F477398

General Info

Members Datasets Scaffolds Average Seq Length
722 282 677 371

Family's Representative Sequence

Representative Sequence 3300003784|Ga0055534_1009919|Ga0055534_10099192
Length 423
Sequence LQYEDPSFSATLVAWQKEYGRHDLPWQNTRDAYLVWLSEIMLQQTQVSAVLGYYERFLERFPTLASLAAAPVEDVMAQWAGLGYYTRARNLHKCAQRVVAEYGGVFPSDPALLAELPGIGRSTAAAIAAFSAGRRAAIMDGNVKRVFARVFGIDTYPGERKTEXAMWARAEALAPAEGIEAXTXGLMDMGATLCTRSSPSCERCPMQARCVAFATGRTAELPVRKPKKATPEKSAHMLLVVDRGQVLLEQRPASGIWGGLLSLPELAGHLAEADTPDDGAVAAAVHPFGPMESLERLLPVMHVFTHYKLHIHPLLVTLASRAALAGEGRYVWLDAAAIPDAALPAPIKKLLLDLLGERARRACSDRTQEMNSLATLNAVPITLTMLAAIAPTTHLIRRVSICAICVPIRANCISNFARSSFVA

Samples

Sample ID Description Type Environment
1 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
2 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
3 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
4 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
5 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
6 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
7 2643221638 Duganella sp. Root336D2 Isolate Unclassified
8 2643221645 Massilia sp. Root351 Isolate Unclassified
9 2643221664 Massilia sp. Root418 Isolate Unclassified
10 2738541280 Massilia sp. GV090 Isolate Unclassified
11 2738541297 Duganella sp. GV083 Isolate Unclassified
12 2738541300 Massilia sp. GV016 Isolate Unclassified
13 2738541357 Duganella sp. GV053 Isolate Unclassified
14 2738543003 Duganella sp. GV066 Isolate Unclassified
15 2738543018 Massilia sp. GV045 Isolate Unclassified
16 2738543026 Duganella sp. GV089 Isolate Unclassified
17 2738543029 Duganella sp. GV039 Isolate Unclassified
18 2738543030 Massilia sp. GV097 Isolate Unclassified
19 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
20 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
21 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
22 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
23 2818991436 Collimonas arenae 515 Isolate Unclassified
24 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
25 2821131069 Duganella sp. 1224 Isolate Unclassified
26 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
27 2842711865 Duganella sp. R-73148 Isolate Unclassified
28 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
29 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
30 2857553236 Duganella sp. R-74557 Isolate Unclassified
31 2857558681 Duganella sp. R-74565 Isolate Unclassified
32 2857564685 Duganella sp. R-74599 Isolate Unclassified
33 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
34 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
35 2904424332 Duganella sp. 1411 Isolate Rhizosphere
36 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
37 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
38 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
39 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
40 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
41 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
42 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
43 2919476304 Duganella sp. 3397 Isolate Unclassified
44 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
45 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
46 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
47 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
48 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
49 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
50 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
51 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
52 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
53 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
54 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
55 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
56 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
57 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
58 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
59 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
60 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
61 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
62 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
63 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
64 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
65 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
66 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
67 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
68 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
69 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
70 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
71 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
72 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
73 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
74 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
75 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
76 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
77 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
78 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
79 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
80 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
81 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
92 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
93 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
94 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
97 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
98 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
99 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
104 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
105 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
106 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
107 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
108 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
110 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
111 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
115 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
118 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
119 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
120 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
123 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
138 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
139 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
140 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
141 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
142 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
143 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
144 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
145 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
146 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
149 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
150 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
151 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
152 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
153 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
154 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
155 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
156 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
157 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
158 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
159 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
160 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
161 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
162 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
163 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
164 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
165 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
166 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
167 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
168 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
169 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
170 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
171 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
172 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
173 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
174 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
175 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
176 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
177 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
178 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
179 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
180 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
181 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
182 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
183 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
184 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
185 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
186 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
187 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
188 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
189 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
190 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
191 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
192 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
193 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
194 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
195 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
196 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
197 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
198 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
199 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
200 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
201 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
202 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
203 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
204 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
205 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
206 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
207 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
208 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
209 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
210 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
211 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
212 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
213 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
214 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
215 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
216 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
217 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
218 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
219 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
220 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
221 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
222 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
223 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
224 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
225 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
226 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
227 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
228 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
229 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
230 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
231 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
232 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
233 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
234 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
235 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
236 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
237 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
238 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
239 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
240 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
241 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
242 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
243 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
244 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
245 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
246 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
247 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
248 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
249 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
250 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
251 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
252 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
253 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
254 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
255 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
256 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
257 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
258 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
259 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
260 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
261 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
262 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
263 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
264 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
265 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
266 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
267 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
268 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
269 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
270 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
271 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
272 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
273 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
274 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
275 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
276 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
277 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
278 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
279 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
280 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
281 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
282 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.35
Metatranscriptomes 0.42
Isolates 6.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.48
Nodule 0.83
Rhizoplane 2.91
Rhizosphere 69.67
Stem 0
Stem Tuber 0
Unclassified 10.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1002276 3300002739 Bacteria 3173
2 JGI25158J39367_1006829 3300002739 Bacteria 1627
3 JGI25152J39213_1000224 3300002773 Bacteria 38367
4 JGI25159J45721_1003027 3300002987 Bacteria 6093
5 JGI25151J46595_10002270 3300003187 Bacteria 11802
6 JGI25151J46595_10004291 3300003187 Bacteria 7578
7 JGI25165J46597_1000051 3300003214 Bacteria 241012
8 rootL2_10029882 3300003322 Bacteria 4126
9 rootL2_10183526 3300003322 Bacteria 3405
10 rootH1_10075425 3300003323 Bacteria 2745
11 JGI25161J50226_1000949 3300003374 Bacteria 10349
12 Ga0007409J51694_1079496 3300003575 Bacteria 2071
13 Ga0055538_1000025 3300003751 Bacteria 241012
14 Ga0055538_1000062 3300003751 Bacteria 105260
15 Ga0055539_1000032 3300003752 Bacteria 241012
16 Ga0055539_1000093 3300003752 Bacteria 105260
17 Ga0055533_1000042 3300003756 Bacteria 241012
