032122
1023 Ga0265316_10095094
1024 Ga0307408_100071207
1025 Ga0316575_10358619
1026 Ga0316576_10023973
1027 Ga0316578_10213872
1028 Ga0307405_10078680
1029 Ga0307413_10260354
1030 Ga0307410_10649297
1031 Ga0307409_100198315
1032 Ga0307416_100478881
1033 Ga0307411_10036612
1034 Ga0307415_101182778
1035 Ga0316586_1007657
1036 Ga0316588_1037631
1037 Ga0316596_1001444
1038 Ga0373958_0007762
1039 Ga0373938_0005076
1040 Ga0373934_0069895
1041 Ga0373940_0000987
1042 Ga0373949_0149587
1043 Ga0373952_0007818
1044 Ga0373952_0034555
1045 Ga0373923_0160862
1046 Ga0373923_0362289
1047 Ga0373932_0090783
1048 Ga0373939_0002313
1049 Ga0373953_0004766
1050 Ga0373954_0028040
1051 Ga0373954_0309950
1052 Ga0373956_0010844
1053 Ga0373957_0051784
1054 Ga0373955_0077990
1055 Ga0373942_0016431
1056 Ga0373961_0008792
1057 Ga0316574_0268202
1058 Ga0316574_0316988
1059 Ga0373931_0000685
1060 Ga0373931_0008373
1061 Ga0373927_0743414
1062 Ga0373947_0111676
1063 Ga0373937_0615671
1064 Ga0316582_0262595
1065 Ga0316584_0031109
1066 Ga0395905_0000002
1067 Ga0400486_32257
1068 Ga0400487_44160
1069 Ga0436365_0741969
1070 Ga0436363_0062250
1071 Ga0436363_0270409
1072 Ga0436362_1178884
1073 Ga0453683_0443351
1074 Ga0453684_0445324
1075 Ga0495617_098917
1076 Ga0495592_0331962
1077 Ga0495603_0025882
1078 Ga0495638_0420545
1079 Ga0495653_0575345
1080 Ga0495664_0540742
1081 Ga0495608_0257843
1082 Ga0495618_0233070
1083 Ga0495628_0201429
1084 Ga0495652_0317586
1085 Ga0495645_0361513
1086 Ga0495633_0126077
1087 Ga0495667_0071936
1088 Ga0495656_0444313
1089 Ga0495625_0128806
1090 Ga0495625_0152947
1091 Ga0495625_0389362
1092 Ga0495625_0400847
1093 Ga0495635_0892186
1094 Ga0495657_0337742
1095 Ga0495658_0250139
1096 Ga0495658_0250931
1097 Ga0495649_0115869
1098 Ga0495600_0645807
1099 Ga0495604_0159833
1100 Ga0495674_0438943
1101 Ga0495672_0093550
1102 Ga0495675_0104893
1103 Ga0495602_0092704
1104 Ga0495615_0062628
1105 Ga0496100_0020609
1106 Ga0496100_0035344
1107 Ga0496101_0006539
1108 Ga0496101_0024585
1109 Ga0496101_0188547
1110 Ga0496102_0008953
1111 Ga0496102_0025641
1112 Ga0496102_0138502
1113 Ga0496102_0356934
1114 Ga0496102_0559746
1115 Ga0496102_0649976
1116 Ga0496103_0023955
1117 Ga0496103_0284503
1118 Ga0496104_0000216
1119 Ga0496104_0095241
1120 Ga0496104_0225123
1121 Ga0496104_0270537
1122 Ga0496104_0375934
1123 Ga0496104_0820865
1124 Ga0496105_0072606
1125 Ga0496105_0236024
1126 Ga0496105_0511263
1127 Ga0496105_0608655
1128 Ga0496105_0659401
1129 Ga0496106_0007414
1130 Ga0496106_0008312
1131 Ga0496106_0107769
1132 Ga0496106_0126584
1133 Ga0496107_0009695
1134 Ga0496107_0065436
1135 Ga0496107_0464494
1136 Ga0496107_0527942
1137 Ga0496108_0011283
1138 Ga0496108_0202215
1139 Ga0496108_1109627
1140 Ga0496109_0033418
1141 Ga0496109_0280252
1142 Ga0496109_0576459
1143 Ga0496109_0947992
1144 Ga0496110_0000957
1145 Ga0496110_0034389
1146 Ga0496110_0148815
1147 Ga0496110_0648584
1148 Ga0496110_1031465
1149 Ga0496111_0123557
1150 Ga0496111_0160560
1151 Ga0496111_0168577
1152 Ga0496111_0371201
1153 Ga0496111_1348283
1154 Ga0496112_0020950
1155 Ga0496112_0557778
1156 Ga0496112_0710527
1157 Ga0496113_0004691
