F477374
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 721 | 313 | 1442 | 220 |
Family's Representative Sequence
| Representative Sequence | 3300031456|Ga0307513_10332481|Ga0307513_103324812 |
| Length | 213 |
| Sequence | MRVLVVEDQVELADSIGRVLRREGMAVDVVYDGGQALEHTGVTGYDVVVLDRDIPVVHGDDVCRELTGPRVLMLTASGTLADRVEGLNLGADDYLPKPFAYAELVARVRAIGRRSQPAVPTLLTHRDLELDPAKRVATRGGVRLVLTPKEFAVLEHLLAAQHRVVSAEELLDRVWDEAADPFTTTVKATINRLRGKLGAPPLIETVPRSGYRI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 2 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 25 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 27 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 29 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 30 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 31 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 32 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 33 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 34 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 35 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 36 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 37 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 38 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 39 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 44 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 45 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 46 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 47 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 49 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 65 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 66 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 67 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 68 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 104 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 105 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 106 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 107 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 108 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 109 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 110 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 111 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 112 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 113 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 114 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 115 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 116 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 117 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 118 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 119 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 120 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 121 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 122 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 123 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 124 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 125 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 126 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 127 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 128 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 129 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 130 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 131 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 132 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 133 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 134 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 135 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 136 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 137 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 138 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 139 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 140 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 141 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 142 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 143 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 144 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 145 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 146 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 147 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 148 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 149 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 150 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 151 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 152 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 153 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 154 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 155 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 156 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 157 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 158 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 159 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 160 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 161 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 162 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 163 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 164 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 165 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 166 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 167 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 168 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 169 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 170 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 171 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 172 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 173 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 174 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 175 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 176 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 177 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 178 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 179 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 180 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 181 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 182 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 183 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 184 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 185 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 186 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 187 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 188 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 189 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 190 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 191 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 238 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 239 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 240 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 