18 Ga0055533_1000105 3300003756 Bacteria 105260
19 Ga0055525_1000018 3300003759 Bacteria 393974
20 Ga0055525_1000050 3300003759 Bacteria 241012
21 Ga0055525_1000137 3300003759 Bacteria 105260
22 Ga0055529_1000079 3300003763 Bacteria 149370
23 Ga0055526_1000211 3300003771 Bacteria 50334
24 Ga0055526_1000272 3300003771 Bacteria 43827
25 Ga0055526_1004035 3300003771 Bacteria 9023
26 Ga0055526_1007275 3300003771 Bacteria 5797
27 Ga0055526_1007509 3300003771 Bacteria 5648
28 Ga0055526_1007814 3300003771 Bacteria 5473
29 Ga0055526_1008251 3300003771 Bacteria 5231
30 Ga0055537_1000038 3300003773 Bacteria 92762
31 Ga0055537_1002750 3300003773 Bacteria 5689
32 Ga0055524_1000024 3300003775 Bacteria 217953
33 Ga0055524_1000728 3300003775 Bacteria 22579
34 Ga0055524_1001031 3300003775 Bacteria 17211
35 Ga0055524_1001453 3300003775 Bacteria 13555
36 Ga0055524_1001929 3300003775 Bacteria 11171
37 Ga0055536_1000134 3300003781 Bacteria 63257
38 Ga0055534_1000074 3300003784 Bacteria 77272
39 Ga0055534_1001413 3300003784 Bacteria 9578
40 Ga0055534_1009919 3300003784 Bacteria 2030
41 Ga0055528_1000231 3300003790 Bacteria 46568
42 Ga0055528_1001043 3300003790 Bacteria 18281
43 Ga0055530_10001965 3300003791 Bacteria 13987
44 Ga0055530_10003946 3300003791 Bacteria 8028
45 Ga0055531_10007726 3300003794 Bacteria 5805
46 Ga0055541_1000023 3300003841 Bacteria 241012
47 Ga0055541_1000063 3300003841 Bacteria 105260
48 Ga0055543_1000924 3300004625 Bacteria 13678
49 Ga0065165_1002806 3300005262 Bacteria 13678
50 Ga0070660_100039087 3300005339 Bacteria 3605
51 Ga0070660_100218844 3300005339 Bacteria 1547
52 Ga0070673_100233069 3300005364 Bacteria 1598
53 Ga0068853_100254777 3300005539 Bacteria 1612
54 Ga0068855_100007118 3300005563 Bacteria 13571
55 Ga0068855_100020379 3300005563 Bacteria 7954
56 Ga0070664_100047821 3300005564 Bacteria 3615
57 Ga0068854_100005433 3300005578 Bacteria 8045
58 Ga0068856_100034024 3300005614 Bacteria 4991
59 Ga0068851_10049041 3300005834 Bacteria 2141
60 Ga0068863_100167702 3300005841 Bacteria 2106
61 Ga0099826_10000007 3300006948 Bacteria 393518
62 Ga0099826_10000010 3300006948 Bacteria 314346
63 Ga0105244_10003379 3300009036 Bacteria 11424
64 Ga0105240_10062674 3300009093 Bacteria 4628
65 Ga0105240_10242754 3300009093 Bacteria 2087
66 Ga0105245_10117468 3300009098 Bacteria 2481
67 Ga0105241_10013339 3300009174 Bacteria 6023
68 Ga0105242_10205817 3300009176 Bacteria 1750
69 Ga0105237_10014347 3300009545 Bacteria 8291
70 Ga0105238_10000763 3300009551 Bacteria 33477
71 Ga0105239_10155414 3300010375 Bacteria 2554
72 Ga0157371_10000018 3300013102 Bacteria 310522
73 Ga0157380_10500275 3300014326 Bacteria 1180
74 Ga0182008_10001672 3300014497 Bacteria 14588
75 Ga0182008_10022614 3300014497 Bacteria 3219
76 Ga0182006_1000141 3300015261 Bacteria 77478
77 Ga0182006_1004639 3300015261 Bacteria 6734
78 Ga0182006_1036812 3300015261 Bacteria 1944
79 Ga0182007_10000144 3300015262 Bacteria 47717
80 Ga0182007_10005958 3300015262 Bacteria 5289
81 Ga0182005_1000016 3300015265 Bacteria 346889
82 Ga0182005_1000024 3300015265 Bacteria 238256
83 Ga0163161_10114153 3300017792 Bacteria 2023
84 Ga0213872_10000005 3300021361 Bacteria 290165
85 Ga0213872_10004614 3300021361 Bacteria 7263
86 Ga0213872_10019006 3300021361 Bacteria 3165
87 Ga0213872_10025486 3300021361 Bacteria 2718
88 Ga0209760_103617 3300025207 Bacteria 1364
89 Ga0209436_100797 3300025208 Bacteria 12952
90 Ga0209784_100010 3300025224 Bacteria 683664
91 Ga0209784_100021 3300025224 Bacteria 408534
92 Ga0209566_100008 3300025225 Bacteria 683664
93 Ga0209566_100119 3300025225 Bacteria 105312
94 Ga0209674_100019 3300025226 Bacteria 683664
95 Ga0209674_100036 3300025226 Bacteria 408534
96 Ga0209563_100011 3300025230 Bacteria 1187808
97 Ga0209563_100021 3300025230 Bacteria 683764
98 Ga0209563_100040 3300025230 Bacteria 408534
99 Ga0207427_100596 3300025231 Bacteria 18082
100 Ga0209437_100019 3300025233 Bacteria 683764
101 Ga0209437_100332 3300025233 Bacteria 58796
102 Ga0207425_1000021 3300025245 Bacteria 367537
103 Ga0207425_1000223 3300025245 Bacteria 44555
104 Ga0207425_1000640 3300025245 Bacteria 19664
105 Ga0209646_1000068 3300025246 Bacteria 233765
106 Ga0209026_1002283 3300025250 Bacteria 7326
107 Ga0209677_100011 3300025253 Bacteria 683664
108 Ga0209677_100023 3300025253 Bacteria 408534
109 Ga0209677_104408 3300025253 Bacteria 4074
110 Ga0209129_1000020 3300025258 Bacteria 457053
111 Ga0209129_1004859 3300025258 Bacteria 5038
112 Ga0209233_1000025 3300025261 Bacteria 683764
113 Ga0209565_1000104 3300025263 Bacteria 124432
114 Ga0209565_1000123 3300025263 Bacteria 111069
115 Ga0209565_1001864 3300025263 Bacteria 8419
116 Ga0209565_1002627 3300025263 Bacteria 6341
117 Ga0209565_1008102 3300025263 Bacteria 2776
118 Ga0209455_1000070 3300025272 Bacteria 307867
119 Ga0209673_1000040 3300025273 Bacteria 312633
120 Ga0209130_1001646 3300025284 Bacteria 13692
121 Ga0209130_1002608 3300025284 Bacteria 8713
122 Ga0209675_1000117 3300025291 Bacteria 111087
123 Ga0209675_1001657 3300025291 Bacteria 12392
124 Ga0209675_1002531 3300025291 Bacteria 9301
125 Ga0209675_1022431 3300025291 Bacteria 1659
126 Ga0209676_1000036 3300025292 Bacteria 457623
127 Ga0209025_1001884 3300025294 Bacteria 24520
128 Ga0209025_1002014 3300025294 Bacteria 23186
129 Ga0209025_1003834 3300025294 Bacteria 13691
130 Ga0209025_1018501 3300025294 Bacteria 3940
131 Ga0209564_1000027 3300025295 Bacteria 518458
132 Ga0209564_1000047 3300025295 Bacteria 368031
133 Ga0209564_1000121 3300025295 Bacteria 204081
134 Ga0209564_1000780 3300025295 Bacteria 44199
135 Ga0209564_1001065 3300025295 Bacteria 33211
136 Ga0209564_1001271 3300025295 Bacteria 27762
137 Ga0209564_1002491 3300025295 Bacteria 14365
138 Ga0209564_1002959 3300025295 Bacteria 12247
139 Ga0209758_1000077 3300025297 Bacteria 268195
140 Ga0209758_1000322 3300025297 Bacteria 92458
141 Ga0209758_1006210 3300025297 Bacteria 8726
142 Ga0209050_1000050 3300025298 Bacteria 362578
143 Ga0209050_1000795 3300025298 Bacteria 44648
144 Ga0209256_1000054 3300025299 Bacteria 298431
145 Ga0209256_1000287 3300025299 Bacteria 88526
146 Ga0209256_1000288 3300025299 Bacteria 88470
147 Ga0209256_1000543 3300025299 Bacteria 54373
148 Ga0209256_1000674 3300025299 Bacteria 46225
149 Ga0209256_1001001 3300025299 Bacteria 33573
150 Ga0209256_1002870 3300025299 Bacteria 13096
151 Ga0209256_1003939 3300025299 Bacteria 9768
152 Ga0207426_1001270 3300025302 Bacteria 22014
153 Ga0209257_1000075 3300025304 Bacteria 324855
154 Ga0209257_1007416 3300025304 Bacteria 6628
155 Ga0207655_1000710 3300025728 Bacteria 38274
156 Ga0207655_1008685 3300025728 Bacteria 6412
157 Ga0207654_10008046 3300025911 Bacteria 5314
158 Ga0207695_10002760 3300025913 Bacteria 25592
159 Ga0207671_10006962 3300025914 Bacteria 9936
160 Ga0207657_10027747 3300025919 Bacteria 5179
161 Ga0207694_10000343 3300025924 Bacteria 44142
162 Ga0207706_10215656 3300025933 Bacteria 1681
163 Ga0207686_10075326 3300025934 Bacteria 2184
164 Ga0207689_10188798 3300025942 Bacteria 1700
165 Ga0207667_10000912 3300025949 Bacteria 37632
166 Ga0207640_10014951 3300025981 Bacteria 4480
167 Ga0207640_10206951 3300025981 Bacteria 1491
168 Ga0207678_10339963 3300026067 Bacteria 1293
169 Ga0207702_10032111 3300026078 Bacteria 4381
170 Ga0207702_10094471 3300026078 Bacteria 2625
171 Ga0209281_1005795 3300027111 Bacteria 3338
172 Ga0209282_1000021 3300027666 Bacteria 177705
173 Ga0209282_1000072 3300027666 Bacteria 81137
174 Ga0316181_1091467 3300030744 Bacteria 2915
175 Ga0307408_100000531 3300031548 Bacteria 32967
176 Ga0307408_100002211 3300031548 Bacteria 13890
177 Ga0307408_100004170 3300031548 Bacteria 9847
178 Ga0307408_100005814 3300031548 Bacteria 8206
179 Ga0316576_10003778 3300031727 Bacteria 8949
180 Ga0316578_10052312 3300031728 Bacteria 2393
181 Ga0307518_10111354 3300031838 Bacteria 1950
182 Ga0307411_10162416 3300032005 Bacteria 1675
183 Ga0316583_10011958 3300032133 Bacteria 3132
184 Ga0316593_10005972 3300032168 Bacteria 3256
185 Ga0316588_1000267 3300033528 Bacteria 6412
186 Ga0373931_0060346 3300035691 Bacteria 2041
187 Ga0395899_0000386 3300037312 Bacteria 52584
188 Ga0395899_0010874 3300037312 Bacteria 6974
189 Ga0395899_0011797 3300037312 Bacteria 6687
190 Ga0395900_0000321 3300037418 Bacteria 71088
191 Ga0395900_0007976 3300037418 Bacteria 10896
192 Ga0395900_0066996 3300037418 Bacteria 3689
193 Ga0395905_0018554 3300037471 Bacteria 6602
194 Ga0395901_0000187 3300038443 Bacteria 79696
195 Ga0395901_0131972 3300038443 Bacteria 2625
196 Ga0395901_0314752 3300038443 Bacteria 1620
197 Ga0395901_0441198 3300038443 Bacteria 1332
198 Ga0436361_0145169 3300039447 Bacteria 14273
199 Ga0436361_0235534 3300039447 Bacteria 12344
200 Ga0436361_0240080 3300039447 Bacteria 4429
201 Ga0436361_0252850 3300039447 Bacteria 2993
202 Ga0436361_0820978 3300039447 Bacteria 73779
203 Ga0436361_0977423 3300039447 Bacteria 2265
204 Ga0436361_1067374 3300039447 Bacteria 3776
205 Ga0436361_1218785 3300039447 Bacteria 111760
206 Ga0439455_0003129 3300042012 Bacteria 3118
207 Ga0450904_002589 3300042139 Bacteria 2107
208 Ga0439458_0017629 3300042157 Bacteria 1632
209 Ga0466969_0007789 3300044656 Bacteria 5693
210 Ga0466982_0082226 3300044672 Bacteria 1995
211 Ga0466965_0000671 3300044683 Bacteria 12580
212 Ga0466965_0046171 3300044683 Bacteria 2155
213 Ga0466966_0037526 3300044684 Bacteria 3124
214 Ga0466966_0102541 3300044684 Bacteria 1768
215 Ga0466964_0011002 3300044706 Bacteria 3417
216 Ga0466964_0017789 3300044706 Bacteria 2723
217 Ga0466964_0021221 3300044706 Bacteria 2510
218 Ga0466968_0000456 3300044735 Bacteria 13782
219 Ga0466968_0004653 3300044735 Bacteria 5135
220 Ga0466968_0036872 3300044735 Bacteria 2049
221 Ga0466970_0052782 3300044765 Bacteria 2170
222 Ga0466957_0004109 3300044842 Bacteria 8065
223 Ga0466957_0010939 3300044842 Bacteria 5218
224 Ga0466957_0058623 3300044842 Bacteria 2359
225 Ga0466957_0167320 3300044842 Bacteria 1430
226 Ga0466957_0218924 3300044842 Bacteria 1256
227 Ga0466959_0020062 3300045049 Bacteria 4920
228 Ga0466958_0028973 3300045836 Bacteria 3285
229 Ga0495617_000245 3300046452 Bacteria 32248
230 Ga0495617_001194 3300046452 Bacteria 11688
231 Ga0495617_001502 3300046452 Bacteria 10168
232 Ga0495617_005346 3300046452 Bacteria 4563
233 Ga0495627_011269 3300046453 Bacteria 3212
234 Ga0495603_0128606 3300046455 Bacteria 1475
235 Ga0495590_0000020 3300046457 Bacteria 212352
236 Ga0495590_0000595 3300046457 Bacteria 17060
237 Ga0495590_0005786 3300046457 Bacteria 4857
238 Ga0495590_0014851 3300046457 Bacteria 2838
239 Ga0495590_0041314 3300046457 Bacteria 1608
240 Ga0495629_0011085 3300046459 Bacteria 6549
241 Ga0495638_0000235 3300046460 Bacteria 75760
242 Ga0495638_0001049 3300046460 Bacteria 27280
243 Ga0495638_0005988 3300046460 Bacteria 8916
244 Ga0495638_0067899 3300046460 Bacteria 2188
245 Ga0495638_0108844 3300046460 Bacteria 1648
246 Ga0495651_0159788 3300046462 Bacteria 1615
247 Ga0495653_0000067 3300046463 Bacteria 90116
248 Ga0495653_0051408 3300046463 Bacteria 3164
249 Ga0495653_0214620 3300046463 Bacteria 1297
250 Ga0495653_0227246 3300046463 Bacteria 1251
251 Ga0495650_0000200 3300046471 Bacteria 130223
252 Ga0495650_0000251 3300046471 Bacteria 105577
253 Ga0495650_0000436 3300046471 Bacteria 67167
254 Ga0495650_0000483 3300046471 Bacteria 60911
255 Ga0495650_0000864 3300046471 Bacteria 36231
256 Ga0495650_0005399 3300046471 Bacteria 8311
257 Ga0495650_0005880 3300046471 Bacteria 7802
258 Ga0495582_0059028 3300046473 Bacteria 2116
259 Ga0495605_0000061 3300046474 Bacteria 145286
260 Ga0495605_0003908 3300046474 Bacteria 8830
261 Ga0495605_0010641 3300046474 Bacteria 5142
262 Ga0495605_0016281 3300046474 Bacteria 4027
263 Ga0495605_0065541 3300046474 Bacteria 1727
264 Ga0495605_0066502 3300046474 Bacteria 1712
265 Ga0495605_0068379 3300046474 Bacteria 1683
266 Ga0495639_0025159 3300046475 Bacteria 2624
267 Ga0495584_0000005 3300046491 Bacteria 306957
268 Ga0495584_0000308 3300046491 Bacteria 34325
269 Ga0495584_0007872 3300046491 Bacteria 5542
270 Ga0495584_0017557 3300046491 Bacteria 3640
271 Ga0495584_0027118 3300046491 Bacteria 2903
272 Ga0495584_0041240 3300046491 Bacteria 2330
273 Ga0495584_0078477 3300046491 Bacteria 1661
274 Ga0495585_0001291 3300046492 Bacteria 19967
275 Ga0495585_0002222 3300046492 Bacteria 14064
276 Ga0495585_0003470 3300046492 Bacteria 10645
277 Ga0495585_0004078 3300046492 Bacteria 9593
278 Ga0495585_0011431 3300046492 Bacteria 5252
279 Ga0495585_0012559 3300046492 Bacteria 4989
280 Ga0495585_0014579 3300046492 Bacteria 4574
281 Ga0495585_0014717 3300046492 Bacteria 4551
282 Ga0495585_0019383 3300046492 Bacteria 3922
283 Ga0495585_0032392 3300046492 Bacteria 2960
284 Ga0495585_0050534 3300046492 Bacteria 2306
285 Ga0495585_0070352 3300046492 Bacteria 1909
286 Ga0495585_0103435 3300046492 Bacteria 1521
287 Ga0495594_0030447 3300046499 Bacteria 2920
288 Ga0495594_0046406 3300046499 Bacteria 2386
289 Ga0495594_0063373 3300046499 Bacteria 2048
290 Ga0495594_0074022 3300046499 Bacteria 1897
291 Ga0495596_0000299 3300046500 Bacteria 32765
292 Ga0495596_0000435 3300046500 Bacteria 26782
293 Ga0495596_0000500 3300046500 Bacteria 24891
294 Ga0495596_0001709 3300046500 Bacteria 12348
295 Ga0495596_0002826 3300046500 Bacteria 9071
296 Ga0495596_0010550 3300046500 Bacteria 4019
297 Ga0495596_0012169 3300046500 Bacteria 3689
298 Ga0495596_0025399 3300046500 Bacteria 2394
299 Ga0495596_0082821 3300046500 Bacteria 1245
300 Ga0495607_0000514 3300046501 Bacteria 38263
301 Ga0495607_0006228 3300046501 Bacteria 8414
302 Ga0495607_0008009 3300046501 Bacteria 7258
303 Ga0495607_0010458 3300046501 Bacteria 6237
304 Ga0495607_0016220 3300046501 Bacteria 4810
305 Ga0495607_0019852 3300046501 Bacteria 4261
306 Ga0495607_0044523 3300046501 Bacteria 2617
307 Ga0495607_0048199 3300046501 Bacteria 2492
308 Ga0495607_0056988 3300046501 Bacteria 2241
309 Ga0495583_0000158 3300046506 Bacteria 113645
310 Ga0495583_0000214 3300046506 Bacteria 97639
311 Ga0495583_0000317 3300046506 Bacteria 76193
312 Ga0495583_0000817 3300046506 Bacteria 38095
313 Ga0495583_0002937 3300046506 Bacteria 13735
314 Ga0495583_0004418 3300046506 Bacteria 10070
315 Ga0495583_0004541 3300046506 Bacteria 9872
316 Ga0495583_0004572 3300046506 Bacteria 9824
317 Ga0495583_0009922 3300046506 Bacteria 5629
318 Ga0495583_0035926 3300046506 Bacteria 2360
319 Ga0495583_0040199 3300046506 Bacteria 2198
320 Ga0495583_0041718 3300046506 Bacteria 2147
321 Ga0495583_0070235 3300046506 Bacteria 1540
322 Ga0495583_0104038 3300046506 Bacteria 1209
323 Ga0495606_0000120 3300046507 Bacteria 133907
324 Ga0495606_0000262 3300046507 Bacteria 92896
325 Ga0495606_0000433 3300046507 Bacteria 69506
326 Ga0495606_0003347 3300046507 Bacteria 17098
327 Ga0495606_0003359 3300046507 Bacteria 17058
328 Ga0495606_0005585 3300046507 Bacteria 11970
329 Ga0495606_0007912 3300046507 Bacteria 9374
330 Ga0495606_0008104 3300046507 Bacteria 9212
331 Ga0495606_0008155 3300046507 Bacteria 9172
332 Ga0495606_0024893 3300046507 Bacteria 4301
333 Ga0495606_0032534 3300046507 Bacteria 3611
334 Ga0495606_0047463 3300046507 Bacteria 2830
335 Ga0495608_0001440 3300046511 Bacteria 16905
336 Ga0495608_0010752 3300046511 Bacteria 6380
337 Ga0495610_0000017 3300046512 Bacteria 365675
338 Ga0495610_0005990 3300046512 Bacteria 8501
339 Ga0495610_0006236 3300046512 Bacteria 8265
340 Ga0495610_0010999 3300046512 Bacteria 5569
341 Ga0495610_0016874 3300046512 Bacteria 4183
342 Ga0495610_0019833 3300046512 Bacteria 3750
343 Ga0495610_0029250 3300046512 Bacteria 2904
344 Ga0495616_0000968 3300046513 Bacteria 20583
345 Ga0495616_0003646 3300046513 Bacteria 9834
346 Ga0495616_0004117 3300046513 Bacteria 9224