1158 Ga0496113_0544249
1159 Ga0496114_0032687
1160 Ga0496114_0526604
1161 Ga0496114_0595315
1162 Ga0496114_1252425
1163 Ga0496115_0010086
1164 Ga0496115_0049897
1165 Ga0496115_0320733
1166 Ga0496115_0564875
1167 Ga0496115_1267349
1168 Ga0496124_0584017
1169 Ga0501031_0045435
1170 Ga0501032_0205650
1171 Ga0501033_0020839
1172 Ga0501033_0386197
1173 Ga0501034_0035297
1174 Ga0501034_0130903
1175 Ga0501034_0525015
1176 Ga0501034_0552590
1177 Ga0501034_0950622
1178 Ga0501036_0000753
1179 Ga0501036_0050604
1180 Ga0501036_0260737
1181 Ga0501036_0260826
1182 Ga0501036_0416150
1183 Ga0501037_0029678
1184 Ga0501038_0058198
1185 Ga0501038_0160415
1186 Ga0501038_0280267
1187 Ga0501038_0336183
1188 Ga0501039_0067744
1189 Ga0501039_0156539
1190 Ga0501039_0264958
1191 Ga0501039_0295099
1192 Ga0501040_0018714
1193 Ga0501040_0400159
1194 Ga0501041_0071840
1195 Ga0501041_0119870
1196 Ga0501041_0121868
1197 Ga0501042_0091459
1198 Ga0501042_0188123
1199 Ga0501042_0691500
1200 Ga0501042_0714740
1201 Ga0501043_0087216
1202 Ga0501043_0392807
1203 Ga0501046_0002625
1204 Ga0501046_0022425
1205 Ga0501046_0707133
1206 Ga0501046_0769214
1207 Ga0501046_1144787
1208 Ga0501047_0032813
1209 Ga0501047_0119021
1210 Ga0501047_0242118
1211 Ga0501047_0250003
1212 Ga0501048_0089793
1213 Ga0501067_0006205
1214 Ga0501067_0063219
1215 Ga0501067_0214117
1216 Ga0501068_0114573
1217 Ga0501068_0681371
1218 Ga0501069_0011030
1219 Ga0501069_0076967
1220 Ga0501070_0000242
1221 Ga0501070_0166494
1222 Ga0501070_0850966
1223 Ga0501070_1294268
1224 Ga0501071_0233860
1225 Ga0501071_0277685
1226 Ga0501072_0002118
1227 Ga0501072_0345630
1228 Ga0501073_0014097
1229 Ga0501073_0116148
1230 Ga0501073_0307400
1231 Ga0501073_0360559
1232 Ga0501073_0449644
1233 Ga0501073_0829991
1234 Ga0501073_0988083
1235 Ga0501074_0031472
1236 Ga0501074_0066986
1237 Ga0501074_0127774
1238 Ga0501074_0661334
1239 Ga0501075_0054908
1240 Ga0501075_0287045
1241 Ga0501076_0046867
1242 Ga0501076_0276965
1243 Ga0501076_0599120
1244 Ga0501077_0085729
1245 Ga0501077_0086136
1246 Ga0501077_0175183
1247 Ga0501077_0490270
1248 Ga0501079_0025203
1249 Ga0501079_0028532
1250 Ga0501079_0050032
1251 Ga0501079_0152010
1252 Ga0501079_0165712
1253 Ga0501079_0378312
1254 Ga0501080_0043318
1255 Ga0501080_0259611
1256 Ga0501080_0367925
1257 Ga0501081_0020823
1258 Ga0501081_0046910
1259 Ga0501081_1074571
1260 Ga0501083_0272856
1261 Ga0501083_0700156
1262 Ga0501035_0026524
1263 Ga0501035_0028545
1264 Ga0501035_0032808
1265 Ga0501035_0040419
1266 Ga0501035_1376196
1267 Ga0501044_0020500
1268 Ga0501044_0104370
1269 Ga0501044_0140506
1270 Ga0501044_0235118
1271 Ga0501044_0573827
1272 Ga0501045_0083439
1273 Ga0501045_0218344
1274 Ga0501045_0295963
1275 Ga0501045_0313591
1276 Ga0501045_0517761
1277 nmdc:mga03683_232921_c1
1278 nmdc:mga03n38_137873_c1
1279 nmdc:mga03n38_199602_c1
1280 nmdc:mga03n38_42067_c1
1281 nmdc:mga03n38_8350_c1
1282 nmdc:mga00v17_33594_c1
1283 nmdc:mga0yw44_12993_c2
1284 nmdc:mga0yw44_284159_c1
1285 nmdc:mga0yw44_323961_c1
1286 nmdc:mga0yw44_706644_c1
1287 nmdc:mga06z11_111959_c1
1288 nmdc:mga06z11_78831_c1
1289 nmdc:mga06z11_8359_c1
1290 nmdc:mga04h51_121999_c1