241 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 242 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 243 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 244 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 245 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 246 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 247 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 248 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 249 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 250 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 251 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 252 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 253 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 254 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 255 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 256 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 292 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 293 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 294 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 295 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 296 | 2684623035 | Frankia sp. NRRL B-16219 | Isolate | Rhizosphere |
| 297 | 2751185782 | Actinoplanes subtropicus NRRL B-24665 | Isolate | Rhizosphere |
| 298 | 2791355406 | Streptomyces rhizosphaericus NRRL B-24304 | Isolate | Unclassified |
| 299 | 2873151551 | Streptomyces silaceus ACCC40021 | Isolate | Rhizosphere |
| 300 | 2880489317 | Micromonospora ureilytica DSM 101692 | Isolate | Unclassified |
| 301 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 302 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 303 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 304 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 305 | 8002784119 | Frankia sp. AgB1.9 | Isolate | Nodule |
| 306 | 8033684223 | Streptomyces phytophilus PIP175 | Isolate | Unclassified |
| 307 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 308 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 309 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 310 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
| 311 | 8054727385 | Micromonospora alfalfae MED01 | Isolate | Nodule |
| 312 | 8055066027 | Sphaerisporangium corydalis NEAU-YHS15 | Isolate | Unclassified |
| 313 | 8055172936 | Sphaerisporangium perillae NEAU-ZS1 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.26 |
| Metatranscriptomes | 0.83 |
| Isolates | 2.91 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.83 |
| Nodule | 0.28 |
| Rhizoplane | 4.72 |
| Rhizosphere | 84.6 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.28 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0307513_10332481 | 3300031456 | Bacteria | 1273 |
| 2 | rootL2_10161055 | 3300003322 | Bacteria | 2359 |
| 3 | Ga0070658_10121097 | 3300005327 | Bacteria | 2174 |
| 4 | Ga0070683_100003527 | 3300005329 | Bacteria | 12732 |
| 5 | Ga0070683_100030232 | 3300005329 | Bacteria | 4913 |
| 6 | Ga0070677_10000002 | 3300005333 | Bacteria | 87295 |
| 7 | Ga0070682_100161446 | 3300005337 | Bacteria | 1548 |
| 8 | Ga0068868_100762264 | 3300005338 | Bacteria | 870 |
| 9 | Ga0070661_100051914 | 3300005344 | Bacteria | 3001 |
| 10 | Ga0070661_100080899 | 3300005344 | Bacteria | 2398 |
| 11 | Ga0070668_100042584 | 3300005347 | Bacteria | 3480 |
| 12 | Ga0070688_100248646 | 3300005365 | Bacteria | 1265 |
| 13 | Ga0070667_100010602 | 3300005367 | Bacteria | 7610 |
| 14 | Ga0070667_100017131 | 3300005367 | Bacteria | 6002 |
| 15 | Ga0070709_10000304 | 3300005434 | Bacteria | 31234 |
| 16 | Ga0070709_10008267 | 3300005434 | Bacteria | 5715 |
| 17 | Ga0070714_100002439 | 3300005435 | Bacteria | 13710 |
| 18 | Ga0070714_100002881 | 3300005435 | Bacteria | 12726 |
| 19 | Ga0070714_100006786 | 3300005435 | Bacteria | 8875 |
| 20 | Ga0070714_100013384 | 3300005435 | Bacteria | 6573 |
| 21 | Ga0070714_100035129 | 3300005435 | Bacteria | 4199 |
| 22 | Ga0070714_100047951 | 3300005435 | Bacteria | 3631 |
| 23 | Ga0070714_100059771 | 3300005435 | Bacteria | 3269 |
| 24 | Ga0070714_100111240 | 3300005435 | Bacteria | 2425 |
| 25 | Ga0070714_100168438 | 3300005435 | Bacteria | 1986 |
| 26 | Ga0070714_100333487 | 3300005435 | Bacteria | 1421 |
| 27 | Ga0070714_100378079 | 3300005435 | Bacteria | 1335 |
| 28 | Ga0070714_100670638 | 3300005435 | Bacteria | 999 |
| 29 | Ga0070713_100006687 | 3300005436 | Bacteria | 8026 |
| 30 | Ga0070713_100017143 | 3300005436 | Bacteria | 5469 |
| 31 | Ga0070713_100036517 | 3300005436 | Bacteria | 3965 |
| 32 | Ga0070713_100036914 | 3300005436 | Bacteria | 3947 |
| 33 | Ga0070713_100049125 | 3300005436 | Bacteria | 3479 |
| 34 | Ga0070713_100080203 | 3300005436 | Bacteria | 2782 |
| 35 | Ga0070713_100103397 | 3300005436 | Bacteria | 2472 |
| 36 | Ga0070713_100108094 | 3300005436 | Bacteria | 2421 |
| 37 | Ga0070713_100121190 | 3300005436 | Bacteria | 2294 |
| 38 | Ga0070713_100127687 | 3300005436 | Unclassified | 2239 |
| 39 | Ga0070713_100164583 | 3300005436 | Bacteria | 1982 |
| 40 | Ga0070713_100166005 | 3300005436 | Bacteria | 1974 |
| 41 | Ga0070713_100182093 | 3300005436 | Bacteria | 1888 |
| 42 | Ga0070713_100260667 | 3300005436 | Bacteria | 1584 |
| 43 | Ga0070713_100354391 | 3300005436 | Bacteria | 1362 |
| 44 | Ga0070713_100359433 | 3300005436 | Bacteria | 1352 |
| 45 | Ga0070713_100894977 | 3300005436 | Bacteria | 854 |
| 46 | Ga0070710_10006988 | 3300005437 | Bacteria | 5445 |
| 47 | Ga0070710_10009828 | 3300005437 | Bacteria | 4688 |
| 48 | Ga0070710_10023690 | 3300005437 | Bacteria | 3230 |
| 49 | Ga0070710_10051112 | 3300005437 | Bacteria | 2320 |
| 50 | Ga0070710_10111385 | 3300005437 | Bacteria | 1645 |
| 51 | Ga0070711_100008504 | 3300005439 | Bacteria | 6289 |
| 52 | Ga0070711_100018037 | 3300005439 | Bacteria | 4502 |
| 53 | Ga0070711_100021516 | 3300005439 | Bacteria | 4172 |
| 54 | Ga0070711_100058594 | 3300005439 | Bacteria | 2671 |
| 55 | Ga0070711_100073092 | 3300005439 | Bacteria | 2421 |
| 56 | Ga0070711_100229739 | 3300005439 | Bacteria | 1446 |
| 57 | Ga0070708_100040380 | 3300005445 | Bacteria | 4086 |
| 58 | Ga0070708_100437479 | 3300005445 | Bacteria | 1234 |
| 59 | Ga0070708_100441292 | 3300005445 | Bacteria | 1228 |
| 60 | Ga0070681_10047270 | 3300005458 | Bacteria | 4301 |
| 61 | Ga0070681_10121682 | 3300005458 | Bacteria | 2544 |
| 62 | Ga0070681_10237534 | 3300005458 | Bacteria | 1736 |
| 63 | Ga0070706_100028740 | 3300005467 | Bacteria | 5120 |
| 64 | Ga0070706_100040281 | 3300005467 | Bacteria | 4312 |
| 65 | Ga0070706_100092397 | 3300005467 | Bacteria | 2807 |
| 66 | Ga0070698_100015832 | 3300005471 | Bacteria | 7964 |
| 67 | Ga0070698_100097015 | 3300005471 | Bacteria | 2924 |
| 68 | Ga0070698_100464257 | 3300005471 | Bacteria | 1202 |
| 69 | Ga0070698_100637386 | 3300005471 | Bacteria | 1007 |
| 70 | Ga0070699_100527561 | 3300005518 | Bacteria | 1074 |
| 71 | Ga0070679_100289461 | 3300005530 | Bacteria | 1589 |
| 72 | Ga0070684_100010494 | 3300005535 | Bacteria | 7340 |