347 Ga0495616_0008053 3300046513 Bacteria 6276
348 Ga0495616_0012210 3300046513 Bacteria 4886
349 Ga0495616_0014213 3300046513 Bacteria 4465
350 Ga0495616_0019686 3300046513 Bacteria 3680
351 Ga0495616_0020246 3300046513 Bacteria 3622
352 Ga0495616_0044097 3300046513 Bacteria 2263
353 Ga0495616_0111038 3300046513 Bacteria 1273
354 Ga0495618_0005745 3300046514 Bacteria 7539
355 Ga0495620_0001878 3300046515 Bacteria 12352
356 Ga0495628_0002346 3300046516 Bacteria 17099
357 Ga0495631_0002979 3300046518 Bacteria 9370
358 Ga0495631_0004446 3300046518 Bacteria 7465
359 Ga0495631_0014038 3300046518 Bacteria 3871
360 Ga0495631_0015576 3300046518 Bacteria 3639
361 Ga0495631_0052150 3300046518 Bacteria 1786
362 Ga0495631_0059700 3300046518 Bacteria 1656
363 Ga0495631_0062941 3300046518 Bacteria 1607
364 Ga0495632_0002504 3300046519 Bacteria 13934
365 Ga0495632_0006166 3300046519 Bacteria 7766
366 Ga0495632_0028547 3300046519 Bacteria 2911
367 Ga0495637_0000179 3300046520 Bacteria 49260
368 Ga0495637_0002381 3300046520 Bacteria 10416
369 Ga0495637_0057767 3300046520 Bacteria 1601
370 Ga0495643_0001515 3300046522 Bacteria 20976
371 Ga0495643_0003833 3300046522 Bacteria 10843
372 Ga0495643_0004577 3300046522 Bacteria 9629
373 Ga0495643_0008786 3300046522 Bacteria 6365
374 Ga0495643_0022557 3300046522 Bacteria 3591
375 Ga0495643_0022831 3300046522 Bacteria 3563
376 Ga0495643_0091662 3300046522 Bacteria 1567
377 Ga0495643_0111783 3300046522 Bacteria 1388
378 Ga0495644_0001273 3300046523 Bacteria 10323
379 Ga0495644_0002046 3300046523 Bacteria 8130
380 Ga0495644_0010549 3300046523 Bacteria 3559
381 Ga0495644_0038991 3300046523 Bacteria 1791
382 Ga0495648_0000183 3300046524 Bacteria 72118
383 Ga0495648_0000350 3300046524 Bacteria 50788
384 Ga0495648_0004377 3300046524 Bacteria 12086
385 Ga0495648_0006400 3300046524 Bacteria 9621
386 Ga0495648_0008929 3300046524 Bacteria 7834
387 Ga0495648_0010395 3300046524 Bacteria 7091
388 Ga0495648_0011915 3300046524 Bacteria 6523
389 Ga0495648_0016470 3300046524 Bacteria 5330
390 Ga0495648_0019269 3300046524 Bacteria 4804
391 Ga0495648_0026508 3300046524 Bacteria 3899
392 Ga0495648_0045451 3300046524 Bacteria 2731
393 Ga0495648_0096526 3300046524 Bacteria 1642
394 Ga0495648_0108041 3300046524 Bacteria 1520
395 Ga0495663_0017336 3300046525 Bacteria 2043
396 Ga0495666_0002304 3300046526 Bacteria 9519
397 Ga0495666_0003839 3300046526 Bacteria 7601
398 Ga0495666_0027086 3300046526 Bacteria 2822
399 Ga0495642_0001394 3300046528 Bacteria 10821
400 Ga0495642_0002375 3300046528 Bacteria 7674
401 Ga0495642_0008501 3300046528 Bacteria 3927
402 Ga0495642_0008897 3300046528 Bacteria 3842
403 Ga0495642_0011049 3300046528 Bacteria 3462
404 Ga0495642_0013848 3300046528 Bacteria 3123
405 Ga0495642_0021316 3300046528 Bacteria 2549
406 Ga0495642_0031048 3300046528 Bacteria 2141
407 Ga0495642_0096715 3300046528 Bacteria 1253
408 Ga0495652_0034764 3300046529 Bacteria 4391
409 Ga0495654_0000060 3300046530 Bacteria 134307
410 Ga0495654_0001159 3300046530 Bacteria 18844
411 Ga0495654_0005774 3300046530 Bacteria 7133
412 Ga0495654_0016211 3300046530 Bacteria 3943
413 Ga0495665_0015384 3300046531 Bacteria 4120
414 Ga0495587_0028066 3300046536 Bacteria 3427
415 Ga0495587_0071587 3300046536 Bacteria 2016
416 Ga0495609_0000314 3300046538 Bacteria 43536
417 Ga0495609_0001512 3300046538 Bacteria 15329
418 Ga0495609_0001993 3300046538 Bacteria 12904
419 Ga0495609_0003500 3300046538 Bacteria 8974
420 Ga0495609_0004793 3300046538 Bacteria 7298
421 Ga0495609_0006945 3300046538 Bacteria 5714
422 Ga0495609_0010694 3300046538 Bacteria 4391
423 Ga0495609_0014295 3300046538 Bacteria 3735
424 Ga0495609_0014512 3300046538 Bacteria 3701
425 Ga0495597_0001017 3300046542 Bacteria 21453
426 Ga0495597_0001024 3300046542 Bacteria 21396
427 Ga0495597_0001027 3300046542 Bacteria 21345
428 Ga0495597_0002718 3300046542 Bacteria 10912
429 Ga0495597_0003136 3300046542 Bacteria 9898
430 Ga0495597_0003813 3300046542 Bacteria 8572
431 Ga0495597_0012946 3300046542 Bacteria 4005
432 Ga0495597_0020801 3300046542 Bacteria 3053
433 Ga0495597_0021173 3300046542 Bacteria 3024
434 Ga0495597_0023809 3300046542 Bacteria 2830
435 Ga0495645_0058669 3300046543 Bacteria 2792
436 Ga0495622_0000488 3300046557 Bacteria 24999
437 Ga0495622_0001922 3300046557 Bacteria 10209
438 Ga0495622_0013368 3300046557 Bacteria 3807
439 Ga0495622_0017669 3300046557 Bacteria 3320
440 Ga0495633_0003504 3300046558 Bacteria 10412
441 Ga0495633_0003677 3300046558 Bacteria 10131
442 Ga0495633_0004606 3300046558 Bacteria 8688
443 Ga0495633_0005099 3300046558 Bacteria 8156
444 Ga0495633_0008760 3300046558 Bacteria 5663
445 Ga0495633_0010011 3300046558 Bacteria 5201
446 Ga0495633_0015948 3300046558 Bacteria 3887
447 Ga0495633_0018108 3300046558 Bacteria 3582
448 Ga0495633_0040530 3300046558 Bacteria 2218
449 Ga0495633_0042766 3300046558 Bacteria 2150
450 Ga0495633_0048390 3300046558 Bacteria 2007
451 Ga0495656_0008532 3300046615 Bacteria 3660
452 Ga0495668_0000162 3300046616 Bacteria 101114
453 Ga0495668_0000427 3300046616 Bacteria 54797
454 Ga0495668_0002105 3300046616 Bacteria 17216
455 Ga0495668_0002232 3300046616 Bacteria 16406
456 Ga0495668_0004696 3300046616 Bacteria 9580
457 Ga0495668_0007960 3300046616 Bacteria 6684
458 Ga0495668_0011146 3300046616 Bacteria 5400
459 Ga0495668_0031864 3300046616 Bacteria 2969
460 Ga0495668_0039173 3300046616 Bacteria 2647
461 Ga0495611_0002762 3300046648 Bacteria 7876
462 Ga0495611_0003285 3300046648 Bacteria 7149
463 Ga0495611_0006211 3300046648 Bacteria 5098
464 Ga0495625_0001192 3300046660 Bacteria 33259
465 Ga0495625_0007112 3300046660 Bacteria 9829
466 Ga0495625_0012748 3300046660 Bacteria 6799
467 Ga0495625_0016783 3300046660 Bacteria 5751
468 Ga0495625_0032343 3300046660 Bacteria 3880
469 Ga0495625_0040242 3300046660 Bacteria 3410
470 Ga0495625_0148623 3300046660 Bacteria 1576
471 Ga0495625_0151161 3300046660 Bacteria 1561
472 Ga0495659_0000127 3300046664 Bacteria 33507
473 Ga0495659_0000721 3300046664 Bacteria 11881
474 Ga0495659_0003375 3300046664 Bacteria 5118
475 Ga0495661_0000490 3300046665 Bacteria 41412
476 Ga0495661_0002987 3300046665 Bacteria 12747
477 Ga0495661_0003261 3300046665 Bacteria 12063
478 Ga0495661_0008306 3300046665 Bacteria 7192
479 Ga0495661_0016109 3300046665 Bacteria 4966
480 Ga0495661_0020630 3300046665 Bacteria 4299
481 Ga0495661_0022899 3300046665 Bacteria 4060
482 Ga0495661_0026903 3300046665 Bacteria 3699
483 Ga0495661_0059339 3300046665 Bacteria 2277
484 Ga0495661_0069284 3300046665 Bacteria 2067
485 Ga0495661_0076269 3300046665 Bacteria 1945
486 Ga0495661_0080054 3300046665 Bacteria 1886
487 Ga0495661_0101486 3300046665 Bacteria 1618
488 Ga0495588_0000199 3300046674 Bacteria 60892
489 Ga0495599_0001957 3300046678 Bacteria 11933
490 Ga0495623_0004092 3300046679 Bacteria 9608
491 Ga0495646_0003630 3300046680 Bacteria 9627
492 Ga0495669_0000844 3300046684 Bacteria 13033
493 Ga0495669_0001832 3300046684 Bacteria 8697
494 Ga0495669_0004619 3300046684 Bacteria 5705
495 Ga0495669_0015545 3300046684 Bacteria 3259
496 Ga0495669_0042112 3300046684 Bacteria 2029
497 Ga0495669_0062005 3300046684 Bacteria 1693
498 Ga0495613_0124142 3300046689 Bacteria 1852
499 Ga0495624_0007612 3300046690 Bacteria 7602
500 Ga0495624_0035957 3300046690 Bacteria 3195
501 Ga0495670_0000952 3300046691 Bacteria 14003
502 Ga0495670_0002230 3300046691 Bacteria 9568
503 Ga0495670_0017515 3300046691 Bacteria 3526
504 Ga0495670_0060273 3300046691 Bacteria 1906
505 Ga0495671_0000037 3300046692 Bacteria 177605
506 Ga0495671_0000266 3300046692 Bacteria 44137
507 Ga0495671_0001588 3300046692 Bacteria 15013
508 Ga0495671_0021170 3300046692 Bacteria 3419
509 Ga0495671_0031973 3300046692 Bacteria 2688
510 Ga0495671_0038570 3300046692 Bacteria 2414
511 Ga0495671_0060337 3300046692 Bacteria 1872
512 Ga0495671_0082603 3300046692 Bacteria 1574
513 Ga0495649_0005779 3300046694 Bacteria 7792
514 Ga0495649_0014891 3300046694 Bacteria 4444
515 Ga0495649_0015065 3300046694 Bacteria 4408
516 Ga0495649_0035786 3300046694 Bacteria 2730
517 Ga0495649_0042129 3300046694 Bacteria 2495
518 Ga0495649_0062254 3300046694 Bacteria 2006
519 Ga0495649_0076532 3300046694 Bacteria 1791
520 Ga0495589_0028246 3300046794 Bacteria 2832
521 Ga0495589_0047304 3300046794 Bacteria 2132
522 Ga0495600_0001939 3300046809 Bacteria 11625
523 Ga0495660_0002471 3300046810 Bacteria 11786
524 Ga0495660_0003717 3300046810 Bacteria 9368
525 Ga0495660_0007910 3300046810 Bacteria 6243
526 Ga0495660_0016480 3300046810 Bacteria 4261
527 Ga0495660_0042667 3300046810 Bacteria 2506
528 Ga0495660_0047139 3300046810 Bacteria 2361
529 Ga0495660_0050070 3300046810 Bacteria 2277
530 Ga0495604_0018828 3300047317 Bacteria 5530
531 Ga0495604_0022591 3300047317 Bacteria 5022
532 Ga0495636_0003200 3300047318 Bacteria 6350
533 Ga0495674_0000762 3300047319 Bacteria 30538
534 Ga0495672_0000013 3300047320 Bacteria 511827
535 Ga0495672_0000297 3300047320 Bacteria 68017
536 Ga0495672_0000353 3300047320 Bacteria 58748
537 Ga0495672_0000528 3300047320 Bacteria 43698
538 Ga0495672_0005338 3300047320 Bacteria 10227
539 Ga0495672_0011050 3300047320 Bacteria 6394
540 Ga0495672_0026668 3300047320 Bacteria 3682
541 Ga0495672_0032578 3300047320 Bacteria 3240
542 Ga0495672_0084496 3300047320 Bacteria 1760
543 Ga0495672_0084888 3300047320 Bacteria 1756
544 Ga0495676_0035724 3300047321 Bacteria 4155
545 Ga0495676_0051856 3300047321 Bacteria 3279
546 Ga0495676_0087306 3300047321 Bacteria 2344
547 Ga0495676_0114962 3300047321 Bacteria 1968
548 Ga0495676_0175399 3300047321 Bacteria 1506
549 Ga0495683_0000717 3300047323 Bacteria 24140
550 Ga0495683_0000773 3300047323 Bacteria 22984
551 Ga0495683_0016868 3300047323 Bacteria 3790
552 Ga0495683_0018685 3300047323 Bacteria 3581
553 Ga0495683_0039873 3300047323 Bacteria 2373
554 Ga0495687_000342 3300047443 Bacteria 59692
555 Ga0495687_004513 3300047443 Bacteria 9355
556 Ga0495687_004776 3300047443 Bacteria 8949
557 Ga0495675_0007299 3300047444 Bacteria 6809
558 Ga0495677_0001477 3300047445 Bacteria 9429
559 Ga0495677_0006592 3300047445 Bacteria 4382
560 Ga0495677_0006999 3300047445 Bacteria 4228
561 Ga0495677_0010091 3300047445 Bacteria 3473
562 Ga0495677_0012355 3300047445 Bacteria 3114
563 Ga0495677_0024474 3300047445 Bacteria 2190
564 Ga0495677_0037947 3300047445 Bacteria 1760
565 Ga0495679_002696 3300047446 Bacteria 8867
566 Ga0495679_017637 3300047446 Bacteria 2552
567 Ga0495679_030597 3300047446 Bacteria 1745
568 Ga0495685_000088 3300047447 Bacteria 33952
569 Ga0495685_011499 3300047447 Bacteria 2987
570 Ga0495685_014285 3300047447 Bacteria 2698
571 Ga0495673_0000179 3300047469 Bacteria 102128
572 Ga0495673_0000201 3300047469 Bacteria 92885
573 Ga0495673_0000248 3300047469 Bacteria 75224
574 Ga0495681_0005506 3300047470 Bacteria 8465
575 Ga0495681_0010017 3300047470 Bacteria 5772
576 Ga0495681_0021685 3300047470 Bacteria 3454
577 Ga0495681_0022753 3300047470 Bacteria 3346
578 Ga0495686_0001233 3300047472 Bacteria 29192
579 Ga0495686_0001635 3300047472 Bacteria 23409
580 Ga0495686_0005028 3300047472 Bacteria 10620
581 Ga0495686_0005717 3300047472 Bacteria 9714
582 Ga0495686_0007524 3300047472 Bacteria 8155
583 Ga0495686_0038847 3300047472 Bacteria 3043
584 Ga0495593_0038046 3300047673 Bacteria 2599
585 Ga0495602_0007222 3300048088 Bacteria 11638
586 Ga0495602_0013945 3300048088 Bacteria 8188
587 Ga0495626_0000105 3300048091 Bacteria 109725
588 Ga0495626_0003195 3300048091 Bacteria 10652
589 Ga0495626_0004624 3300048091 Bacteria 8377
590 Ga0495626_0007526 3300048091 Bacteria 6048
591 Ga0495626_0008438 3300048091 Bacteria 5646
592 Ga0495626_0013805 3300048091 Bacteria 4189
593 Ga0495626_0020787 3300048091 Bacteria 3266
594 Ga0496100_0079681 3300048903 Bacteria 2207
595 Ga0496101_0050820 3300048904 Bacteria 2985
596 Ga0496101_0131960 3300048904 Bacteria 1897
597 Ga0496102_0000074 3300048905 Bacteria 148938
598 Ga0496102_0035650 3300048905 Bacteria 4478
599 Ga0496102_0053103 3300048905 Bacteria 3695
600 Ga0496103_0006538 3300048906 Bacteria 6951
601 Ga0496103_0008145 3300048906 Bacteria 6224
602 Ga0496103_0014695 3300048906 Bacteria 4651
603 Ga0496104_0194987 3300048907 Bacteria 1938
604 Ga0496106_0004887 3300048909 Bacteria 9924
605 Ga0496107_0012263 3300048910 Bacteria 5982
606 Ga0496109_0008098 3300048912 Bacteria 8910
607 Ga0496110_0225442 3300048913 Bacteria 1704
608 Ga0496112_0201043 3300048915 Bacteria 1952
609 Ga0496114_0077089 3300048917 Bacteria 2810
610 Ga0496115_0003466 3300048918 Bacteria 11339
611 Ga0496115_0069468 3300048918 Bacteria 2853
612 Ga0496115_0166843 3300048918 Bacteria 1821
613 Ga0496115_0186331 3300048918 Bacteria 1715
614 Ga0496116_0006192 3300048919 Bacteria 10929
615 Ga0496116_0008873 3300048919 Bacteria 8651
616 Ga0496116_0030804 3300048919 Bacteria 3850
617 Ga0496116_0041864 3300048919 Bacteria 3138
618 Ga0496116_0075259 3300048919 Bacteria 2120
619 Ga0496117_0000005 3300048920 Bacteria 777468
620 Ga0496118_0000031 3300048921 Bacteria 339329
621 Ga0496120_0032282 3300048923 Bacteria 3159
622 Ga0496121_0005140 3300048924 Bacteria 17033
623 Ga0496121_0021381 3300048924 Bacteria 6339
624 Ga0496121_0063402 3300048924 Bacteria 3020
625 Ga0496122_0001099 3300048925 Bacteria 46763
626 Ga0496122_0002483 3300048925 Bacteria 26065
627 Ga0496122_0008145 3300048925 Bacteria 11412
628 Ga0496122_0029016 3300048925 Bacteria 4678
629 Ga0496122_0029365 3300048925 Bacteria 4639
630 Ga0496122_0063214 3300048925 Bacteria 2703
631 Ga0496123_0000953 3300048926 Bacteria 44958
632 Ga0496123_0001525 3300048926 Bacteria 32004
633 Ga0496123_0002484 3300048926 Bacteria 22768
634 Ga0496123_0008730 3300048926 Bacteria 9252
635 Ga0496123_0034932 3300048926 Bacteria 3592
636 Ga0496123_0090250 3300048926 Bacteria 1823
637 Ga0496124_0011035 3300048927 Bacteria 9071
638 Ga0496124_0015786 3300048927 Bacteria 7216
639 Ga0496124_0065544 3300048927 Bacteria 3028
640 Ga0496124_0100008 3300048927 Bacteria 2351
641 Ga0496124_0175953 3300048927 Bacteria 1652
642 Ga0496125_0001223 3300048928 Bacteria 38519
643 Ga0496125_0004256 3300048928 Bacteria 16667
644 Ga0496125_0005020 3300048928 Bacteria 14939
645 Ga0496125_0209664 3300048928 Bacteria 1266
646 Ga0496125_0218857 3300048928 Bacteria 1229
647 Ga0496126_0026304 3300048929 Bacteria 5581
648 Ga0496126_0080496 3300048929 Bacteria 2883
649 Ga0495678_000010 3300049459 Bacteria 357896
650 Ga0495678_000323 3300049459 Bacteria 50951
651 Ga0495678_002976 3300049459 Bacteria 10802
652 Ga0495678_003554 3300049459 Bacteria 9556
653 Ga0495678_005675 3300049459 Bacteria 6798
654 Ga0495678_009409 3300049459 Bacteria 4836
655 Ga0495682_0001031 3300049460 Bacteria 16453
656 Ga0495682_0001462 3300049460 Bacteria 12666
657 Ga0495682_0008902 3300049460 Bacteria 3939
658 Ga0495682_0014460 3300049460 Bacteria 2992
659 Ga0495682_0035157 3300049460 Bacteria 1846
660 Ga0495682_0087443 3300049460 Bacteria 1120
661 Ga0501227_005381 3300049665 Bacteria 2740
662 Ga0501269_001283 3300049766 Bacteria 3364
663 Ga0501279_000496 3300049775 Bacteria 5153
664 Ga0501279_001155 3300049775 Bacteria 3464
665 Ga0501280_000364 3300049776 Bacteria 11188
666 Ga0501035_0010094 3300049822 Bacteria 8765
667 Ga0495601_0001795 3300053077 Bacteria 11914
668 Ga0500594_0004037 3300053118 Bacteria 3230
669 Ga0500595_008802 3300053119 Bacteria 4102
670 Ga0500618_000139 3300053125 Bacteria 60811
671 Ga0500618_001387 3300053125 Bacteria 10914
672 Ga0500618_002238 3300053125 Bacteria 7538
673 Ga0500618_008663 3300053125 Bacteria 2823
674 Ga0500574_000059 3300053141 Bacteria 12462
675 Ga0500586_004334 3300053145 Bacteria 3461
676 Ga0500619_001046 3300053154 Bacteria 4791
677 Ga0466962_0084538 3300061719 Bacteria 1518