1291 nmdc:mga04h51_71683_c1
1292 nmdc:mga07m45_261671_c1
1293 nmdc:mga05p37_137270_c1
1294 nmdc:mga05p37_1731230_c1
1295 nmdc:mga05p37_1841647_c1
1296 nmdc:mga05p37_293864_c1
1297 nmdc:mga05p37_41170_c1
1298 nmdc:mga05p37_539785_c1
1299 nmdc:mga09592_226779_c1
1300 nmdc:mga09592_325121_c1
1301 nmdc:mga09592_857266_c1
1302 nmdc:mga0qj67_31040_c1
1303 nmdc:mga0qj67_35451_c1
1304 nmdc:mga0qj67_884256_c1
1305 nmdc:mga06r32_162165_c1
1306 nmdc:mga06r32_3927_c1
1307 nmdc:mga06r32_434603_c2
1308 nmdc:mga06r32_571836_c1
1309 nmdc:mga06r32_579776_c1
1310 nmdc:mga06r32_77661_c1
1311 nmdc:mga08y16_102827_c1
1312 nmdc:mga08y16_116401_c1
1313 nmdc:mga08y16_223420_c1
1314 nmdc:mga08y16_31062_c1
1315 nmdc:mga08y16_32052_c1
1316 nmdc:mga08y16_654842_c1
1317 nmdc:mga0n895_1044781_c1
1318 nmdc:mga0n895_148336_c1
1319 nmdc:mga0n895_1509380_c1
1320 nmdc:mga0n895_183616_c1
1321 nmdc:mga0n895_54152_c1
1322 nmdc:mga0rr50_13998_c1
1323 nmdc:mga0rr50_274232_c1
1324 nmdc:mga0rr50_34732_c1
1325 nmdc:mga08x19_593133_c1
1326 nmdc:mga0a205_1161341_c1
1327 nmdc:mga0a205_8892_c1
1328 Ga0495601_0141330
1329 Ga0495612_0022836
1330 Ga0495655_0313520
1331 Ga0495595_0129100
1332 Ga0495619_0032928
1333 Ga0495619_0388935
1334 Ga0500595_016892
1335 Ga0500616_0001777
1336 Ga0500616_0023732
1337 Ga0500616_0064122
1338 Ga0500616_0240723
1339 Ga0500620_272549
1340 Ga0500624_003122
1341 Ga0501084_0024059
1342 Ga0501084_0027792
1343 Ga0501084_0140436
1344 Ga0501084_1680323
1345 Ga0587077_174194
1346 Ga0587071_061658
1347 Ga0587111_0071714
1348 Ga0501082_0119060
1349 Ga0501082_0320960
1350 Ga0501082_0352413
1351 Ga0501082_0425684
1352 Ga0501082_1183145
1353 Ga0530510_0053728
1354 Ga0530510_0097227
1355 Ga0530510_0621811
1356 2507509797
1357 2508543813
1358 2508698399
1359 2513679088
1360 2513695960
1361 2513857554
1362 2515629991
1363 2517893506
1364 2524469954
1365 2644287934
1366 2671118142
1367 2723846189
1368 2728747731
1369 2849080435
1370 2874595094
1371 2874610896
1372 2874632670
1373 2874650955
1374 2876775030
1375 2876823845
1376 2879080473
1377 2879134921
1378 2879149231
1379 2885380965
1380 2885384464
1381 2888395002
1382 2906610389
1383 2906628288
1384 2906642807
1385 2906665942
1386 2908778921
1387 2922428972
1388 2932800422
1389 2932804596
1390 2935611344
1391 2935637765
1392 2935648728
1393 2935657189
1394 2935775281
1395 2935779518
1396 2935791521
1397 2935799833
1398 2935820821
1399 2935850919
1400 2935889789
1401 2935913714
1402 2935920296
1403 2935930635
1404 2935939392
1405 2935946341
1406 2935955820
1407 2935966976
1408 2935972470
1409 2935981699
1410 2935991074
1411 2936011638
1412 2936020233
1413 2936028928
1414 2936046956
1415 2936058164
1416 2941514438
1417 2941522334
1418 2941530147
1419 2941536107
1420 8006964547
1421 8006996053
1422 8016530803
1423 8016536093
1424 8016540375
1425 8016552860
1426 8016574443
1427 8016578538
1428 8016591224
1429 8016599096
1430 8016611955
1431 8016621850
1432 8016628003
1433 8016632326
1434 8019535818
1435 8019543659
1436 8019555116
1437 8019557956
1438 8019567329
1439 8019626802
1440 8019635707
1441 8019643976
1442 8019663505
1443 8019673117
1444 8019688723