| 73 | Ga0070684_100044764 | 3300005535 | Bacteria | 3829 |
| 74 | Ga0070684_100097776 | 3300005535 | Bacteria | 2618 |
| 75 | Ga0070684_100208581 | 3300005535 | Bacteria | 1781 |
| 76 | Ga0068853_100056346 | 3300005539 | Bacteria | 3389 |
| 77 | Ga0070665_100048757 | 3300005548 | Bacteria | 4251 |
| 78 | Ga0070665_100087523 | 3300005548 | Bacteria | 3121 |
| 79 | Ga0070665_100244713 | 3300005548 | Bacteria | 1794 |
| 80 | Ga0070665_100690699 | 3300005548 | Bacteria | 1034 |
| 81 | Ga0068855_100007036 | 3300005563 | Bacteria | 13650 |
| 82 | Ga0070664_100034597 | 3300005564 | Bacteria | 4238 |
| 83 | Ga0070664_100040038 | 3300005564 | Bacteria | 3951 |
| 84 | Ga0070664_100101158 | 3300005564 | Bacteria | 2506 |
| 85 | Ga0068857_100071362 | 3300005577 | Bacteria | 3094 |
| 86 | Ga0068857_100250736 | 3300005577 | Bacteria | 1623 |
| 87 | Ga0068856_100056913 | 3300005614 | Bacteria | 3860 |
| 88 | Ga0068856_100183370 | 3300005614 | Bacteria | 2107 |
| 89 | Ga0068852_100018248 | 3300005616 | Bacteria | 5525 |
| 90 | Ga0068864_100251181 | 3300005618 | Bacteria | 1642 |
| 91 | Ga0068864_100412861 | 3300005618 | Bacteria | 1285 |
| 92 | Ga0068863_100350809 | 3300005841 | Bacteria | 1437 |
| 93 | Ga0068863_100445725 | 3300005841 | Bacteria | 1270 |
| 94 | Ga0068858_100023769 | 3300005842 | Bacteria | 5710 |
| 95 | Ga0068858_100175232 | 3300005842 | Bacteria | 2023 |
| 96 | Ga0068860_100015723 | 3300005843 | Bacteria | 7388 |
| 97 | Ga0068862_100000226 | 3300005844 | Bacteria | 62735 |
| 98 | Ga0081455_10008990 | 3300005937 | Bacteria | 10318 |
| 99 | Ga0081538_10006523 | 3300005981 | Bacteria | 10255 |
| 100 | Ga0081539_10000135 | 3300005985 | Bacteria | 172789 |
| 101 | Ga0070717_10005799 | 3300006028 | Bacteria | 9045 |
| 102 | Ga0070717_10007966 | 3300006028 | Bacteria | 7891 |
| 103 | Ga0070717_10013585 | 3300006028 | Bacteria | 6246 |
| 104 | Ga0070717_10036856 | 3300006028 | Bacteria | 3968 |
| 105 | Ga0070717_10073734 | 3300006028 | Bacteria | 2853 |
| 106 | Ga0070717_10105962 | 3300006028 | Bacteria | 2393 |
| 107 | Ga0070717_10107587 | 3300006028 | Bacteria | 2375 |
| 108 | Ga0070717_10125477 | 3300006028 | Bacteria | 2203 |
| 109 | Ga0070717_10127810 | 3300006028 | Bacteria | 2183 |
| 110 | Ga0070715_10004858 | 3300006163 | Bacteria | 4451 |
| 111 | Ga0070715_10027432 | 3300006163 | Bacteria | 2275 |
| 112 | Ga0070715_10068587 | 3300006163 | Bacteria | 1577 |
| 113 | Ga0070716_100006515 | 3300006173 | Bacteria | 5706 |
| 114 | Ga0070716_100013232 | 3300006173 | Bacteria | 4201 |
| 115 | Ga0070712_100001468 | 3300006175 | Bacteria | 14378 |
| 116 | Ga0070712_100014450 | 3300006175 | Bacteria | 5068 |
| 117 | Ga0070712_100030346 | 3300006175 | Bacteria | 3631 |
| 118 | Ga0070712_100067409 | 3300006175 | Bacteria | 2546 |
| 119 | Ga0070712_100070499 | 3300006175 | Bacteria | 2498 |
| 120 | Ga0070712_100264242 | 3300006175 | Bacteria | 1380 |
| 121 | Ga0070712_100310936 | 3300006175 | Bacteria | 1278 |
| 122 | Ga0075428_100389121 | 3300006844 | Bacteria | 1495 |
| 123 | Ga0075431_100010116 | 3300006847 | Bacteria | 9478 |
| 124 | Ga0075434_100085098 | 3300006871 | Bacteria | 3161 |
| 125 | Ga0075434_100144568 | 3300006871 | Bacteria | 2398 |
| 126 | Ga0075436_100137075 | 3300006914 | Bacteria | 1719 |
| 127 | Ga0097620_100000073 | 3300006931 | Bacteria | 93018 |
| 128 | Ga0075435_100097225 | 3300007076 | Bacteria | 2436 |
| 129 | Ga0105240_10229716 | 3300009093 | Bacteria | 2157 |
| 130 | Ga0105241_10000454 | 3300009174 | Bacteria | 30798 |
| 131 | Ga0105248_10000034 | 3300009177 | Bacteria | 192324 |
| 132 | Ga0105248_10195350 | 3300009177 | Bacteria | 2280 |
| 133 | Ga0105237_10246415 | 3300009545 | Bacteria | 1788 |
| 134 | Ga0105237_10535184 | 3300009545 | Bacteria | 1178 |
| 135 | Ga0105238_10072802 | 3300009551 | Bacteria | 3431 |
| 136 | Ga0105249_10019175 | 3300009553 | Bacteria | 6100 |
| 137 | Ga0105239_10094755 | 3300010375 | Bacteria | 3298 |
| 138 | Ga0157370_10589908 | 3300013104 | Bacteria | 1018 |
| 139 | Ga0157369_10025153 | 3300013105 | Bacteria | 6610 |
| 140 | Ga0157369_10659436 | 3300013105 | Bacteria | 1079 |
| 141 | Ga0163162_10399704 | 3300013306 | Bacteria | 1507 |
| 142 | Ga0157372_10666074 | 3300013307 | Bacteria | 1212 |
| 143 | Ga0157375_10308505 | 3300013308 | Bacteria | 1746 |
| 144 | Ga0163163_10019517 | 3300014325 | Bacteria | 6368 |
| 145 | Ga0163163_10288242 | 3300014325 | Bacteria | 1694 |
| 146 | Ga0163163_10524780 | 3300014325 | Bacteria | 1246 |
| 147 | Ga0157379_10158269 | 3300014968 | Bacteria | 2044 |
| 148 | Ga0157376_10527972 | 3300014969 | Bacteria | 1164 |
| 149 | Ga0213874_10008181 | 3300021377 | Bacteria | 2540 |
| 150 | Ga0213876_10017094 | 3300021384 | Bacteria | 3831 |
| 151 | Ga0213876_10089910 | 3300021384 | Bacteria | 1626 |
| 152 | Ga0213875_10001518 | 3300021388 | Bacteria | 14932 |
| 153 | Ga0213875_10004855 | 3300021388 | Bacteria | 7301 |
| 154 | Ga0213875_10038934 | 3300021388 | Bacteria | 2240 |
| 155 | Ga0213875_10053238 | 3300021388 | Bacteria | 1895 |
| 156 | Ga0213875_10214024 | 3300021388 | Bacteria | 907 |
| 157 | Ga0213875_10273218 | 3300021388 | Bacteria | 798 |
| 158 | Ga0224572_1003639 | 3300024225 | Bacteria | 2619 |
| 159 | Ga0224572_1025107 | 3300024225 | Bacteria | 1144 |
| 160 | Ga0207682_10000012 | 3300025893 | Bacteria | 84521 |
| 161 | Ga0207692_10001357 | 3300025898 | Bacteria | 9136 |
| 162 | Ga0207692_10001832 | 3300025898 | Bacteria | 8072 |
| 163 | Ga0207692_10020312 | 3300025898 | Bacteria | 3018 |
| 164 | Ga0207692_10124225 | 3300025898 | Bacteria | 1449 |
| 165 | Ga0207692_10150251 | 3300025898 | Bacteria | 1333 |
| 166 | Ga0207680_10004600 | 3300025903 | Bacteria | 6548 |
| 167 | Ga0207685_10000141 | 3300025905 | Bacteria | 10686 |
| 168 | Ga0207699_10002220 | 3300025906 | Bacteria | 9160 |
| 169 | Ga0207699_10004654 | 3300025906 | Bacteria | 6565 |
| 170 | Ga0207699_10006547 | 3300025906 | Bacteria | 5649 |
| 171 | Ga0207699_10058573 | 3300025906 | Bacteria | 2304 |
| 172 | Ga0207705_10032208 | 3300025909 | Bacteria | 3745 |
| 173 | Ga0207684_10001155 | 3300025910 | Bacteria | 29461 |
| 174 | Ga0207684_10077001 | 3300025910 | Bacteria | 2835 |
| 175 | Ga0207684_10157249 | 3300025910 | Bacteria | 1956 |
| 176 | Ga0207654_10014748 | 3300025911 | Bacteria | 4042 |
| 177 | Ga0207707_10036623 | 3300025912 | Bacteria | 4289 |
| 178 | Ga0207707_10390735 | 3300025912 | Bacteria | 1195 |
| 179 | Ga0207695_10023117 | 3300025913 | Bacteria | 7035 |
| 180 | Ga0207671_10000816 | 3300025914 | Bacteria | 39430 |
| 181 | Ga0207693_10002447 | 3300025915 | Bacteria | 16123 |
| 182 | Ga0207693_10006701 | 3300025915 | Bacteria | 9510 |
| 183 | Ga0207693_10012999 | 3300025915 | Bacteria | 6716 |
| 184 | Ga0207693_10021261 | 3300025915 | Bacteria | 5156 |
| 185 | Ga0207693_10046995 | 3300025915 | Bacteria | 3392 |
| 186 | Ga0207693_10129730 | 3300025915 | Bacteria | 1982 |
| 187 | Ga0207693_10242932 | 3300025915 | Bacteria | 1413 |
| 188 | Ga0207693_10306332 | 3300025915 | Bacteria | 1244 |
| 189 | Ga0207693_10331510 | 3300025915 | Bacteria | 1191 |
| 190 | Ga0207663_10001744 | 3300025916 | Bacteria | 10227 |