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046518 Ga0495631_0062941 Ga0495631_0062941_704_1597 291
2 3300042157 Ga0439458_0017629 Ga0439458_0017629_723_1622 292
3 3300049460 Ga0495682_0087443 Ga0495682_0087443_14_979 314
4 3300042012 Ga0439455_0003129 Ga0439455_0003129_2137_3105 315
5 3300046500 Ga0495596_0082821 Ga0495596_0082821_16_984 315
6 3300048927 Ga0496124_0175953 Ga0496124_0175953_654_1628 316
7 3300046522 Ga0495643_0008786 Ga0495643_0008786_4291_5421 325
8 3300046665 Ga0495661_0002987 Ga0495661_0002987_11170_12285 325
9 3300046474 Ga0495605_0065541 Ga0495605_0065541_189_1304 326
10 3300048091 Ga0495626_0000105 Ga0495626_0000105_41424_42542 327
11 3300044683 Ga0466965_0046171 Ga0466965_0046171_445_1554 328
12 3300044706 Ga0466964_0011002 Ga0466964_0011002_136_1245 328
13 3300044735 Ga0466968_0000456 Ga0466968_0000456_575_1684 328
14 3300044842 Ga0466957_0010939 Ga0466957_0010939_2059_3168 328
15 3300046471 Ga0495650_0000483 Ga0495650_0000483_24380_25504 328
16 3300046474 Ga0495605_0010641 Ga0495605_0010641_2114_3238 328
17 3300046500 Ga0495596_0000500 Ga0495596_0000500_10146_11270 328
18 3300046513 Ga0495616_0014213 Ga0495616_0014213_679_1788 328
19 3300046522 Ga0495643_0022831 Ga0495643_0022831_2203_3342 328
20 3300046524 Ga0495648_0004377 Ga0495648_0004377_9309_10433 328
21 3300046538 Ga0495609_0003500 Ga0495609_0003500_6940_8064 328
22 3300046665 Ga0495661_0059339 Ga0495661_0059339_950_2059 328
23 3300046674 Ga0495588_0000199 Ga0495588_0000199_36837_37946 328
24 3300047320 Ga0495672_0000528 Ga0495672_0000528_7048_8172 328
25 3300048091 Ga0495626_0013805 Ga0495626_0013805_1294_2418 328
26 3300046536 Ga0495587_0071587 Ga0495587_0071587_597_1721 329
27 3300047445 Ga0495677_0001477 Ga0495677_0001477_1910_3034 330
28 3300046457 Ga0495590_0041314 Ga0495590_0041314_167_1282 331
29 3300046501 Ga0495607_0019852 Ga0495607_0019852_653_1768 331
30 3300006948 Ga0099826_10000007 Ga0099826_10000007340 333
31 3300027666 Ga0209282_1000021 Ga0209282_100002135 333
32 3300046474 Ga0495605_0003908 Ga0495605_0003908_7239_8408 333
33 3300046500 Ga0495596_0000299 Ga0495596_0000299_10169_11338 333
34 3300046512 Ga0495610_0006236 Ga0495610_0006236_1277_2446 333
35 3300046513 Ga0495616_0003646 Ga0495616_0003646_5755_6924 333
36 3300046538 Ga0495609_0004793 Ga0495609_0004793_368_1537 333
37 3300046665 Ga0495661_0069284 Ga0495661_0069284_766_1935 333
38 3300046692 Ga0495671_0001588 Ga0495671_0001588_7510_8679 333
39 3300047320 Ga0495672_0005338 Ga0495672_0005338_6865_8034 333
40 3300047447 Ga0495685_014285 Ga0495685_014285_542_1711 333
41 3300048919 Ga0496116_0008873 Ga0496116_0008873_6469_7638 333
42 3300048925 Ga0496122_0029365 Ga0496122_0029365_934_2103 333
43 3300048926 Ga0496123_0002484 Ga0496123_0002484_7530_8699 333
44 3300048928 Ga0496125_0218857 Ga0496125_0218857_47_1216 333
45 3300046506 Ga0495583_0000158 Ga0495583_0000158_68552_69658 334
46 3300009098 Ga0105245_10117468 Ga0105245_101174682 337
47 3300037312 Ga0395899_0010874 Ga0395899_0010874_4395_5504 337
48 iso_pu_bacteria 2891633521 2891633872 337
49 3300038443 Ga0395901_0131972 Ga0395901_0131972_725_1840 338
50 3300046463 Ga0495653_0227246 Ga0495653_0227246_195_1235 338
51 3300046518 Ga0495631_0015576 Ga0495631_0015576_506_1612 339
52 3300046525 Ga0495663_0017336 Ga0495663_0017336_599_1705 339
53 3300046615 Ga0495656_0008532 Ga0495656_0008532_1825_2931 339
54 3300046694 Ga0495649_0015065 Ga0495649_0015065_1382_2521 339
55 3300005364 Ga0070673_100233069 Ga0070673_1002330692 340
56 3300014326 Ga0157380_10500275 Ga0157380_105002751 340
57 iso_pu_bacteria 2574179768 2574430277 340
58 3300046491 Ga0495584_0027118 Ga0495584_0027118_1047_2153 342
59 3300046558 Ga0495633_0008760 Ga0495633_0008760_247_1353 342
60 3300047445 Ga0495677_0006592 Ga0495677_0006592_2534_3640 342
61 3300005841 Ga0068863_100167702 Ga0068863_1001677022 343
62 3300025919 Ga0207657_10027747 Ga0207657_100277474 343
63 3300048915 Ga0496112_0201043 Ga0496112_0201043_746_1855 343
64 3300048925 Ga0496122_0008145 Ga0496122_0008145_6996_8105 343
65 3300048926 Ga0496123_0034932 Ga0496123_0034932_71_1180 343
66 3300045836 Ga0466958_0028973 Ga0466958_0028973_1819_2928 344
67 3300046500 Ga0495596_0001709 Ga0495596_0001709_8660_9784 344
68 3300046513 Ga0495616_0111038 Ga0495616_0111038_21_1076 344
69 3300046660 Ga0495625_0151161 Ga0495625_0151161_124_1212 344
70 3300047445 Ga0495677_0024474 Ga0495677_0024474_835_1941 344
71 3300048924 Ga0496121_0005140 Ga0496121_0005140_7308_8477 344
72 3300003759 Ga0055525_1000018 Ga0055525_1000018307 345
73 3300025230 Ga0209563_100011 Ga0209563_100011785 345
74 3300025253 Ga0209677_104408 Ga0209677_1044082 345
75 3300039447 Ga0436361_1218785 Ga0436361_1218785_27306_28436 345
76 3300046471 Ga0495650_0000864 Ga0495650_0000864_22583_23713 346
77 3300003771 Ga0055526_1004035 Ga0055526_10040354 347
78 3300003773 Ga0055537_1000038 Ga0055537_100003839 347
79 3300003784 Ga0055534_1000074 Ga0055534_100007431 347
80 3300003790 Ga0055528_1000231 Ga0055528_100023126 347
81 3300025263 Ga0209565_1000123 Ga0209565_100012364 347
82 3300025273 Ga0209673_1000040 Ga0209673_1000040252 347
83 3300025291 Ga0209675_1000117 Ga0209675_100011741 347
84 3300025295 Ga0209564_1000121 Ga0209564_1000121147 347
85 3300025299 Ga0209256_1000288 Ga0209256_100028822 347
86 3300046538 Ga0495609_0001993 Ga0495609_0001993_6477_7583 347
87 3300053125 Ga0500618_002238 Ga0500618_002238_6081_7154 347
88 3300015262 Ga0182007_10005958 Ga0182007_100059582 348
89 3300035691 Ga0373931_0060346 Ga0373931_0060346_301_1365 348
90 3300046511 Ga0495608_0010752 Ga0495608_0010752_168_1295 348
91 3300046516 Ga0495628_0002346 Ga0495628_0002346_7333_8469 348
92 3300046616 Ga0495668_0000427 Ga0495668_0000427_18231_19385 348
93 3300048088 Ga0495602_0013945 Ga0495602_0013945_5746_6873 348
94 3300003575 Ga0007409J51694_1079496 Ga0007409J51694_10794962 349
95 3300039447 Ga0436361_1067374 Ga0436361_1067374_601_1704 349
96 3300049776 Ga0501280_000364 Ga0501280_000364_3107_4183 349
97 3300003751 Ga0055538_1000062 Ga0055538_100006263 350
98 3300003752 Ga0055539_1000093 Ga0055539_100009363 350
99 3300003756 Ga0055533_1000105 Ga0055533_100010563 350
100 3300003759 Ga0055525_1000137 Ga0055525_100013763 350
101 3300003841 Ga0055541_1000063 Ga0055541_100006363 350
102 3300005563 Ga0068855_100007118 Ga0068855_1000071188 350
103 3300005578 Ga0068854_100005433 Ga0068854_1000054333 350
104 3300005834 Ga0068851_10049041 Ga0068851_100490412 350
105 3300009093 Ga0105240_10062674 Ga0105240_100626744 350
106 3300009545 Ga0105237_10014347 Ga0105237_100143472 350
107 3300009551 Ga0105238_10000763 Ga0105238_1000076332 350
108 3300010375 Ga0105239_10155414 Ga0105239_101554142 350
109 3300015261 Ga0182006_1004639 Ga0182006_10046393 350
110 3300021361 Ga0213872_10004614 Ga0213872_100046143 350
111 3300025224 Ga0209784_100021 Ga0209784_100021352 350
112 3300025225 Ga0209566_100119 Ga0209566_10011930 350
113 3300025226 Ga0209674_100036 Ga0209674_100036352 350
114 3300025230 Ga0209563_100040 Ga0209563_100040352 350
115 3300025253 Ga0209677_100023 Ga0209677_100023352 350
116 3300025913 Ga0207695_10002760 Ga0207695_100027603 350
117 3300025914 Ga0207671_10006962 Ga0207671_100069625 350
118 3300025924 Ga0207694_10000343 Ga0207694_1000034325 350
119 3300025949 Ga0207667_10000912 Ga0207667_1000091232 350
120 3300025981 Ga0207640_10014951 Ga0207640_100149513 350
121 3300026078 Ga0207702_10094471 Ga0207702_100944712 350
122 3300039447 Ga0436361_0145169 Ga0436361_0145169_4370_5506 350
123 3300046528 Ga0495642_0021316 Ga0495642_0021316_483_1568 350
124 3300047470 Ga0495681_0022753 Ga0495681_0022753_2097_3191 350
125 3300048905 Ga0496102_0000074 Ga0496102_0000074_37332_38417 350
126 3300048906 Ga0496103_0008145 Ga0496103_0008145_3365_4450 350
127 3300048928 Ga0496125_0001223 Ga0496125_0001223_27614_28768 350
128 3300048929 Ga0496126_0080496 Ga0496126_0080496_556_1710 350
129 3300053125 Ga0500618_001387 Ga0500618_001387_4388_5593 350
130 3300053125 Ga0500618_008663 Ga0500618_008663_1345_2523 350
131 iso_pu_bacteria 2511231026 2511385238 350
132 iso_pu_bacteria 2521172590 2521559847 350
133 iso_pu_bacteria 2551306416 2553007017 350
134 iso_pu_bacteria 2765235838 2765571106 350
135 iso_pu_bacteria 2808606386 2808985014 350
136 iso_pu_bacteria 2808606415 2809130146 350
137 iso_pu_bacteria 2808606419 2809150377 350
138 iso_pu_bacteria 2818991449 2819618242 350
139 iso_pu_bacteria 2839094727 2839098990 350
140 iso_pu_bacteria 2852618963 2852621399 350
141 iso_pu_bacteria 2904439833 2904444416 350
142 iso_pu_bacteria 2904530477 2904535569 350
143 iso_pu_bacteria 2904584206 2904588140 350
144 iso_pu_bacteria 2904589729 2904595176 350
145 iso_pu_bacteria 2904601388 2904606089 350
146 iso_pu_bacteria 2919046199 2919049232 350
147 iso_pu_bacteria 2919079590 2919084287 350
148 iso_pu_bacteria 2923510766 2923513617 350
149 iso_pu_bacteria 2928130867 2928135267 350
150 3300003322 rootL2_10183526 rootL2_101835262 351
151 3300005614 Ga0068856_100034024 Ga0068856_1000340243 351
152 3300025233 Ga0209437_100332 Ga0209437_10033232 351
153 3300026078 Ga0207702_10032111 Ga0207702_100321113 351
154 3300037471 Ga0395905_0018554 Ga0395905_0018554_3283_4425 351
155 3300046530 Ga0495654_0016211 Ga0495654_0016211_998_2125 351
156 3300048928 Ga0496125_0005020 Ga0496125_0005020_4642_5757 351
157 3300003187 JGI25151J46595_10004291 JGI25151J46595_100042912 352
158 3300003214 JGI25165J46597_1000051 JGI25165J46597_100005167 352
159 3300003751 Ga0055538_1000025 Ga0055538_1000025166 352
160 3300003752 Ga0055539_1000032 Ga0055539_100003267 352
161 3300003756 Ga0055533_1000042 Ga0055533_1000042166 352
162 3300003759 Ga0055525_1000050 Ga0055525_1000050166 352
163 3300003771 Ga0055526_1007275 Ga0055526_10072756 352
164 3300003771 Ga0055526_1008251 Ga0055526_10082516 352
165 3300003773 Ga0055537_1002750 Ga0055537_10027504 352
166 3300003775 Ga0055524_1000728 Ga0055524_10007286 352
167 3300003841 Ga0055541_1000023 Ga0055541_1000023165 352
168 3300025207 Ga0209760_103617 Ga0209760_1036171 352
169 3300025224 Ga0209784_100010 Ga0209784_100010543 352
170 3300025225 Ga0209566_100008 Ga0209566_100008543 352
171 3300025226 Ga0209674_100019 Ga0209674_100019543 352
172 3300025230 Ga0209563_100021 Ga0209563_100021543 352
173 3300025231 Ga0207427_100596 Ga0207427_10059613 352
174 3300025233 Ga0209437_100019 Ga0209437_100019543 352
175 3300025253 Ga0209677_100011 Ga0209677_100011543 352
176 3300025261 Ga0209233_1000025 Ga0209233_1000025543 352
177 3300025263 Ga0209565_1000104 Ga0209565_100010497 352
178 3300025294 Ga0209025_1001884 Ga0209025_100188418 352
179 3300025294 Ga0209025_1002014 Ga0209025_100201418 352
180 3300025295 Ga0209564_1002491 Ga0209564_10024917 352
181 3300025295 Ga0209564_1002959 Ga0209564_10029597 352
182 3300025297 Ga0209758_1006210 Ga0209758_10062102 352
183 3300025299 Ga0209256_1000287 Ga0209256_100028765 352
184 3300025299 Ga0209256_1000543 Ga0209256_100054311 352
185 3300046460 Ga0495638_0108844 Ga0495638_0108844_72_1172 352
186 3300046462 Ga0495651_0159788 Ga0495651_0159788_132_1253 352
187 3300046492 Ga0495585_0014579 Ga0495585_0014579_2387_3487 352
188 3300046506 Ga0495583_0004572 Ga0495583_0004572_6995_8098 352