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00298

Ribosomal_L11

Ribosomal protein L11, RNA binding domain

93

161

0.99

PF03946

Ribosomal_L11_N

Ribosomal protein L11, N-terminal domain

30

88

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cjt-assembly4.cif.gz_H ribosomal protein l11 methyltransferase (prma) in complex with dimethylated ribosomal protein l11 0.9537 3 73
3egv-assembly1.cif.gz_B ribosomal protein l11 methyltransferase (prma) in complex with trimethylated ribosomal protein l11 0.9481 3 80
3egv-assembly1.cif.gz_B ribosomal protein l11 methyltransferase (prma) in complex with trimethylated ribosomal protein l11 0.9365 3 80
3cjt-assembly4.cif.gz_H ribosomal protein l11 methyltransferase (prma) in complex with dimethylated ribosomal protein l11 0.9284 3 73
2bcw-assembly1.cif.gz_A coordinates of the n-terminal domain of ribosomal protein l11,c-terminal domain of ribosomal protein l7/l12 and a portion of the g' domain of elongation factor g, as fitted into cryo-em map of an escherichia coli 70s*ef-g*gdp*fusidic acid complex 0.9227 9 73
ID Description Score Start End Superfamily
af_A0A0R4J4M9_4_71_3.30.1550.10 Alpha Beta;2-Layer Sandwich;Ribosomal protein L11, N-terminal domain;Ribosomal protein L11/L12, N-terminal domain 0.9831 3 69 3.30.1550.10
af_Q9VFJ2_20_96_3.30.1550.10 Alpha Beta;2-Layer Sandwich;Ribosomal protein L11, N-terminal domain;Ribosomal protein L11/L12, N-terminal domain 0.9637 6 81 3.30.1550.10
af_Q8IIQ5_3_68_3.30.1550.10 Alpha Beta;2-Layer Sandwich;Ribosomal protein L11, N-terminal domain;Ribosomal protein L11/L12, N-terminal domain 0.9587 6 70 3.30.1550.10
af_A0A0R4J4M9_4_71_3.30.1550.10 Alpha Beta;2-Layer Sandwich;Ribosomal protein L11, N-terminal domain;Ribosomal protein L11/L12, N-terminal domain 0.9551 3 69 3.30.1550.10
3egvB00 Alpha Beta;2-Layer Sandwich;Ribosomal protein L11, N-terminal domain;Ribosomal protein L11/L12, N-terminal domain 0.9481 3 80 3.30.1550.10
ID Description Score Start End GO Terms
AF-A0A4Q3RV35-F1-model_v4 50S ribosomal protein L11 1.002 1 64 GO:0003735
GO:0006412
GO:0022625
GO:0070180
AF-A0A7Y3CRS9-F1-model_v4 50S ribosomal protein L11 1.001 1 73 GO:0003735
GO:0006412
GO:0022625
GO:0070180
AF-A0A379KAS4-F1-model_v4 50S ribosomal protein L11 0.9999 1 73 GO:0003735
GO:0006412
GO:0022625
GO:0070180
AF-F4N6J0-F1-model_v4 50S ribosomal protein L11 0.9972 1 73 GO:0003735
GO:0006412
GO:0022625
GO:0070180
AF-A0A258C299-F1-model_v4 deleted 0.9962 1 77

Map