| 191 | Ga0207663_10002264 | 3300025916 | Bacteria | 9213 |
| 192 | Ga0207663_10004959 | 3300025916 | Bacteria | 6666 |
| 193 | Ga0207663_10095333 | 3300025916 | Bacteria | 1985 |
| 194 | Ga0207663_10141969 | 3300025916 | Bacteria | 1674 |
| 195 | Ga0207663_10144505 | 3300025916 | Bacteria | 1661 |
| 196 | Ga0207649_10134717 | 3300025920 | Bacteria | 1683 |
| 197 | Ga0207646_10072741 | 3300025922 | Bacteria | 3070 |
| 198 | Ga0207694_10006139 | 3300025924 | Bacteria | 9177 |
| 199 | Ga0207700_10004453 | 3300025928 | Bacteria | 8260 |
| 200 | Ga0207700_10010978 | 3300025928 | Bacteria | 5752 |
| 201 | Ga0207700_10016766 | 3300025928 | Bacteria | 4877 |
| 202 | Ga0207700_10030966 | 3300025928 | Bacteria | 3795 |
| 203 | Ga0207700_10038144 | 3300025928 | Bacteria | 3485 |
| 204 | Ga0207700_10040897 | 3300025928 | Bacteria | 3387 |
| 205 | Ga0207700_10069710 | 3300025928 | Bacteria | 2700 |
| 206 | Ga0207700_10070078 | 3300025928 | Bacteria | 2694 |
| 207 | Ga0207700_10100569 | 3300025928 | Unclassified | 2305 |
| 208 | Ga0207700_10133768 | 3300025928 | Bacteria | 2028 |
| 209 | Ga0207700_10165225 | 3300025928 | Bacteria | 1841 |
| 210 | Ga0207700_10232288 | 3300025928 | Bacteria | 1569 |
| 211 | Ga0207700_10238301 | 3300025928 | Bacteria | 1549 |
| 212 | Ga0207700_10271590 | 3300025928 | Bacteria | 1455 |
| 213 | Ga0207700_10334828 | 3300025928 | Bacteria | 1314 |
| 214 | Ga0207664_10002017 | 3300025929 | Bacteria | 13371 |
| 215 | Ga0207664_10014150 | 3300025929 | Bacteria | 5753 |
| 216 | Ga0207664_10014922 | 3300025929 | Bacteria | 5624 |
| 217 | Ga0207664_10028825 | 3300025929 | Bacteria | 4222 |
| 218 | Ga0207664_10033567 | 3300025929 | Bacteria | 3943 |
| 219 | Ga0207664_10040268 | 3300025929 | Bacteria | 3632 |
| 220 | Ga0207664_10044933 | 3300025929 | Bacteria | 3461 |
| 221 | Ga0207664_10051540 | 3300025929 | Bacteria | 3250 |
| 222 | Ga0207664_10057613 | 3300025929 | Bacteria | 3089 |
| 223 | Ga0207664_10066448 | 3300025929 | Bacteria | 2891 |
| 224 | Ga0207664_10067781 | 3300025929 | Bacteria | 2865 |
| 225 | Ga0207664_10090751 | 3300025929 | Bacteria | 2504 |
| 226 | Ga0207664_10347151 | 3300025929 | Bacteria | 1313 |
| 227 | Ga0207664_10479262 | 3300025929 | Bacteria | 1113 |
| 228 | Ga0207664_10506803 | 3300025929 | Bacteria | 1081 |
| 229 | Ga0207665_10004714 | 3300025939 | Bacteria | 9055 |
| 230 | Ga0207665_10013433 | 3300025939 | Bacteria | 5384 |
| 231 | Ga0207711_10004985 | 3300025941 | Bacteria | 11263 |
| 232 | Ga0207711_10062925 | 3300025941 | Bacteria | 3202 |
| 233 | Ga0207689_10099692 | 3300025942 | Bacteria | 2387 |
| 234 | Ga0207689_10243185 | 3300025942 | Bacteria | 1488 |
| 235 | Ga0207661_10012244 | 3300025944 | Bacteria | 6232 |
| 236 | Ga0207661_10028961 | 3300025944 | Bacteria | 4248 |
| 237 | Ga0207661_10120752 | 3300025944 | Bacteria | 2230 |
| 238 | Ga0207679_10039166 | 3300025945 | Bacteria | 3383 |
| 239 | Ga0207667_10070912 | 3300025949 | Bacteria | 3625 |
| 240 | Ga0207712_10042223 | 3300025961 | Bacteria | 3139 |
| 241 | Ga0207703_10025241 | 3300026035 | Bacteria | 4674 |
| 242 | Ga0207639_10170036 | 3300026041 | Bacteria | 1845 |
| 243 | Ga0207702_10008511 | 3300026078 | Bacteria | 8649 |
| 244 | Ga0207702_10144455 | 3300026078 | Bacteria | 2157 |
| 245 | Ga0207641_10063829 | 3300026088 | Bacteria | 3147 |
| 246 | Ga0207641_10105419 | 3300026088 | Bacteria | 2490 |
| 247 | Ga0207641_10381739 | 3300026088 | Bacteria | 1349 |
| 248 | Ga0207676_10168118 | 3300026095 | Bacteria | 1908 |
| 249 | Ga0207674_10073930 | 3300026116 | Bacteria | 3421 |
| 250 | Ga0207674_10216959 | 3300026116 | Bacteria | 1861 |
| 251 | Ga0207698_10055112 | 3300026142 | Bacteria | 3062 |
| 252 | Ga0268266_10000715 | 3300028379 | Bacteria | 44804 |
| 253 | Ga0268266_10019465 | 3300028379 | Bacteria | 5782 |
| 254 | Ga0268266_10145281 | 3300028379 | Bacteria | 2132 |
| 255 | Ga0268266_10476447 | 3300028379 | Bacteria | 1189 |
| 256 | Ga0268265_10000015 | 3300028380 | Bacteria | 322854 |
| 257 | Ga0268264_10035620 | 3300028381 | Bacteria | 4097 |
| 258 | Ga0265337_1000279 | 3300028556 | Bacteria | 27809 |
| 259 | Ga0265337_1001875 | 3300028556 | Bacteria | 10026 |
| 260 | Ga0265326_10000533 | 3300028558 | Bacteria | 14447 |
| 261 | Ga0265326_10005497 | 3300028558 | Bacteria | 3995 |
| 262 | Ga0265319_1000741 | 3300028563 | Bacteria | 21267 |
| 263 | Ga0265319_1001077 | 3300028563 | Bacteria | 16964 |
| 264 | Ga0265334_10000292 | 3300028573 | Bacteria | 27991 |
| 265 | Ga0265334_10003283 | 3300028573 | Bacteria | 7383 |
| 266 | Ga0265318_10028768 | 3300028577 | Bacteria | 2170 |
| 267 | Ga0265318_10067264 | 3300028577 | Bacteria | 1330 |
| 268 | Ga0265323_10001007 | 3300028653 | Bacteria | 14691 |
| 269 | Ga0265323_10018964 | 3300028653 | Bacteria | 2658 |
| 270 | Ga0265322_10002610 | 3300028654 | Bacteria | 5538 |
| 271 | Ga0265336_10001849 | 3300028666 | Bacteria | 9197 |
| 272 | Ga0265336_10004242 | 3300028666 | Bacteria | 5453 |
| 273 | Ga0307515_10001780 | 3300028794 | Bacteria | 47995 |
| 274 | Ga0307515_10068192 | 3300028794 | Bacteria | 4892 |
| 275 | Ga0265338_10001313 | 3300028800 | Bacteria | 40731 |
| 276 | Ga0265338_10002068 | 3300028800 | Bacteria | 30992 |
| 277 | Ga0265338_10003087 | 3300028800 | Bacteria | 23899 |
| 278 | Ga0265324_10000826 | 3300029957 | Bacteria | 20096 |
| 279 | Ga0265324_10003928 | 3300029957 | Bacteria | 6898 |
| 280 | Ga0307512_10001804 | 3300030522 | Bacteria | 28918 |
| 281 | Ga0307512_10029868 | 3300030522 | Bacteria | 4751 |
| 282 | Ga0265760_10054501 | 3300031090 | Bacteria | 1208 |
| 283 | Ga0265332_10000688 | 3300031238 | Bacteria | 21619 |
| 284 | Ga0265332_10001644 | 3300031238 | Bacteria | 12207 |
| 285 | Ga0265320_10000591 | 3300031240 | Bacteria | 27892 |
| 286 | Ga0265320_10010036 | 3300031240 | Bacteria | 5661 |
| 287 | Ga0265325_10005697 | 3300031241 | Bacteria | 7658 |
| 288 | Ga0265325_10008122 | 3300031241 | Bacteria | 6218 |
| 289 | Ga0265340_10000611 | 3300031247 | Bacteria | 19983 |
| 290 | Ga0265340_10007717 | 3300031247 | Bacteria | 5834 |
| 291 | Ga0265340_10009127 | 3300031247 | Bacteria | 5332 |
| 292 | Ga0265340_10068978 | 3300031247 | Bacteria | 1678 |
| 293 | Ga0265339_10005617 | 3300031249 | Bacteria | 8325 |
| 294 | Ga0265316_10005669 | 3300031344 | Bacteria | 12084 |
| 295 | Ga0265316_10066740 | 3300031344 | Bacteria | 2783 |
| 296 | Ga0307513_10036048 | 3300031456 | Bacteria | 5527 |
| 297 | Ga0307513_10178032 | 3300031456 | Bacteria | 1994 |
| 298 | Ga0307513_10181284 | 3300031456 | Bacteria | 1969 |
| 299 | Ga0307509_10005853 | 3300031507 | Bacteria | 16868 |
| 300 | Ga0307408_100571318 | 3300031548 | Bacteria | 1001 |
| 301 | Ga0265313_10002273 | 3300031595 | Bacteria | 16850 |
| 302 | Ga0265313_10019494 | 3300031595 | Bacteria | 3771 |
| 303 | Ga0307508_10008069 | 3300031616 | Bacteria | 9765 |
| 304 | Ga0307508_10283228 | 3300031616 | Bacteria | 1251 |
| 305 | Ga0265314_10002719 | 3300031711 | Bacteria | 17696 |
| 306 | Ga0265314_10029362 | 3300031711 | Bacteria | 4088 |
| 307 | Ga0265342_10003526 | 3300031712 | Bacteria | 12800 |