189 3300046511 Ga0495608_0001440 Ga0495608_0001440_4878_6002 352
190 3300046514 Ga0495618_0005745 Ga0495618_0005745_6212_7336 352
191 3300046522 Ga0495643_0001515 Ga0495643_0001515_12862_13965 352
192 3300046616 Ga0495668_0039173 Ga0495668_0039173_543_1634 352
193 3300046678 Ga0495599_0001957 Ga0495599_0001957_10065_11189 352
194 3300046680 Ga0495646_0003630 Ga0495646_0003630_6519_7643 352
195 3300046690 Ga0495624_0035957 Ga0495624_0035957_173_1297 352
196 3300046691 Ga0495670_0017515 Ga0495670_0017515_283_1383 352
197 3300046809 Ga0495600_0001939 Ga0495600_0001939_4845_5969 352
198 3300047320 Ga0495672_0084888 Ga0495672_0084888_358_1461 352
199 3300047321 Ga0495676_0035724 Ga0495676_0035724_2367_3467 352
200 3300047321 Ga0495676_0051856 Ga0495676_0051856_388_1512 352
201 3300048905 Ga0496102_0053103 Ga0496102_0053103_387_1451 352
202 3300048912 Ga0496109_0008098 Ga0496109_0008098_1184_2296 352
203 3300048925 Ga0496122_0001099 Ga0496122_0001099_38376_39488 352
204 3300048926 Ga0496123_0000953 Ga0496123_0000953_11064_12176 352
205 3300048928 Ga0496125_0004256 Ga0496125_0004256_7260_8372 352
206 3300049459 Ga0495678_002976 Ga0495678_002976_8106_9209 352
207 3300053077 Ga0495601_0001795 Ga0495601_0001795_5089_6213 352
208 3300053119 Ga0500595_008802 Ga0500595_008802_1834_2958 352
209 3300053141 Ga0500574_000059 Ga0500574_000059_4939_6063 352
210 3300053154 Ga0500619_001046 Ga0500619_001046_2026_3150 352
211 iso_pu_bacteria 2818991436 2819544636 352
212 3300005339 Ga0070660_100039087 Ga0070660_1000390872 353
213 3300005339 Ga0070660_100218844 Ga0070660_1002188441 353
214 3300005539 Ga0068853_100254777 Ga0068853_1002547771 353
215 3300005563 Ga0068855_100020379 Ga0068855_1000203798 353
216 3300005564 Ga0070664_100047821 Ga0070664_1000478213 353
217 3300009093 Ga0105240_10242754 Ga0105240_102427542 353
218 3300009174 Ga0105241_10013339 Ga0105241_100133393 353
219 3300009176 Ga0105242_10205817 Ga0105242_102058172 353
220 3300025911 Ga0207654_10008046 Ga0207654_100080464 353
221 3300025933 Ga0207706_10215656 Ga0207706_102156562 353
222 3300025934 Ga0207686_10075326 Ga0207686_100753262 353
223 3300025942 Ga0207689_10188798 Ga0207689_101887982 353
224 3300025981 Ga0207640_10206951 Ga0207640_102069511 353
225 3300026067 Ga0207678_10339963 Ga0207678_103399631 353
226 3300031727 Ga0316576_10003778 Ga0316576_100037788 353
227 3300031728 Ga0316578_10052312 Ga0316578_100523123 353
228 3300032133 Ga0316583_10011958 Ga0316583_100119583 353
229 3300032168 Ga0316593_10005972 Ga0316593_100059723 353
230 3300033528 Ga0316588_1000267 Ga0316588_10002675 353
231 3300037312 Ga0395899_0000386 Ga0395899_0000386_231_1334 353
232 3300037312 Ga0395899_0011797 Ga0395899_0011797_2678_3787 353
233 3300037418 Ga0395900_0000321 Ga0395900_0000321_10327_11436 353
234 3300037418 Ga0395900_0007976 Ga0395900_0007976_3214_4323 353
235 3300037418 Ga0395900_0066996 Ga0395900_0066996_196_1305 353
236 3300038443 Ga0395901_0000187 Ga0395901_0000187_18844_19953 353
237 3300038443 Ga0395901_0314752 Ga0395901_0314752_222_1331 353
238 3300038443 Ga0395901_0441198 Ga0395901_0441198_194_1303 353
239 3300044656 Ga0466969_0007789 Ga0466969_0007789_1096_2205 353
240 3300044683 Ga0466965_0000671 Ga0466965_0000671_10812_11966 353
241 3300044684 Ga0466966_0037526 Ga0466966_0037526_1992_3101 353
242 3300044684 Ga0466966_0102541 Ga0466966_0102541_591_1700 353
243 3300044706 Ga0466964_0017789 Ga0466964_0017789_524_1678 353
244 3300044706 Ga0466964_0021221 Ga0466964_0021221_398_1531 353
245 3300044735 Ga0466968_0004653 Ga0466968_0004653_268_1422 353
246 3300044735 Ga0466968_0036872 Ga0466968_0036872_298_1443 353
247 3300044842 Ga0466957_0004109 Ga0466957_0004109_168_1277 353
248 3300044842 Ga0466957_0167320 Ga0466957_0167320_261_1370 353
249 3300044842 Ga0466957_0218924 Ga0466957_0218924_79_1188 353
250 3300045049 Ga0466959_0020062 Ga0466959_0020062_1918_3027 353
251 3300046452 Ga0495617_001194 Ga0495617_001194_4507_5619 353
252 3300046455 Ga0495603_0128606 Ga0495603_0128606_169_1269 353
253 3300046457 Ga0495590_0000595 Ga0495590_0000595_1937_3052 353
254 3300046457 Ga0495590_0014851 Ga0495590_0014851_1671_2777 353
255 3300046459 Ga0495629_0011085 Ga0495629_0011085_1410_2513 353
256 3300046460 Ga0495638_0005988 Ga0495638_0005988_1591_2697 353
257 3300046471 Ga0495650_0000200 Ga0495650_0000200_2106_3212 353
258 3300046473 Ga0495582_0059028 Ga0495582_0059028_276_1376 353
259 3300046474 Ga0495605_0016281 Ga0495605_0016281_2063_3172 353
260 3300046474 Ga0495605_0066502 Ga0495605_0066502_519_1649 353
261 3300046491 Ga0495584_0000005 Ga0495584_0000005_41753_42862 353
262 3300046491 Ga0495584_0000308 Ga0495584_0000308_26599_27705 353
263 3300046491 Ga0495584_0017557 Ga0495584_0017557_631_1731 353
264 3300046492 Ga0495585_0001291 Ga0495585_0001291_6326_7438 353
265 3300046492 Ga0495585_0003470 Ga0495585_0003470_2333_3436 353
266 3300046492 Ga0495585_0004078 Ga0495585_0004078_2095_3201 353
267 3300046492 Ga0495585_0011431 Ga0495585_0011431_2170_3279 353
268 3300046492 Ga0495585_0019383 Ga0495585_0019383_1655_2758 353
269 3300046492 Ga0495585_0050534 Ga0495585_0050534_155_1255 353
270 3300046492 Ga0495585_0103435 Ga0495585_0103435_295_1398 353
271 3300046499 Ga0495594_0030447 Ga0495594_0030447_1469_2569 353
272 3300046499 Ga0495594_0046406 Ga0495594_0046406_559_1659 353
273 3300046499 Ga0495594_0063373 Ga0495594_0063373_229_1332 353
274 3300046499 Ga0495594_0074022 Ga0495594_0074022_55_1158 353
275 3300046500 Ga0495596_0000435 Ga0495596_0000435_6779_7885 353
276 3300046500 Ga0495596_0012169 Ga0495596_0012169_1755_2858 353
277 3300046500 Ga0495596_0025399 Ga0495596_0025399_907_2013 353
278 3300046501 Ga0495607_0044523 Ga0495607_0044523_442_1551 353
279 3300046501 Ga0495607_0048199 Ga0495607_0048199_1265_2380 353
280 3300046506 Ga0495583_0000214 Ga0495583_0000214_75776_76870 353
281 3300046506 Ga0495583_0004541 Ga0495583_0004541_1766_2881 353
282 3300046506 Ga0495583_0040199 Ga0495583_0040199_29_1132 353
283 3300046506 Ga0495583_0070235 Ga0495583_0070235_29_1132 353
284 3300046506 Ga0495583_0104038 Ga0495583_0104038_78_1181 353
285 3300046507 Ga0495606_0005585 Ga0495606_0005585_5072_6205 353
286 3300046507 Ga0495606_0007912 Ga0495606_0007912_7457_8566 353
287 3300046507 Ga0495606_0008155 Ga0495606_0008155_7264_8379 353
288 3300046507 Ga0495606_0032534 Ga0495606_0032534_864_1967 353
289 3300046507 Ga0495606_0047463 Ga0495606_0047463_1249_2352 353
290 3300046513 Ga0495616_0004117 Ga0495616_0004117_1918_3024 353
291 3300046513 Ga0495616_0008053 Ga0495616_0008053_4077_5189 353
292 3300046513 Ga0495616_0020246 Ga0495616_0020246_832_1938 353
293 3300046515 Ga0495620_0001878 Ga0495620_0001878_6555_7658 353
294 3300046518 Ga0495631_0002979 Ga0495631_0002979_1910_3025 353
295 3300046518 Ga0495631_0014038 Ga0495631_0014038_839_1954 353
296 3300046518 Ga0495631_0052150 Ga0495631_0052150_87_1190 353
297 3300046518 Ga0495631_0059700 Ga0495631_0059700_386_1489 353
298 3300046519 Ga0495632_0002504 Ga0495632_0002504_6750_7865 353
299 3300046519 Ga0495632_0028547 Ga0495632_0028547_347_1453 353
300 3300046520 Ga0495637_0057767 Ga0495637_0057767_322_1437 353
301 3300046522 Ga0495643_0003833 Ga0495643_0003833_1945_3075 353
302 3300046522 Ga0495643_0022557 Ga0495643_0022557_805_1920 353
303 3300046523 Ga0495644_0010549 Ga0495644_0010549_1603_2718 353
304 3300046523 Ga0495644_0038991 Ga0495644_0038991_22_1128 353
305 3300046524 Ga0495648_0000183 Ga0495648_0000183_69921_71033 353
306 3300046524 Ga0495648_0016470 Ga0495648_0016470_1623_2717 353
307 3300046524 Ga0495648_0019269 Ga0495648_0019269_890_1999 353
308 3300046524 Ga0495648_0026508 Ga0495648_0026508_1931_3061 353
309 3300046524 Ga0495648_0108041 Ga0495648_0108041_104_1207 353
310 3300046526 Ga0495666_0003839 Ga0495666_0003839_5492_6595 353
311 3300046526 Ga0495666_0027086 Ga0495666_0027086_1390_2490 353
312 3300046528 Ga0495642_0008501 Ga0495642_0008501_2570_3673 353
313 3300046528 Ga0495642_0008897 Ga0495642_0008897_974_2089 353
314 3300046528 Ga0495642_0011049 Ga0495642_0011049_1904_3007 353
315 3300046528 Ga0495642_0013848 Ga0495642_0013848_57_1160 353
316 3300046528 Ga0495642_0096715 Ga0495642_0096715_97_1200 353
317 3300046530 Ga0495654_0005774 Ga0495654_0005774_357_1472 353
318 3300046531 Ga0495665_0015384 Ga0495665_0015384_1016_2119 353
319 3300046536 Ga0495587_0028066 Ga0495587_0028066_1157_2260 353
320 3300046538 Ga0495609_0006945 Ga0495609_0006945_621_1727 353
321 3300046538 Ga0495609_0010694 Ga0495609_0010694_2662_3765 353
322 3300046542 Ga0495597_0001027 Ga0495597_0001027_5331_6431 353
323 3300046542 Ga0495597_0003813 Ga0495597_0003813_6573_7676 353
324 3300046542 Ga0495597_0020801 Ga0495597_0020801_872_1987 353
325 3300046542 Ga0495597_0021173 Ga0495597_0021173_41_1135 353
326 3300046542 Ga0495597_0023809 Ga0495597_0023809_81_1187 353
327 3300046543 Ga0495645_0058669 Ga0495645_0058669_1137_2246 353
328 3300046557 Ga0495622_0013368 Ga0495622_0013368_1080_2183 353
329 3300046557 Ga0495622_0017669 Ga0495622_0017669_1208_2311 353
330 3300046558 Ga0495633_0003504 Ga0495633_0003504_937_2043 353
331 3300046558 Ga0495633_0005099 Ga0495633_0005099_834_1943 353
332 3300046558 Ga0495633_0040530 Ga0495633_0040530_234_1340 353
333 3300046616 Ga0495668_0002232 Ga0495668_0002232_12413_13528 353
334 3300046616 Ga0495668_0031864 Ga0495668_0031864_1512_2627 353
335 3300046648 Ga0495611_0006211 Ga0495611_0006211_1981_3084 353
336 3300046660 Ga0495625_0012748 Ga0495625_0012748_875_1978 353
337 3300046660 Ga0495625_0016783 Ga0495625_0016783_1669_2784 353
338 3300046660 Ga0495625_0148623 Ga0495625_0148623_104_1234 353
339 3300046665 Ga0495661_0003261 Ga0495661_0003261_3117_4226 353
340 3300046665 Ga0495661_0016109 Ga0495661_0016109_321_1427 353
341 3300046665 Ga0495661_0020630 Ga0495661_0020630_357_1472 353
342 3300046665 Ga0495661_0022899 Ga0495661_0022899_928_2037 353
343 3300046665 Ga0495661_0076269 Ga0495661_0076269_44_1147 353
344 3300046665 Ga0495661_0101486 Ga0495661_0101486_144_1247 353
345 3300046684 Ga0495669_0001832 Ga0495669_0001832_937_2043 353
346 3300046684 Ga0495669_0004619 Ga0495669_0004619_2987_4102 353
347 3300046689 Ga0495613_0124142 Ga0495613_0124142_117_1220 353
348 3300046690 Ga0495624_0007612 Ga0495624_0007612_2456_3559 353
349 3300046691 Ga0495670_0000952 Ga0495670_0000952_5932_7032 353
350 3300046691 Ga0495670_0002230 Ga0495670_0002230_6945_8051 353
351 3300046691 Ga0495670_0060273 Ga0495670_0060273_623_1732 353
352 3300046692 Ga0495671_0031973 Ga0495671_0031973_766_1881 353
353 3300046692 Ga0495671_0082603 Ga0495671_0082603_353_1456 353
354 3300046694 Ga0495649_0005779 Ga0495649_0005779_5097_6227 353
355 3300046794 Ga0495589_0028246 Ga0495589_0028246_633_1733 353
356 3300046810 Ga0495660_0047139 Ga0495660_0047139_103_1206 353
357 3300047317 Ga0495604_0018828 Ga0495604_0018828_4345_5448 353
358 3300047319 Ga0495674_0000762 Ga0495674_0000762_17615_18718 353
359 3300047320 Ga0495672_0000353 Ga0495672_0000353_19657_20787 353
360 3300047320 Ga0495672_0032578 Ga0495672_0032578_942_2057 353
361 3300047321 Ga0495676_0087306 Ga0495676_0087306_245_1345 353
362 3300047321 Ga0495676_0114962 Ga0495676_0114962_217_1320 353