| 308 | Ga0265342_10010569 | 3300031712 | Bacteria | 6386 |
| 309 | Ga0307405_10006726 | 3300031731 | Bacteria | 5682 |
| 310 | Ga0307413_10186880 | 3300031824 | Bacteria | 1483 |
| 311 | Ga0307413_10269572 | 3300031824 | Bacteria | 1274 |
| 312 | Ga0307413_10322756 | 3300031824 | Bacteria | 1180 |
| 313 | Ga0307518_10048166 | 3300031838 | Bacteria | 3098 |
| 314 | Ga0307406_10005437 | 3300031901 | Bacteria | 6971 |
| 315 | Ga0307406_10098309 | 3300031901 | Bacteria | 1987 |
| 316 | Ga0307406_10308898 | 3300031901 | Bacteria | 1218 |
| 317 | Ga0307412_10035372 | 3300031911 | Bacteria | 3191 |
| 318 | Ga0307409_100000113 | 3300031995 | Bacteria | 29745 |
| 319 | Ga0307416_100327628 | 3300032002 | Bacteria | 1537 |
| 320 | Ga0307416_100498419 | 3300032002 | Bacteria | 1282 |
| 321 | Ga0307416_100519096 | 3300032002 | Bacteria | 1259 |
| 322 | Ga0307411_10692252 | 3300032005 | Bacteria | 887 |
| 323 | Ga0307415_100000026 | 3300032126 | Bacteria | 62017 |
| 324 | Ga0307415_100320764 | 3300032126 | Bacteria | 1292 |
| 325 | Ga0307415_100592894 | 3300032126 | Bacteria | 985 |
| 326 | Ga0307507_10021177 | 3300033179 | Bacteria | 7250 |
| 327 | Ga0307507_10122475 | 3300033179 | Bacteria | 2074 |
| 328 | Ga0316215_1005851 | 3300033544 | Bacteria | 1189 |
| 329 | Ga0316214_1005087 | 3300033545 | Bacteria | 1714 |
| 330 | Ga0316214_1009529 | 3300033545 | Bacteria | 1311 |
| 331 | Ga0316212_1010630 | 3300033547 | Bacteria | 1320 |
| 332 | Ga0373926_0024770 | 3300035083 | Bacteria | 2091 |
| 333 | Ga0373929_0004862 | 3300035085 | Bacteria | 2408 |
| 334 | Ga0373934_0000111 | 3300035086 | Bacteria | 29169 |
| 335 | Ga0373934_0038433 | 3300035086 | Bacteria | 1885 |
| 336 | Ga0373940_0045295 | 3300035088 | Bacteria | 1221 |
| 337 | Ga0373951_0008124 | 3300035091 | Bacteria | 2379 |
| 338 | Ga0373923_0029502 | 3300035111 | Bacteria | 2200 |
| 339 | Ga0373923_0053846 | 3300035111 | Bacteria | 1692 |
| 340 | Ga0373936_0024986 | 3300035113 | Bacteria | 2335 |
| 341 | Ga0373939_0026379 | 3300035114 | Bacteria | 1637 |
| 342 | Ga0373945_0049689 | 3300035116 | Bacteria | 1539 |
| 343 | Ga0373953_0000880 | 3300035117 | Bacteria | 8410 |
| 344 | Ga0373953_0004946 | 3300035117 | Bacteria | 4289 |
| 345 | Ga0373953_0025929 | 3300035117 | Bacteria | 2243 |
| 346 | Ga0373953_0030819 | 3300035117 | Bacteria | 2082 |
| 347 | Ga0373954_0120255 | 3300035118 | Bacteria | 1274 |
| 348 | Ga0373956_0001515 | 3300035119 | Bacteria | 9598 |
| 349 | Ga0373956_0008097 | 3300035119 | Bacteria | 4253 |
| 350 | Ga0373956_0044340 | 3300035119 | Bacteria | 1982 |
| 351 | Ga0373956_0057772 | 3300035119 | Bacteria | 1754 |
| 352 | Ga0373956_0172623 | 3300035119 | Bacteria | 1021 |
| 353 | Ga0373956_0281555 | 3300035119 | Bacteria | 791 |
| 354 | Ga0373957_0004429 | 3300035120 | Bacteria | 4274 |
| 355 | Ga0373957_0005016 | 3300035120 | Bacteria | 4082 |
| 356 | Ga0373960_0002032 | 3300035121 | Bacteria | 4551 |
| 357 | Ga0373943_0024193 | 3300035170 | Bacteria | 2830 |
| 358 | Ga0373946_0050763 | 3300035171 | Bacteria | 1733 |
| 359 | Ga0373955_0001442 | 3300035172 | Bacteria | 10103 |
| 360 | Ga0373955_0009346 | 3300035172 | Bacteria | 4589 |
| 361 | Ga0373955_0307893 | 3300035172 | Bacteria | 956 |
| 362 | Ga0373942_0094040 | 3300035207 | Bacteria | 907 |
| 363 | Ga0373961_0003194 | 3300035241 | Bacteria | 4091 |
| 364 | Ga0373962_0005094 | 3300035242 | Bacteria | 3175 |
| 365 | Ga0373962_0005435 | 3300035242 | Bacteria | 3084 |
| 366 | Ga0373924_0002893 | 3300035410 | Bacteria | 5816 |
| 367 | Ga0373924_0149176 | 3300035410 | Bacteria | 1022 |
| 368 | Ga0373931_0003534 | 3300035691 | Bacteria | 7046 |
| 369 | Ga0373935_0006968 | 3300035692 | Bacteria | 6748 |
| 370 | Ga0373935_0014756 | 3300035692 | Bacteria | 4716 |
| 371 | Ga0373935_0150696 | 3300035692 | Bacteria | 1578 |
| 372 | Ga0373935_0326632 | 3300035692 | Bacteria | 1090 |
| 373 | Ga0373927_0551225 | 3300035695 | Bacteria | 762 |
| 374 | Ga0373933_0000358 | 3300035724 | Bacteria | 29171 |
| 375 | Ga0373933_0007543 | 3300035724 | Bacteria | 5945 |
| 376 | Ga0373933_0031339 | 3300035724 | Bacteria | 3084 |
| 377 | Ga0373933_0148378 | 3300035724 | Bacteria | 1484 |
| 378 | Ga0373947_0074452 | 3300035725 | Bacteria | 2089 |
| 379 | Ga0373947_0075650 | 3300035725 | Bacteria | 2073 |
| 380 | Ga0373947_0279417 | 3300035725 | Bacteria | 1110 |
| 381 | Ga0373937_0000703 | 3300036401 | Bacteria | 29180 |
| 382 | Ga0373937_0002308 | 3300036401 | Bacteria | 15936 |
| 383 | Ga0373937_0028895 | 3300036401 | Bacteria | 5021 |
| 384 | Ga0373937_0123640 | 3300036401 | Bacteria | 2412 |
| 385 | Ga0373937_0129587 | 3300036401 | Bacteria | 2355 |
| 386 | Ga0373937_0143877 | 3300036401 | Bacteria | 2231 |
| 387 | Ga0373937_0215151 | 3300036401 | Bacteria | 1808 |
| 388 | Ga0372808_000712 | 3300036459 | Bacteria | 2918 |
| 389 | Ga0372808_001246 | 3300036459 | Bacteria | 2565 |
| 390 | Ga0372808_007114 | 3300036459 | Bacteria | 1525 |
| 391 | Ga0372808_014509 | 3300036459 | Bacteria | 1125 |
| 392 | Ga0372808_014827 | 3300036459 | Bacteria | 1113 |
| 393 | Ga0373925_0000041 | 3300037068 | Bacteria | 137281 |
| 394 | Ga0373925_0030235 | 3300037068 | Bacteria | 3975 |
| 395 | Ga0373925_0040701 | 3300037068 | Bacteria | 3442 |
| 396 | Ga0373925_0044464 | 3300037068 | Bacteria | 3297 |
| 397 | Ga0395900_0588854 | 3300037418 | Bacteria | 1054 |
| 398 | Ga0395900_0863152 | 3300037418 | Bacteria | 830 |
| 399 | Ga0395898_0369244 | 3300037466 | Bacteria | 1368 |
| 400 | Ga0395898_0662846 | 3300037466 | Bacteria | 986 |
| 401 | Ga0436364_0059581 | 3300037853 | Bacteria | 1230 |
| 402 | Ga0436364_0154658 | 3300037853 | Bacteria | 22988 |
| 403 | Ga0436364_0165739 | 3300037853 | Bacteria | 1476 |
| 404 | Ga0436364_0580721 | 3300037853 | Bacteria | 2339 |
| 405 | Ga0436364_0785455 | 3300037853 | Bacteria | 1426 |
| 406 | Ga0436364_0898752 | 3300037853 | Bacteria | 2677 |
| 407 | Ga0436364_0993389 | 3300037853 | Bacteria | 4041 |
| 408 | Ga0436364_1242135 | 3300037853 | Bacteria | 1028 |
| 409 | Ga0436364_1544583 | 3300037853 | Bacteria | 2155 |
| 410 | Ga0395901_0378590 | 3300038443 | Bacteria | 1457 |
| 411 | Ga0242420_006594 | 3300038996 | Bacteria | 1839 |
| 412 | Ga0436365_0103846 | 3300039437 | Bacteria | 7931 |
| 413 | Ga0436365_0304993 | 3300039437 | Bacteria | 3234 |
| 414 | Ga0436365_0439231 | 3300039437 | Bacteria | 18529 |
| 415 | Ga0436365_0512239 | 3300039437 | Bacteria | 4445 |
| 416 | Ga0436363_0425661 | 3300039450 | Bacteria | 9513 |
| 417 | Ga0436363_0872421 | 3300039450 | Bacteria | 1345 |
| 418 | Ga0436363_1171956 | 3300039450 | Bacteria | 1950 |
| 419 | Ga0451835_0897398 | 3300041492 | Bacteria | 1317 |
| 420 | Ga0451853_0372355 | 3300041512 | Bacteria | 3786 |
| 421 | Ga0466969_0004127 | 3300044656 | Bacteria | 7710 |
| 422 | Ga0466969_0017275 | 3300044656 | Bacteria | 3770 |
| 423 | Ga0466969_0103023 | 3300044656 | Bacteria | 1342 |
| 424 | Ga0466966_0122462 | 3300044684 | Bacteria | 1597 |
| 425 | Ga0466966_0139922 | 3300044684 | Bacteria | 1479 |
| 426 | Ga0466966_0156493 | 3300044684 | Bacteria | 1388 |