363 3300047321 Ga0495676_0175399 Ga0495676_0175399_214_1317 353
364 3300047323 Ga0495683_0000717 Ga0495683_0000717_6529_7635 353
365 3300047323 Ga0495683_0016868 Ga0495683_0016868_983_2095 353
366 3300047446 Ga0495679_002696 Ga0495679_002696_7012_8127 353
367 3300047446 Ga0495679_030597 Ga0495679_030597_293_1408 353
368 3300047447 Ga0495685_011499 Ga0495685_011499_20_1102 353
369 3300047470 Ga0495681_0021685 Ga0495681_0021685_1785_2900 353
370 3300047472 Ga0495686_0005717 Ga0495686_0005717_6641_7753 353
371 3300047673 Ga0495593_0038046 Ga0495593_0038046_58_1161 353
372 3300048091 Ga0495626_0003195 Ga0495626_0003195_9423_10523 353
373 3300048091 Ga0495626_0007526 Ga0495626_0007526_299_1402 353
374 3300048091 Ga0495626_0008438 Ga0495626_0008438_868_1974 353
375 3300048091 Ga0495626_0020787 Ga0495626_0020787_2052_3167 353
376 3300048904 Ga0496101_0131960 Ga0496101_0131960_464_1669 353
377 3300048905 Ga0496102_0035650 Ga0496102_0035650_388_1482 353
378 3300048906 Ga0496103_0006538 Ga0496103_0006538_3784_4878 353
379 3300048906 Ga0496103_0014695 Ga0496103_0014695_2379_3509 353
380 3300048909 Ga0496106_0004887 Ga0496106_0004887_125_1234 353
381 3300048910 Ga0496107_0012263 Ga0496107_0012263_3060_4169 353
382 3300048913 Ga0496110_0225442 Ga0496110_0225442_81_1190 353
383 3300048917 Ga0496114_0077089 Ga0496114_0077089_841_1971 353
384 3300048918 Ga0496115_0003466 Ga0496115_0003466_4916_6019 353
385 3300048918 Ga0496115_0069468 Ga0496115_0069468_1645_2748 353
386 3300048918 Ga0496115_0166843 Ga0496115_0166843_496_1599 353
387 3300048918 Ga0496115_0186331 Ga0496115_0186331_252_1352 353
388 3300048919 Ga0496116_0006192 Ga0496116_0006192_3071_4276 353
389 3300048927 Ga0496124_0065544 Ga0496124_0065544_1697_2809 353
390 3300049459 Ga0495678_000323 Ga0495678_000323_42668_43783 353
391 3300049459 Ga0495678_003554 Ga0495678_003554_2018_3148 353
392 3300049460 Ga0495682_0014460 Ga0495682_0014460_1508_2611 353
393 3300049460 Ga0495682_0035157 Ga0495682_0035157_459_1574 353
394 3300049822 Ga0501035_0010094 Ga0501035_0010094_6959_8068 353
395 3300061719 Ga0466962_0084538 Ga0466962_0084538_301_1410 353
396 3300003187 JGI25151J46595_10002270 JGI25151J46595_100022706 354
397 3300003781 Ga0055536_1000134 Ga0055536_100013424 354
398 3300003784 Ga0055534_1001413 Ga0055534_10014136 354
399 3300025250 Ga0209026_1002283 Ga0209026_10022832 354
400 3300025291 Ga0209675_1001657 Ga0209675_10016578 354
401 3300025292 Ga0209676_1000036 Ga0209676_1000036416 354
402 3300025294 Ga0209025_1003834 Ga0209025_10038348 354
403 3300025295 Ga0209564_1001065 Ga0209564_100106525 354
404 3300046453 Ga0495627_011269 Ga0495627_011269_876_1997 354
405 3300046457 Ga0495590_0005786 Ga0495590_0005786_1890_3023 354
406 3300046463 Ga0495653_0051408 Ga0495653_0051408_212_1336 354
407 3300046463 Ga0495653_0214620 Ga0495653_0214620_154_1287 354
408 3300046474 Ga0495605_0068379 Ga0495605_0068379_433_1551 354
409 3300046491 Ga0495584_0078477 Ga0495584_0078477_75_1199 354
410 3300046492 Ga0495585_0012559 Ga0495585_0012559_2094_3215 354
411 3300046492 Ga0495585_0032392 Ga0495585_0032392_35_1159 354
412 3300046500 Ga0495596_0002826 Ga0495596_0002826_1568_2689 354
413 3300046500 Ga0495596_0010550 Ga0495596_0010550_2124_3248 354
414 3300046501 Ga0495607_0006228 Ga0495607_0006228_7024_8148 354
415 3300046506 Ga0495583_0000817 Ga0495583_0000817_23096_24217 354
416 3300046506 Ga0495583_0004418 Ga0495583_0004418_2074_3198 354
417 3300046506 Ga0495583_0035926 Ga0495583_0035926_296_1417 354
418 3300046507 Ga0495606_0024893 Ga0495606_0024893_1320_2450 354
419 3300046513 Ga0495616_0044097 Ga0495616_0044097_923_2044 354
420 3300046518 Ga0495631_0004446 Ga0495631_0004446_1726_2850 354
421 3300046519 Ga0495632_0006166 Ga0495632_0006166_592_1716 354
422 3300046522 Ga0495643_0111783 Ga0495643_0111783_222_1340 354
423 3300046524 Ga0495648_0096526 Ga0495648_0096526_15_1133 354
424 3300046526 Ga0495666_0002304 Ga0495666_0002304_6425_7555 354
425 3300046528 Ga0495642_0031048 Ga0495642_0031048_204_1328 354
426 3300046529 Ga0495652_0034764 Ga0495652_0034764_1983_3107 354
427 3300046542 Ga0495597_0002718 Ga0495597_0002718_791_1909 354
428 3300046542 Ga0495597_0003136 Ga0495597_0003136_1605_2723 354
429 3300046558 Ga0495633_0018108 Ga0495633_0018108_947_2071 354
430 3300046558 Ga0495633_0048390 Ga0495633_0048390_176_1297 354
431 3300046616 Ga0495668_0007960 Ga0495668_0007960_1710_2828 354
432 3300046648 Ga0495611_0002762 Ga0495611_0002762_1326_2447 354
433 3300046665 Ga0495661_0000490 Ga0495661_0000490_33900_35018 354
434 3300046665 Ga0495661_0008306 Ga0495661_0008306_1996_3120 354
435 3300046665 Ga0495661_0080054 Ga0495661_0080054_745_1866 354
436 3300046679 Ga0495623_0004092 Ga0495623_0004092_4142_5266 354
437 3300046684 Ga0495669_0015545 Ga0495669_0015545_783_1904 354
438 3300046684 Ga0495669_0042112 Ga0495669_0042112_394_1518 354
439 3300046684 Ga0495669_0062005 Ga0495669_0062005_307_1428 354
440 3300046692 Ga0495671_0060337 Ga0495671_0060337_328_1449 354
441 3300046694 Ga0495649_0062254 Ga0495649_0062254_240_1373 354
442 3300046694 Ga0495649_0076532 Ga0495649_0076532_139_1263 354
443 3300046794 Ga0495589_0047304 Ga0495589_0047304_480_1604 354
444 3300046810 Ga0495660_0050070 Ga0495660_0050070_479_1603 354
445 3300047317 Ga0495604_0022591 Ga0495604_0022591_2664_3788 354
446 3300047320 Ga0495672_0084496 Ga0495672_0084496_565_1689 354
447 3300047323 Ga0495683_0018685 Ga0495683_0018685_1050_2174 354
448 3300047444 Ga0495675_0007299 Ga0495675_0007299_16_1116 354
449 3300047445 Ga0495677_0010091 Ga0495677_0010091_612_1736 354
450 3300047445 Ga0495677_0037947 Ga0495677_0037947_377_1498 354
451 3300047470 Ga0495681_0005506 Ga0495681_0005506_7152_8276 354
452 3300048088 Ga0495602_0007222 Ga0495602_0007222_6460_7584 354
453 3300048091 Ga0495626_0004624 Ga0495626_0004624_6745_7863 354
454 3300048903 Ga0496100_0079681 Ga0496100_0079681_919_2037 354
455 3300048904 Ga0496101_0050820 Ga0496101_0050820_350_1468 354
456 3300048926 Ga0496123_0090250 Ga0496123_0090250_176_1297 354
457 3300049459 Ga0495678_005675 Ga0495678_005675_4029_5153 354
458 3300013102 Ga0157371_10000018 Ga0157371_10000018243 355
459 3300014497 Ga0182008_10022614 Ga0182008_100226142 355
460 3300015261 Ga0182006_1036812 Ga0182006_10368122 355
461 3300044842 Ga0466957_0058623 Ga0466957_0058623_32_1147 355
462 3300046506 Ga0495583_0041718 Ga0495583_0041718_792_1925 355
463 3300046524 Ga0495648_0011915 Ga0495648_0011915_3432_4529 355
464 3300048927 Ga0496124_0011035 Ga0496124_0011035_4792_5916 355
465 3300042139 Ga0450904_002589 Ga0450904_002589_839_1951 356
466 3300046524 Ga0495648_0000350 Ga0495648_0000350_39160_40290 358
467 3300046528 Ga0495642_0001394 Ga0495642_0001394_7728_8858 358
468 iso_pu_bacteria 2842711865 2842712301 358
469 3300049775 Ga0501279_000496 Ga0501279_000496_1377_2489 359
470 3300030744 Ga0316181_1091467 Ga0316181_10914673 360
471 3300046512 Ga0495610_0005990 Ga0495610_0005990_1009_2139 360
472 3300046524 Ga0495648_0006400 Ga0495648_0006400_5188_6318 360
473 3300046538 Ga0495609_0014295 Ga0495609_0014295_711_1841 360
474 3300046692 Ga0495671_0038570 Ga0495671_0038570_437_1567 360
475 3300046694 Ga0495649_0035786 Ga0495649_0035786_1339_2445 360
476 3300053118 Ga0500594_0004037 Ga0500594_0004037_1005_2135 360
477 iso_pu_bacteria 2643221554 2643792035 360
478 iso_pu_bacteria 2643221638 2644216483 360
479 3300044672 Ga0466982_0082226 Ga0466982_0082226_170_1285 361
480 3300044765 Ga0466970_0052782 Ga0466970_0052782_295_1410 361
481 3300046558 Ga0495633_0004606 Ga0495633_0004606_986_2116 361
482 3300053145 Ga0500586_004334 Ga0500586_004334_1318_2448 361
483 3300046501 Ga0495607_0000514 Ga0495607_0000514_15393_16508 362
484 3300046506 Ga0495583_0009922 Ga0495583_0009922_651_1766 362
485 3300046513 Ga0495616_0000968 Ga0495616_0000968_17722_18837 362
486 3300046522 Ga0495643_0091662 Ga0495643_0091662_179_1294 362
487 3300046528 Ga0495642_0002375 Ga0495642_0002375_632_1747 362
488 3300046538 Ga0495609_0000314 Ga0495609_0000314_41540_42655 362
489 3300046616 Ga0495668_0011146 Ga0495668_0011146_3567_4682 362
490 3300046660 Ga0495625_0040242 Ga0495625_0040242_882_1997 362
491 3300046664 Ga0495659_0003375 Ga0495659_0003375_3233_4348 362
492 3300046684 Ga0495669_0000844 Ga0495669_0000844_10340_11455 362
493 3300046694 Ga0495649_0014891 Ga0495649_0014891_3053_4168 362
494 3300047446 Ga0495679_017637 Ga0495679_017637_349_1464 362
495 3300047470 Ga0495681_0010017 Ga0495681_0010017_3778_4893 362
496 3300047472 Ga0495686_0001233 Ga0495686_0001233_1751_2872 362
497 3300003775 Ga0055524_1000024 Ga0055524_100002443 363
498 3300006948 Ga0099826_10000010 Ga0099826_10000010218 363
499 3300025263 Ga0209565_1002627 Ga0209565_10026274 363
500 3300025299 Ga0209256_1000054 Ga0209256_1000054209 363
501 3300027666 Ga0209282_1000072 Ga0209282_100007276 363
502 3300049665 Ga0501227_005381 Ga0501227_005381_1485_2576 363
503 3300002739 JGI25158J39367_1006829 JGI25158J39367_10068291 364
504 3300002773 JGI25152J39213_1000224 JGI25152J39213_100022411 364
505 3300003323 rootH1_10075425 rootH1_100754254 364
506 3300003771 Ga0055526_1007509 Ga0055526_10075092 364
507 3300003775 Ga0055524_1001031 Ga0055524_100103110 364
508 3300003775 Ga0055524_1001929 Ga0055524_10019295 364
509 3300003784 Ga0055534_1009919 Ga0055534_10099192 364
510 3300003790 Ga0055528_1001043 Ga0055528_10010433 364
511 3300003791 Ga0055530_10003946 Ga0055530_100039462 364
512 3300003794 Ga0055531_10007726 Ga0055531_100077264 364
513 3300025245 Ga0207425_1000021 Ga0207425_100002170 364
514 3300025245 Ga0207425_1000223 Ga0207425_100022334 364
515 3300025258 Ga0209129_1000020 Ga0209129_1000020141 364
516 3300025258 Ga0209129_1004859 Ga0209129_10048593 364
517 3300025263 Ga0209565_1001864 Ga0209565_10018648 364
518 3300025284 Ga0209130_1002608 Ga0209130_10026084 364
519 3300025291 Ga0209675_1002531 Ga0209675_10025317 364
520 3300025295 Ga0209564_1001271 Ga0209564_10012718 364
521 3300025297 Ga0209758_1000077 Ga0209758_1000077194 364
522 3300025298 Ga0209050_1000050 Ga0209050_100005072 364
523 3300025299 Ga0209256_1000674 Ga0209256_100067433 364
524 3300025299 Ga0209256_1001001 Ga0209256_100100129 364
525 3300025299 Ga0209256_1002870 Ga0209256_100287012 364
526 3300025302 Ga0207426_1001270 Ga0207426_100127019 364
527 3300025304 Ga0209257_1000075 Ga0209257_100007572 364
528 3300025304 Ga0209257_1007416 Ga0209257_10074161 364
529 3300031548 Ga0307408_100004170 Ga0307408_1000041706 364
530 3300031838 Ga0307518_10111354 Ga0307518_101113542 364
531 3300046810 Ga0495660_0016480 Ga0495660_0016480_855_2039 364
532 3300048907 Ga0496104_0194987 Ga0496104_0194987_476_1630 364
533 iso_pu_bacteria 2738541297 2738826829 364
534 iso_pu_bacteria 2738541357 2739150626 364
535 iso_pu_bacteria 2738543003 2739192545 364
536 iso_pu_bacteria 2738543026 2739319022 364
537 iso_pu_bacteria 2738543029 2739337263 364
538 iso_pu_bacteria 2821131069 2821135837 364
539 iso_pu_bacteria 2857553236 2857556238 364
540 iso_pu_bacteria 2857558681 2857560838 364
541 iso_pu_bacteria 2857564685 2857568039 364
542 iso_pu_bacteria 2904424332 2904428822 364
543 3300003322 rootL2_10029882 rootL2_100298823 365
544 3300003763 Ga0055529_1000079 Ga0055529_100007962 365