| 427 | Ga0466961_0334322 | 3300044693 | Bacteria | 923 |
| 428 | Ga0466963_0002213 | 3300044694 | Bacteria | 10756 |
| 429 | Ga0466963_0097722 | 3300044694 | Bacteria | 2006 |
| 430 | Ga0466964_0063558 | 3300044706 | Bacteria | 1542 |
| 431 | Ga0466971_0017933 | 3300044719 | Bacteria | 3135 |
| 432 | Ga0466968_0174056 | 3300044735 | Bacteria | 998 |
| 433 | Ga0466970_0024799 | 3300044765 | Bacteria | 3137 |
| 434 | Ga0466957_0069478 | 3300044842 | Bacteria | 2176 |
| 435 | Ga0466957_0089202 | 3300044842 | Bacteria | 1930 |
| 436 | Ga0466957_0283855 | 3300044842 | Bacteria | 1109 |
| 437 | Ga0466959_0000352 | 3300045049 | Bacteria | 27249 |
| 438 | Ga0466959_0071059 | 3300045049 | Bacteria | 2521 |
| 439 | Ga0466959_0075538 | 3300045049 | Bacteria | 2434 |
| 440 | Ga0466959_0132778 | 3300045049 | Bacteria | 1764 |
| 441 | Ga0466959_0189928 | 3300045049 | Bacteria | 1434 |
| 442 | Ga0466958_0000550 | 3300045836 | Bacteria | 15964 |
| 443 | Ga0466958_0001732 | 3300045836 | Bacteria | 10547 |
| 444 | Ga0466958_0070704 | 3300045836 | Bacteria | 2136 |
| 445 | Ga0466958_0209387 | 3300045836 | Bacteria | 1242 |
| 446 | Ga0466967_0001582 | 3300045976 | Bacteria | 13376 |
| 447 | Ga0466967_0228786 | 3300045976 | Bacteria | 1770 |
| 448 | Ga0495592_0000483 | 3300046454 | Bacteria | 29089 |
| 449 | Ga0495592_0030186 | 3300046454 | Bacteria | 4100 |
| 450 | Ga0495592_0109232 | 3300046454 | Bacteria | 1959 |
| 451 | Ga0495592_0281057 | 3300046454 | Bacteria | 1088 |
| 452 | Ga0495629_0011203 | 3300046459 | Bacteria | 6512 |
| 453 | Ga0495629_0164300 | 3300046459 | Bacteria | 1542 |
| 454 | Ga0495641_0007602 | 3300046461 | Bacteria | 6744 |
| 455 | Ga0495651_0000542 | 3300046462 | Bacteria | 29179 |
| 456 | Ga0495651_0039447 | 3300046462 | Bacteria | 3676 |
| 457 | Ga0495651_0060196 | 3300046462 | Bacteria | 2909 |
| 458 | Ga0495651_0066345 | 3300046462 | Bacteria | 2755 |
| 459 | Ga0495651_0163480 | 3300046462 | Bacteria | 1592 |
| 460 | Ga0495653_0003360 | 3300046463 | Bacteria | 12863 |
| 461 | Ga0495653_0033254 | 3300046463 | Bacteria | 4087 |
| 462 | Ga0495653_0048513 | 3300046463 | Bacteria | 3277 |
| 463 | Ga0495653_0106622 | 3300046463 | Bacteria | 2020 |
| 464 | Ga0495580_0057069 | 3300046472 | Bacteria | 2748 |
| 465 | Ga0495582_0014877 | 3300046473 | Bacteria | 4275 |
| 466 | Ga0495582_0096130 | 3300046473 | Bacteria | 1655 |
| 467 | Ga0495639_0045211 | 3300046475 | Bacteria | 1992 |
| 468 | Ga0495639_0286957 | 3300046475 | Bacteria | 819 |
| 469 | Ga0495662_0002848 | 3300046476 | Bacteria | 8751 |
| 470 | Ga0495662_0074632 | 3300046476 | Bacteria | 1645 |
| 471 | Ga0495664_0018598 | 3300046477 | Bacteria | 3984 |
| 472 | Ga0495664_0029488 | 3300046477 | Bacteria | 3209 |
| 473 | Ga0495664_0095707 | 3300046477 | Bacteria | 1787 |
| 474 | Ga0495594_0063441 | 3300046499 | Bacteria | 2047 |
| 475 | Ga0495608_0004453 | 3300046511 | Bacteria | 10027 |
| 476 | Ga0495608_0013972 | 3300046511 | Bacteria | 5569 |
| 477 | Ga0495608_0017138 | 3300046511 | Bacteria | 5014 |
| 478 | Ga0495608_0024944 | 3300046511 | Bacteria | 4086 |
| 479 | Ga0495608_0219074 | 3300046511 | Bacteria | 1194 |
| 480 | Ga0495618_0035439 | 3300046514 | Bacteria | 3131 |
| 481 | Ga0495618_0050938 | 3300046514 | Bacteria | 2616 |
| 482 | Ga0495618_0097010 | 3300046514 | Bacteria | 1885 |
| 483 | Ga0495618_0184311 | 3300046514 | Bacteria | 1325 |
| 484 | Ga0495628_0006726 | 3300046516 | Bacteria | 10019 |
| 485 | Ga0495628_0091170 | 3300046516 | Bacteria | 2359 |
| 486 | Ga0495628_0186914 | 3300046516 | Bacteria | 1565 |
| 487 | Ga0495630_0050986 | 3300046517 | Bacteria | 3096 |
| 488 | Ga0495630_0193297 | 3300046517 | Bacteria | 1552 |
| 489 | Ga0495666_0015013 | 3300046526 | Bacteria | 3855 |
| 490 | Ga0495652_0032522 | 3300046529 | Bacteria | 4561 |
| 491 | Ga0495652_0045024 | 3300046529 | Bacteria | 3797 |
| 492 | Ga0495652_0181182 | 3300046529 | Bacteria | 1616 |
| 493 | Ga0495652_0199846 | 3300046529 | Bacteria | 1518 |
| 494 | Ga0495665_0026677 | 3300046531 | Bacteria | 3102 |
| 495 | Ga0495665_0109835 | 3300046531 | Bacteria | 1446 |
| 496 | Ga0495640_0046911 | 3300046533 | Bacteria | 2991 |
| 497 | Ga0495640_0088012 | 3300046533 | Bacteria | 2053 |
| 498 | Ga0495586_0046516 | 3300046535 | Bacteria | 2339 |
| 499 | Ga0495587_0000440 | 3300046536 | Bacteria | 29136 |
| 500 | Ga0495587_0044100 | 3300046536 | Bacteria | 2653 |
| 501 | Ga0495587_0058698 | 3300046536 | Bacteria | 2260 |
| 502 | Ga0495587_0395235 | 3300046536 | Bacteria | 768 |
| 503 | Ga0495645_0027726 | 3300046543 | Bacteria | 4114 |
| 504 | Ga0495645_0030498 | 3300046543 | Bacteria | 3927 |
| 505 | Ga0495645_0225272 | 3300046543 | Bacteria | 1259 |
| 506 | Ga0495645_0382363 | 3300046543 | Bacteria | 900 |
| 507 | Ga0495645_0386299 | 3300046543 | Bacteria | 894 |
| 508 | Ga0495667_0000437 | 3300046559 | Bacteria | 26662 |
| 509 | Ga0495667_0007631 | 3300046559 | Bacteria | 7339 |
| 510 | Ga0495667_0015460 | 3300046559 | Bacteria | 5156 |
| 511 | Ga0495667_0123595 | 3300046559 | Bacteria | 1670 |
| 512 | Ga0495667_0124511 | 3300046559 | Bacteria | 1663 |
| 513 | Ga0495667_0351140 | 3300046559 | Bacteria | 931 |
| 514 | Ga0495634_0010227 | 3300046642 | Bacteria | 6879 |
| 515 | Ga0495634_0077665 | 3300046642 | Bacteria | 2177 |
| 516 | Ga0495634_0384824 | 3300046642 | Bacteria | 835 |
| 517 | Ga0495625_0000323 | 3300046660 | Bacteria | 72852 |
| 518 | Ga0495635_0054935 | 3300046663 | Bacteria | 2743 |
| 519 | Ga0495635_0071929 | 3300046663 | Bacteria | 2370 |
| 520 | Ga0495635_0429835 | 3300046663 | Bacteria | 875 |
| 521 | Ga0495588_0113563 | 3300046674 | Bacteria | 1427 |
| 522 | Ga0495657_0000776 | 3300046675 | Bacteria | 28391 |
| 523 | Ga0495657_0059344 | 3300046675 | Bacteria | 2537 |
| 524 | Ga0495657_0157351 | 3300046675 | Bacteria | 1407 |
| 525 | Ga0495599_0044698 | 3300046678 | Bacteria | 2777 |
| 526 | Ga0495599_0077009 | 3300046678 | Bacteria | 2082 |
| 527 | Ga0495599_0293015 | 3300046678 | Bacteria | 983 |
| 528 | Ga0495623_0000376 | 3300046679 | Bacteria | 29151 |
| 529 | Ga0495623_0066807 | 3300046679 | Bacteria | 2245 |
| 530 | Ga0495623_0261942 | 3300046679 | Bacteria | 968 |
| 531 | Ga0495623_0303448 | 3300046679 | Bacteria | 881 |
| 532 | Ga0495646_0038112 | 3300046680 | Bacteria | 2969 |
| 533 | Ga0495646_0064509 | 3300046680 | Bacteria | 2171 |
| 534 | Ga0495646_0098486 | 3300046680 | Bacteria | 1679 |
| 535 | Ga0495646_0099433 | 3300046680 | Bacteria | 1670 |
| 536 | Ga0495647_0141376 | 3300046681 | Bacteria | 1026 |
| 537 | Ga0495658_0025229 | 3300046683 | Bacteria | 3175 |
| 538 | Ga0495658_0053384 | 3300046683 | Bacteria | 2295 |
| 539 | Ga0495613_0014394 | 3300046689 | Bacteria | 5871 |
| 540 | Ga0495613_0101876 | 3300046689 | Bacteria | 2073 |
| 541 | Ga0495613_0141871 | 3300046689 | Bacteria | 1716 |
| 542 | Ga0495624_0016119 | 3300046690 | Bacteria | 5032 |
| 543 | Ga0495624_0162574 | 3300046690 | Bacteria | 1364 |
| 544 | Ga0495624_0253994 | 3300046690 | Bacteria | 1063 |
| 545 | Ga0495624_0310894 | 3300046690 | Bacteria | 949 |
| 546 | Ga0495600_0002787 | 3300046809 | Bacteria | 10144 |