545 3300003771 Ga0055526_1000211 Ga0055526_100021136 365
546 3300003771 Ga0055526_1000272 Ga0055526_10002724 365
547 3300009036 Ga0105244_10003379 Ga0105244_100033799 365
548 3300014497 Ga0182008_10001672 Ga0182008_100016728 365
549 3300015261 Ga0182006_1000141 Ga0182006_100014119 365
550 3300015262 Ga0182007_10000144 Ga0182007_1000014412 365
551 3300015265 Ga0182005_1000016 Ga0182005_1000016238 365
552 3300015265 Ga0182005_1000024 Ga0182005_100002411 365
553 3300017792 Ga0163161_10114153 Ga0163161_101141532 365
554 3300021361 Ga0213872_10000005 Ga0213872_1000000530 365
555 3300021361 Ga0213872_10019006 Ga0213872_100190064 365
556 3300021361 Ga0213872_10025486 Ga0213872_100254862 365
557 3300025245 Ga0207425_1000640 Ga0207425_10006408 365
558 3300025246 Ga0209646_1000068 Ga0209646_100006871 365
559 3300025272 Ga0209455_1000070 Ga0209455_1000070211 365
560 3300025294 Ga0209025_1018501 Ga0209025_10185012 365
561 3300025295 Ga0209564_1000027 Ga0209564_1000027290 365
562 3300025295 Ga0209564_1000047 Ga0209564_100004775 365
563 3300025297 Ga0209758_1000322 Ga0209758_100032266 365
564 3300025728 Ga0207655_1000710 Ga0207655_100071028 365
565 3300025728 Ga0207655_1008685 Ga0207655_10086855 365
566 3300027111 Ga0209281_1005795 Ga0209281_10057952 365
567 3300032005 Ga0307411_10162416 Ga0307411_101624162 365
568 3300039447 Ga0436361_0235534 Ga0436361_0235534_10998_12134 365
569 3300039447 Ga0436361_0240080 Ga0436361_0240080_2759_3883 365
570 3300039447 Ga0436361_0252850 Ga0436361_0252850_1648_2772 365
571 3300039447 Ga0436361_0820978 Ga0436361_0820978_37530_38654 365
572 3300039447 Ga0436361_0977423 Ga0436361_0977423_669_1793 365
573 3300046452 Ga0495617_000245 Ga0495617_000245_18302_19432 365
574 3300046452 Ga0495617_001502 Ga0495617_001502_2562_3692 365
575 3300046452 Ga0495617_005346 Ga0495617_005346_948_2099 365
576 3300046457 Ga0495590_0000020 Ga0495590_0000020_161292_162422 365
577 3300046460 Ga0495638_0000235 Ga0495638_0000235_10499_11629 365
578 3300046460 Ga0495638_0001049 Ga0495638_0001049_2759_3910 365
579 3300046460 Ga0495638_0067899 Ga0495638_0067899_557_1687 365
580 3300046463 Ga0495653_0000067 Ga0495653_0000067_21312_22442 365
581 3300046471 Ga0495650_0000251 Ga0495650_0000251_103564_104694 365
582 3300046471 Ga0495650_0000436 Ga0495650_0000436_55707_56852 365
583 3300046471 Ga0495650_0005399 Ga0495650_0005399_3616_4746 365
584 3300046471 Ga0495650_0005880 Ga0495650_0005880_4625_5755 365
585 3300046474 Ga0495605_0000061 Ga0495605_0000061_96688_97818 365
586 3300046475 Ga0495639_0025159 Ga0495639_0025159_19_1149 365
587 3300046491 Ga0495584_0007872 Ga0495584_0007872_2403_3554 365
588 3300046491 Ga0495584_0041240 Ga0495584_0041240_207_1358 365
589 3300046492 Ga0495585_0002222 Ga0495585_0002222_6946_8076 365
590 3300046492 Ga0495585_0014717 Ga0495585_0014717_2031_3182 365
591 3300046492 Ga0495585_0070352 Ga0495585_0070352_531_1682 365
592 3300046501 Ga0495607_0008009 Ga0495607_0008009_1977_3107 365
593 3300046501 Ga0495607_0010458 Ga0495607_0010458_1375_2532 365
594 3300046501 Ga0495607_0016220 Ga0495607_0016220_2046_3197 365
595 3300046501 Ga0495607_0056988 Ga0495607_0056988_697_1848 365
596 3300046506 Ga0495583_0000317 Ga0495583_0000317_23941_25092 365
597 3300046506 Ga0495583_0002937 Ga0495583_0002937_10471_11601 365
598 3300046507 Ga0495606_0000120 Ga0495606_0000120_91994_93124 365
599 3300046507 Ga0495606_0000262 Ga0495606_0000262_47460_48590 365
600 3300046507 Ga0495606_0000433 Ga0495606_0000433_21726_22916 365
601 3300046507 Ga0495606_0003347 Ga0495606_0003347_7027_8157 365
602 3300046507 Ga0495606_0003359 Ga0495606_0003359_2555_3685 365
603 3300046507 Ga0495606_0008104 Ga0495606_0008104_380_1525 365
604 3300046512 Ga0495610_0000017 Ga0495610_0000017_287122_288252 365
605 3300046512 Ga0495610_0010999 Ga0495610_0010999_2338_3471 365
606 3300046512 Ga0495610_0016874 Ga0495610_0016874_1788_2918 365
607 3300046512 Ga0495610_0019833 Ga0495610_0019833_1274_2407 365
608 3300046512 Ga0495610_0029250 Ga0495610_0029250_1042_2172 365
609 3300046513 Ga0495616_0012210 Ga0495616_0012210_2046_3197 365
610 3300046513 Ga0495616_0019686 Ga0495616_0019686_524_1675 365
611 3300046520 Ga0495637_0000179 Ga0495637_0000179_41758_42888 365
612 3300046520 Ga0495637_0002381 Ga0495637_0002381_2364_3494 365
613 3300046522 Ga0495643_0004577 Ga0495643_0004577_1882_3012 365
614 3300046523 Ga0495644_0001273 Ga0495644_0001273_2786_3937 365
615 3300046523 Ga0495644_0002046 Ga0495644_0002046_2050_3201 365
616 3300046524 Ga0495648_0008929 Ga0495648_0008929_4342_5472 365
617 3300046524 Ga0495648_0010395 Ga0495648_0010395_3002_4132 365
618 3300046524 Ga0495648_0045451 Ga0495648_0045451_696_1847 365
619 3300046530 Ga0495654_0000060 Ga0495654_0000060_71654_72784 365
620 3300046530 Ga0495654_0001159 Ga0495654_0001159_11764_12894 365
621 3300046538 Ga0495609_0001512 Ga0495609_0001512_7022_8173 365
622 3300046538 Ga0495609_0014512 Ga0495609_0014512_1603_2754 365
623 3300046542 Ga0495597_0001017 Ga0495597_0001017_7760_8890 365
624 3300046542 Ga0495597_0001024 Ga0495597_0001024_1914_3044 365
625 3300046542 Ga0495597_0012946 Ga0495597_0012946_775_1926 365
626 3300046557 Ga0495622_0000488 Ga0495622_0000488_2070_3194 365
627 3300046557 Ga0495622_0001922 Ga0495622_0001922_6984_8114 365
628 3300046558 Ga0495633_0003677 Ga0495633_0003677_1907_3037 365
629 3300046558 Ga0495633_0010011 Ga0495633_0010011_2278_3408 365
630 3300046558 Ga0495633_0015948 Ga0495633_0015948_1920_3071 365
631 3300046558 Ga0495633_0042766 Ga0495633_0042766_817_1968 365
632 3300046616 Ga0495668_0000162 Ga0495668_0000162_28989_30119 365
633 3300046616 Ga0495668_0002105 Ga0495668_0002105_1641_2771 365
634 3300046616 Ga0495668_0004696 Ga0495668_0004696_1460_2590 365
635 3300046648 Ga0495611_0003285 Ga0495611_0003285_3605_4756 365
636 3300046660 Ga0495625_0001192 Ga0495625_0001192_14917_16047 365
637 3300046660 Ga0495625_0007112 Ga0495625_0007112_2055_3185 365
638 3300046660 Ga0495625_0032343 Ga0495625_0032343_1832_2962 365
639 3300046664 Ga0495659_0000127 Ga0495659_0000127_30688_31839 365
640 3300046664 Ga0495659_0000721 Ga0495659_0000721_4161_5312 365
641 3300046665 Ga0495661_0026903 Ga0495661_0026903_2398_3528 365
642 3300046692 Ga0495671_0000037 Ga0495671_0000037_152461_153591 365
643 3300046692 Ga0495671_0000266 Ga0495671_0000266_1811_2962 365
644 3300046692 Ga0495671_0021170 Ga0495671_0021170_802_1953 365
645 3300046694 Ga0495649_0042129 Ga0495649_0042129_586_1716 365
646 3300046810 Ga0495660_0002471 Ga0495660_0002471_8455_9606 365
647 3300046810 Ga0495660_0003717 Ga0495660_0003717_6948_8078 365
648 3300046810 Ga0495660_0007910 Ga0495660_0007910_2036_3166 365
649 3300046810 Ga0495660_0042667 Ga0495660_0042667_870_2000 365
650 3300047318 Ga0495636_0003200 Ga0495636_0003200_5160_6311 365
651 3300047320 Ga0495672_0000013 Ga0495672_0000013_58354_59520 365
652 3300047320 Ga0495672_0000297 Ga0495672_0000297_34263_35414 365
653 3300047320 Ga0495672_0011050 Ga0495672_0011050_3800_4951 365
654 3300047320 Ga0495672_0026668 Ga0495672_0026668_2189_3340 365
655 3300047323 Ga0495683_0000773 Ga0495683_0000773_7555_8706 365
656 3300047323 Ga0495683_0039873 Ga0495683_0039873_414_1544 365
657 3300047443 Ga0495687_000342 Ga0495687_000342_51102_52253 365
658 3300047443 Ga0495687_004513 Ga0495687_004513_2335_3465 365
659 3300047443 Ga0495687_004776 Ga0495687_004776_1911_3041 365
660 3300047445 Ga0495677_0006999 Ga0495677_0006999_1790_2941 365
661 3300047445 Ga0495677_0012355 Ga0495677_0012355_625_1776 365
662 3300047447 Ga0495685_000088 Ga0495685_000088_16031_17182 365
663 3300047469 Ga0495673_0000179 Ga0495673_0000179_41162_42292 365
664 3300047469 Ga0495673_0000201 Ga0495673_0000201_52709_53839 365
665 3300047469 Ga0495673_0000248 Ga0495673_0000248_63635_64765 365
666 3300047472 Ga0495686_0001635 Ga0495686_0001635_11138_12337 365
667 3300047472 Ga0495686_0005028 Ga0495686_0005028_6227_7357 365
668 3300047472 Ga0495686_0007524 Ga0495686_0007524_6346_7497 365
669 3300047472 Ga0495686_0038847 Ga0495686_0038847_1188_2318 365
670 3300048919 Ga0496116_0030804 Ga0496116_0030804_631_1761 365
671 3300048919 Ga0496116_0041864 Ga0496116_0041864_1232_2395 365
672 3300048919 Ga0496116_0075259 Ga0496116_0075259_83_1216 365
673 3300048920 Ga0496117_0000005 Ga0496117_0000005_553525_554688 365
674 3300048921 Ga0496118_0000031 Ga0496118_0000031_222781_223944 365
675 3300048923 Ga0496120_0032282 Ga0496120_0032282_1120_2250 365
676 3300048924 Ga0496121_0021381 Ga0496121_0021381_259_1422 365
677 3300048924 Ga0496121_0063402 Ga0496121_0063402_1613_2743 365
678 3300048925 Ga0496122_0002483 Ga0496122_0002483_7158_8321 365
679 3300048925 Ga0496122_0029016 Ga0496122_0029016_1517_2647 365
680 3300048925 Ga0496122_0063214 Ga0496122_0063214_1429_2559 365
681 3300048926 Ga0496123_0001525 Ga0496123_0001525_18920_20083 365
682 3300048926 Ga0496123_0008730 Ga0496123_0008730_7043_8173 365
683 3300048927 Ga0496124_0015786 Ga0496124_0015786_3589_4752 365
684 3300048927 Ga0496124_0100008 Ga0496124_0100008_146_1276 365
685 3300048928 Ga0496125_0209664 Ga0496125_0209664_30_1193 365
686 3300048929 Ga0496126_0026304 Ga0496126_0026304_2394_3524 365
687 3300049459 Ga0495678_000010 Ga0495678_000010_296063_297196 365
688 3300049459 Ga0495678_009409 Ga0495678_009409_2957_4108 365
689 3300049460 Ga0495682_0001031 Ga0495682_0001031_6335_7486 365
690 3300049460 Ga0495682_0001462 Ga0495682_0001462_6336_7487 365
691 3300049460 Ga0495682_0008902 Ga0495682_0008902_844_2007 365
692 3300049766 Ga0501269_001283 Ga0501269_001283_2171_3301 365
693 3300053125 Ga0500618_000139 Ga0500618_000139_44129_45259 365
694 iso_pu_bacteria 2600255292 2601667057 365
695 iso_pu_bacteria 2643221645 2644254772 365
696 iso_pu_bacteria 2643221664 2644360324 365
697 iso_pu_bacteria 2738541280 2738738079 365
698 iso_pu_bacteria 2738541300 2738843130 365
699 iso_pu_bacteria 2738543018 2739273881 365
700 iso_pu_bacteria 2738543030 2739342925 365
701 iso_pu_bacteria 2857547612 2857549102 365
702 iso_pu_bacteria 2885080285 2885085000 365
703 iso_pu_bacteria 2919476304 2919477004 365
704 3300002739 JGI25158J39367_1002276 JGI25158J39367_10022761 367
705 3300002987 JGI25159J45721_1003027 JGI25159J45721_10030273 367
706 3300003374 JGI25161J50226_1000949 JGI25161J50226_10009493 367
707 3300003771 Ga0055526_1007814 Ga0055526_10078145 367
708 3300003775 Ga0055524_1001453 Ga0055524_10014536 367
709 3300003791 Ga0055530_10001965 Ga0055530_100019656 367
710 3300004625 Ga0055543_1000924 Ga0055543_10009246 367
711 3300005262 Ga0065165_1002806 Ga0065165_10028066 367
712 3300025208 Ga0209436_100797 Ga0209436_1007977 367
713 3300025263 Ga0209565_1008102 Ga0209565_10081024 367
714 3300025284 Ga0209130_1001646 Ga0209130_10016466 367
715 3300025291 Ga0209675_1022431 Ga0209675_10224313 367
716 3300025295 Ga0209564_1000780 Ga0209564_100078033 367
717 3300025298 Ga0209050_1000795 Ga0209050_100079534 367
718 3300025299 Ga0209256_1003939 Ga0209256_10039397 367
719 3300031548 Ga0307408_100000531 Ga0307408_10000053128 367
720 3300031548 Ga0307408_100002211 Ga0307408_10000221111 367
721 3300031548 Ga0307408_100005814 Ga0307408_1000058146 367
722 3300049775 Ga0501279_001155 Ga0501279_001155_1047_2159 367