| 547 | Ga0495600_0014584 | 3300046809 | Bacteria | 4953 |
| 548 | Ga0495600_0020053 | 3300046809 | Bacteria | 4275 |
| 549 | Ga0495600_0035497 | 3300046809 | Bacteria | 3238 |
| 550 | Ga0495581_0009163 | 3300047315 | Bacteria | 5727 |
| 551 | Ga0495581_0046324 | 3300047315 | Bacteria | 2512 |
| 552 | Ga0495604_0000664 | 3300047317 | Bacteria | 29179 |
| 553 | Ga0495604_0018564 | 3300047317 | Bacteria | 5572 |
| 554 | Ga0495604_0107044 | 3300047317 | Bacteria | 2044 |
| 555 | Ga0495604_0187253 | 3300047317 | Bacteria | 1444 |
| 556 | Ga0495604_0191698 | 3300047317 | Bacteria | 1424 |
| 557 | Ga0495674_0020938 | 3300047319 | Bacteria | 6052 |
| 558 | Ga0495674_0030922 | 3300047319 | Bacteria | 4865 |
| 559 | Ga0495674_0070381 | 3300047319 | Bacteria | 3023 |
| 560 | Ga0495674_0103882 | 3300047319 | Bacteria | 2416 |
| 561 | Ga0495674_0150399 | 3300047319 | Bacteria | 1952 |
| 562 | Ga0495676_0120075 | 3300047321 | Bacteria | 1913 |
| 563 | Ga0495676_0140124 | 3300047321 | Bacteria | 1734 |
| 564 | Ga0495676_0192511 | 3300047321 | Bacteria | 1422 |
| 565 | Ga0495676_0414730 | 3300047321 | Bacteria | 892 |
| 566 | Ga0495680_0001147 | 3300047322 | Bacteria | 29179 |
| 567 | Ga0495680_0037409 | 3300047322 | Bacteria | 3887 |
| 568 | Ga0495680_0050055 | 3300047322 | Bacteria | 3268 |
| 569 | Ga0495680_0156485 | 3300047322 | Bacteria | 1657 |
| 570 | Ga0495680_0165759 | 3300047322 | Bacteria | 1602 |
| 571 | Ga0495680_0167614 | 3300047322 | Bacteria | 1591 |
| 572 | Ga0495675_0001923 | 3300047444 | Bacteria | 12383 |
| 573 | Ga0495675_0049591 | 3300047444 | Bacteria | 2668 |
| 574 | Ga0495675_0055205 | 3300047444 | Bacteria | 2519 |
| 575 | Ga0495675_0156705 | 3300047444 | Bacteria | 1404 |
| 576 | Ga0495684_0012683 | 3300047471 | Bacteria | 6503 |
| 577 | Ga0495684_0043948 | 3300047471 | Bacteria | 3420 |
| 578 | Ga0495684_0313441 | 3300047471 | Bacteria | 1123 |
| 579 | Ga0495684_0488445 | 3300047471 | Bacteria | 849 |
| 580 | Ga0495593_0052536 | 3300047673 | Bacteria | 2154 |
| 581 | Ga0495602_0000872 | 3300048088 | Bacteria | 29136 |
| 582 | Ga0495602_0004455 | 3300048088 | Bacteria | 14611 |
| 583 | Ga0495602_0061723 | 3300048088 | Bacteria | 3256 |
| 584 | Ga0495602_0094950 | 3300048088 | Bacteria | 2463 |
| 585 | Ga0495602_0159171 | 3300048088 | Bacteria | 1765 |
| 586 | Ga0495602_0349191 | 3300048088 | Bacteria | 1068 |
| 587 | Ga0495602_0518279 | 3300048088 | Bacteria | 831 |
| 588 | Ga0495614_0068895 | 3300048089 | Bacteria | 1523 |
| 589 | Ga0496100_0007870 | 3300048903 | Bacteria | 5917 |
| 590 | Ga0496101_0007048 | 3300048904 | Bacteria | 7266 |
| 591 | Ga0496101_0659085 | 3300048904 | Bacteria | 827 |
| 592 | Ga0496102_0000546 | 3300048905 | Bacteria | 40572 |
| 593 | Ga0496102_0077224 | 3300048905 | Bacteria | 3065 |
| 594 | Ga0496103_0000368 | 3300048906 | Bacteria | 40572 |
| 595 | Ga0496103_0245046 | 3300048906 | Bacteria | 1153 |
| 596 | Ga0496104_0004911 | 3300048907 | Bacteria | 11663 |
| 597 | Ga0496104_0041222 | 3300048907 | Bacteria | 4328 |
| 598 | Ga0496104_0296109 | 3300048907 | Bacteria | 1530 |
| 599 | Ga0496104_0388366 | 3300048907 | Bacteria | 1308 |
| 600 | Ga0496105_0002740 | 3300048908 | Bacteria | 12858 |
| 601 | Ga0496105_0127559 | 3300048908 | Bacteria | 2097 |
| 602 | Ga0496105_0323701 | 3300048908 | Bacteria | 1235 |
| 603 | Ga0496106_0007035 | 3300048909 | Bacteria | 8310 |
| 604 | Ga0496107_0073490 | 3300048910 | Bacteria | 2487 |
| 605 | Ga0496108_0003523 | 3300048911 | Bacteria | 12548 |
| 606 | Ga0496108_0046534 | 3300048911 | Bacteria | 3625 |
| 607 | Ga0496108_0178498 | 3300048911 | Bacteria | 1838 |
| 608 | Ga0496109_0015874 | 3300048912 | Bacteria | 6576 |
| 609 | Ga0496109_0041199 | 3300048912 | Bacteria | 4185 |
| 610 | Ga0496110_0064932 | 3300048913 | Bacteria | 3227 |
| 611 | Ga0496110_0402874 | 3300048913 | Bacteria | 1247 |
| 612 | Ga0496112_0021922 | 3300048915 | Bacteria | 6079 |
| 613 | Ga0496112_0034460 | 3300048915 | Bacteria | 4927 |
| 614 | Ga0496112_0047389 | 3300048915 | Bacteria | 4216 |
| 615 | Ga0496113_0004273 | 3300048916 | Bacteria | 8753 |
| 616 | Ga0496114_0005278 | 3300048917 | Bacteria | 10095 |
| 617 | Ga0496114_0036326 | 3300048917 | Bacteria | 4072 |
| 618 | Ga0496115_0005053 | 3300048918 | Bacteria | 9588 |
| 619 | Ga0496115_0012606 | 3300048918 | Bacteria | 6368 |
| 620 | Ga0496115_0186294 | 3300048918 | Bacteria | 1715 |
| 621 | Ga0496115_0609583 | 3300048918 | Bacteria | 867 |
| 622 | Ga0496117_0020327 | 3300048920 | Bacteria | 5415 |
| 623 | Ga0496118_0020562 | 3300048921 | Bacteria | 5849 |
| 624 | Ga0496124_0029824 | 3300048927 | Bacteria | 4853 |
| 625 | Ga0496126_0031689 | 3300048929 | Bacteria | 4990 |
| 626 | Ga0496126_0160568 | 3300048929 | Bacteria | 1921 |
| 627 | Ga0496126_0170441 | 3300048929 | Bacteria | 1855 |
| 628 | Ga0496126_0407494 | 3300048929 | Bacteria | 1101 |
| 629 | Ga0501031_0003150 | 3300049568 | Bacteria | 10580 |
| 630 | Ga0501031_0080670 | 3300049568 | Bacteria | 2120 |
| 631 | Ga0501032_0001503 | 3300049569 | Bacteria | 18641 |
| 632 | Ga0501032_0068599 | 3300049569 | Bacteria | 2367 |
| 633 | Ga0501032_0136428 | 3300049569 | Bacteria | 1617 |
| 634 | Ga0501033_0004824 | 3300049570 | Bacteria | 10762 |
| 635 | Ga0501034_0015402 | 3300049571 | Bacteria | 7859 |
| 636 | Ga0501034_0150811 | 3300049571 | Bacteria | 2300 |
| 637 | Ga0501036_0009842 | 3300049572 | Bacteria | 7872 |
| 638 | Ga0501036_0547589 | 3300049572 | Bacteria | 962 |
| 639 | Ga0501037_0003839 | 3300049573 | Bacteria | 10912 |
| 640 | Ga0501038_0006610 | 3300049574 | Bacteria | 10726 |
| 641 | Ga0501039_0004345 | 3300049575 | Bacteria | 10689 |
| 642 | Ga0501039_0180541 | 3300049575 | Bacteria | 1660 |
| 643 | Ga0501042_0021761 | 3300049578 | Bacteria | 4472 |
| 644 | Ga0501042_0036688 | 3300049578 | Bacteria | 3478 |
| 645 | Ga0501043_0002854 | 3300049579 | Bacteria | 14430 |
| 646 | Ga0501043_0185311 | 3300049579 | Bacteria | 1621 |
| 647 | Ga0501043_0363048 | 3300049579 | Bacteria | 1099 |
| 648 | Ga0501046_0006075 | 3300049580 | Bacteria | 10745 |
| 649 | Ga0501046_0021033 | 3300049580 | Bacteria | 5388 |
| 650 | Ga0501047_0006595 | 3300049581 | Bacteria | 10924 |
| 651 | Ga0501047_0195148 | 3300049581 | Bacteria | 1887 |
| 652 | Ga0501047_0207306 | 3300049581 | Bacteria | 1820 |
| 653 | Ga0501047_0251262 | 3300049581 | Bacteria | 1616 |
| 654 | Ga0501048_0004454 | 3300049582 | Bacteria | 10658 |
| 655 | Ga0501067_0048865 | 3300049583 | Bacteria | 2345 |
| 656 | Ga0501068_0023427 | 3300049584 | Bacteria | 3618 |
| 657 | Ga0501069_0031935 | 3300049585 | Bacteria | 2898 |
| 658 | Ga0501070_0005358 | 3300049586 | Bacteria | 10945 |
| 659 | Ga0501070_0010354 | 3300049586 | Bacteria | 7882 |
| 660 | Ga0501072_0049870 | 3300049588 | Bacteria | 3295 |
| 661 | Ga0501073_0008885 | 3300049589 | Bacteria | 7428 |
| 662 | Ga0501074_0003906 | 3300049590 | Bacteria | 10615 |
| 663 | Ga0501074_0042042 | 3300049590 | Bacteria | 3308 |
| 664 | Ga0501074_0115390 | 3300049590 | Bacteria | 1921 |
| 665 | Ga0501074_0155962 | 3300049590 | Bacteria | 1631 |
| 666 | Ga0501079_0016604 | 3300049741 | Bacteria | 5622 |