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00730

HhH-GPD

HhH-GPD superfamily base excision DNA repair protein

37

172

0.96

PF00633

HHH

Helix-hairpin-helix motif

101

130

0.95

PF14815

NUDIX_4

NUDIX domain

236

353

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
1kg6-assembly1.cif.gz_A crystal structure of the k142r mutant of e.coli muty (core fragment) 0.9671 8 226
1muy-assembly1.cif.gz_A-2 catalytic domain of muty from escherichia coli 0.967 4 227
1weg-assembly1.cif.gz_A catalytic domain of muty from escherichia coli k142a mutant 0.9669 8 227
1kg7-assembly1.cif.gz_A crystal structure of the e161a mutant of e.coli muty (core fragment) 0.9666 6 226
1mun-assembly1.cif.gz_A-2 catalytic domain of muty from escherichia coli d138n mutant 0.9666 4 227
ID Description Score Start End Superfamily
1rrqA02 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9729 23 134 1.10.340.30
1rrqA02 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9644 23 134 1.10.340.30
1kg2A02 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9629 23 134 1.10.340.30
1kg2A02 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9547 23 134 1.10.340.30
1weiA01 Mainly Alpha;Orthogonal Bundle;Endonuclease Iii, domain 2;Helix-hairpin-Helix base-excision DNA repair enzymes (C-terminal) 0.9518 137 226 1.10.1670.10
ID Description Score Start End GO Terms
AF-A0A6L5DGX0-F1-model_v4 deleted 0.9761 59 160
AF-A0A4U9V3Q8-F1-model_v4 Adenine DNA glycosylase (EC 3.2.2.31) 0.9738 8 228 GO:0000701
GO:0006284
GO:0006298
GO:0032357
GO:0034039
GO:0035485
GO:0046872
GO:0051539
AF-A0A353Y599-F1-model_v4 Adenine DNA glycosylase (EC 3.2.2.31) 0.9729 43 152 GO:0000701
GO:0006284
GO:0006298
GO:0032357
GO:0034039
GO:0035485
GO:0046872
GO:0051536
AF-T1BBA5-F1-model_v4 Adenine DNA glycosylase 0.9723 53 216 GO:0000701
GO:0006284
GO:0006298
GO:0032357
GO:0034039
GO:0035485
GO:0046872
GO:0051539
AF-A0A3M9ZLM4-F1-model_v4 A/G-specific adenine glycosylase 0.9722 121 219 GO:0000701
GO:0006284
GO:0006298
GO:0032357
GO:0034039
GO:0035485
GO:0046872
GO:0051536

Feature Viewer

pLDDT pTM Quality
90.84 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map