| 667 | Ga0501080_0012286 | 3300049742 | Bacteria | 7845 |
| 668 | Ga0501083_0007590 | 3300049744 | Bacteria | 7684 |
| 669 | Ga0501035_0006695 | 3300049822 | Bacteria | 10768 |
| 670 | Ga0501035_0057657 | 3300049822 | Bacteria | 3462 |
| 671 | Ga0501044_0003535 | 3300049823 | Bacteria | 17595 |
| 672 | Ga0501044_0009251 | 3300049823 | Bacteria | 10759 |
| 673 | Ga0501044_0024307 | 3300049823 | Bacteria | 6435 |
| 674 | Ga0501044_0129597 | 3300049823 | Bacteria | 2517 |
| 675 | Ga0501044_0327596 | 3300049823 | Bacteria | 1455 |
| 676 | Ga0501045_0026473 | 3300049824 | Bacteria | 4172 |
| 677 | nmdc:mga06r32_7823_c1 | 3300050510 | Bacteria | 9608 |
| 678 | nmdc:mga0n895_47552_c1 | 3300050512 | Bacteria | 4195 |
| 679 | nmdc:mga0n895_58859_c1 | 3300050512 | Bacteria | 3790 |
| 680 | nmdc:mga0rr50_4382_c1 | 3300050513 | Bacteria | 8293 |
| 681 | nmdc:mga08x19_184623_c1 | 3300050514 | Bacteria | 1425 |
| 682 | nmdc:mga08x19_76842_c1 | 3300050514 | Bacteria | 2186 |
| 683 | nmdc:mga0a205_126520_c1 | 3300050515 | Bacteria | 2455 |
| 684 | Ga0495601_0032968 | 3300053077 | Bacteria | 3226 |
| 685 | Ga0495601_0295737 | 3300053077 | Bacteria | 1055 |
| 686 | Ga0495612_0009073 | 3300053078 | Bacteria | 4033 |
| 687 | Ga0495612_0009732 | 3300053078 | Bacteria | 3893 |
| 688 | Ga0495595_0027561 | 3300053084 | Bacteria | 2532 |
| 689 | Ga0495595_0033675 | 3300053084 | Bacteria | 2313 |
| 690 | Ga0495595_0102647 | 3300053084 | Bacteria | 1381 |
| 691 | Ga0495619_0024571 | 3300053085 | Bacteria | 3865 |
| 692 | Ga0495619_0028487 | 3300053085 | Bacteria | 3603 |
| 693 | Ga0495619_0240477 | 3300053085 | Bacteria | 1254 |
| 694 | Ga0500646_0000384 | 3300053090 | Bacteria | 13266 |
| 695 | Ga0500646_0000609 | 3300053090 | Bacteria | 10231 |
| 696 | Ga0500646_0005482 | 3300053090 | Bacteria | 3208 |
| 697 | Ga0500583_0029591 | 3300053092 | Bacteria | 2390 |
| 698 | Ga0500651_0133821 | 3300053093 | Bacteria | 1498 |
| 699 | Ga0500641_0245102 | 3300053096 | Bacteria | 753 |
| 700 | Ga0501082_0011327 | 3300060353 | Bacteria | 7665 |
| 701 | 2686538288 | 2684623035 | Bacteria | 8032739 |
| 702 | 2753270282 | 2751185782 | Bacteria | 11227053 |
| 703 | 2753272367 | 2751185782 | Bacteria | 11227053 |
| 704 | 2793982432 | 2791355406 | Bacteria | 11364898 |
| 705 | 2873152461 | 2873151551 | Bacteria | 8625867 |
| 706 | 2880489949 | 2880489317 | Bacteria | 7096270 |
| 707 | 2884699327 | 2884693830 | Bacteria | 11273186 |
| 708 | 2884702153 | 2884693830 | Bacteria | 11273186 |
| 709 | 2891399318 | 2891395885 | Bacteria | 9251614 |
| 710 | 2895445305 | 2895442618 | Bacteria | 11027144 |
| 711 | 2895447490 | 2895442618 | Bacteria | 11027144 |
| 712 | 2895881744 | 2895880812 | Bacteria | 11255272 |
| 713 | 8002785561 | 8002784119 | Bacteria | 9788632 |
| 714 | 8033690794 | 8033684223 | Bacteria | 6906479 |
| 715 | 8047894662 | 8047893842 | Bacteria | 11723082 |
| 716 | 8048364387 | 8048356638 | Bacteria | 11044339 |
| 717 | 8048371681 | 8048369669 | Bacteria | 11666822 |
| 718 | 8048380615 | 8048379754 | Bacteria | 11877923 |
| 719 | 8054733368 | 8054727385 | Bacteria | 7558670 |
| 720 | 8055070785 | 8055066027 | Bacteria | 9479577 |
| 721 | 8055181221 | 8055172936 | Bacteria | 9305943 |
| 722 | Ga0307513_10332481 | |||
| 723 | rootL2_10161055 | |||
| 724 | Ga0070658_10121097 | |||
| 725 | Ga0070683_100003527 | |||
| 726 | Ga0070683_100030232 | |||
| 727 | Ga0070677_10000002 | |||
| 728 | Ga0070682_100161446 | |||
| 729 | Ga0068868_100762264 | |||
| 730 | Ga0070661_100051914 | |||
| 731 | Ga0070661_100080899 | |||
| 732 | Ga0070668_100042584 | |||
| 733 | Ga0070688_100248646 | |||
| 734 | Ga0070667_100010602 | |||
| 735 | Ga0070667_100017131 | |||
| 736 | Ga0070709_10000304 | |||
| 737 | Ga0070709_10008267 | |||
| 738 | Ga0070714_100002439 | |||
| 739 | Ga0070714_100002881 | |||
| 740 | Ga0070714_100006786 | |||
| 741 | Ga0070714_100013384 | |||
| 742 | Ga0070714_100035129 | |||
| 743 | Ga0070714_100047951 | |||
| 744 | Ga0070714_100059771 | |||
| 745 | Ga0070714_100111240 | |||
| 746 | Ga0070714_100168438 | |||
| 747 | Ga0070714_100333487 | |||
| 748 | Ga0070714_100378079 | |||
| 749 | Ga0070714_100670638 | |||
| 750 | Ga0070713_100006687 | |||
| 751 | Ga0070713_100017143 | |||
| 752 | Ga0070713_100036517 | |||
| 753 | Ga0070713_100036914 | |||
| 754 | Ga0070713_100049125 | |||
| 755 | Ga0070713_100080203 | |||
| 756 | Ga0070713_100103397 | |||
| 757 | Ga0070713_100108094 | |||
| 758 | Ga0070713_100121190 | |||
| 759 | Ga0070713_100127687 | |||
| 760 | Ga0070713_100164583 | |||
| 761 | Ga0070713_100166005 | |||
| 762 | Ga0070713_100182093 | |||
| 763 | Ga0070713_100260667 | |||
| 764 | Ga0070713_100354391 | |||
| 765 | Ga0070713_100359433 | |||
| 766 | Ga0070713_100894977 | |||
| 767 | Ga0070710_10006988 | |||
| 768 | Ga0070710_10009828 | |||
| 769 | Ga0070710_10023690 | |||
| 770 | Ga0070710_10051112 | |||
| 771 | Ga0070710_10111385 | |||
| 772 | Ga0070711_100008504 | |||
| 773 | Ga0070711_100018037 | |||
| 774 | Ga0070711_100021516 | |||
| 775 | Ga0070711_100058594 | |||
| 776 | Ga0070711_100073092 | |||
| 777 | Ga0070711_100229739 | |||
| 778 | Ga0070708_100040380 | |||
| 779 | Ga0070708_100437479 | |||
| 780 | Ga0070708_100441292 | |||
| 781 | Ga0070681_10047270 | |||
| 782 | Ga0070681_10121682 | |||
| 783 | Ga0070681_10237534 | |||
| 784 | Ga0070706_100028740 | |||
| 785 | Ga0070706_100040281 | |||
| 786 | Ga0070706_100092397 | |||
| 787 | Ga0070698_100015832 | |||
| 788 | Ga0070698_100097015 | |||
| 789 | Ga0070698_100464257 | |||
| 790 | Ga0070698_100637386 | |||
| 791 | Ga0070699_100527561 | |||
| 792 | Ga0070679_100289461 | |||
| 793 | Ga0070684_100010494 | |||
| 794 | Ga0070684_100044764 | |||
| 795 | Ga0070684_100097776 | |||
| 796 | Ga0070684_100208581 | |||
| 797 | Ga0068853_100056346 | |||
| 798 | Ga0070665_100048757 | |||
| 799 | Ga0070665_100087523 | |||
| 800 | Ga0070665_100244713 | |||
| 801 | Ga0070665_100690699 | |||
| 802 | Ga0068855_100007036 | |||
| 803 | Ga0070664_100034597 | |||
| 804 | Ga0070664_100040038 | |||
| 805 | Ga0070664_100101158 | |||
| 806 | Ga0068857_100071362 | |||
| 807 | Ga0068857_100250736 | |||
| 808 | Ga0068856_100056913 | |||
| 809 | Ga0068856_100183370 | |||
| 810 | Ga0068852_100018248 | |||
| 811 | Ga0068864_100251181 | |||
| 812 | Ga0068864_100412861 | |||
| 813 | Ga0068863_100350809 | |||
| 814 | Ga0068863_100445725 | |||
| 815 | Ga0068858_100023769 | |||
| 816 | Ga0068858_100175232 | |||
| 817 | Ga0068860_100015723 | |||
| 818 | Ga0068862_100000226 | |||
| 819 | Ga0081455_10008990 | |||
| 820 | Ga0081538_10006523 | |||
| 821 | Ga0081539_10000135 | |||
| 822 | Ga0070717_10005799 | |||
| 823 | Ga0070717_10007966 | |||
| 824 | Ga0070717_10013585 | |||
| 825 | Ga0070717_10036856 | |||
| 826 | Ga0070717_10073734 | |||
| 827 | Ga0070717_10105962 | |||
| 828 | Ga0070717_10107587 | |||
| 829 | Ga0070717_10125477 | |||
| 830 | Ga0070717_10127810 | |||
| 831 | Ga0070715_10004858 | |||
| 832 | Ga0070715_10027432 | |||
| 833 | Ga0070715_10068587 | |||
| 834 | Ga0070716_100006515 | |||
| 835 | Ga0070716_100013232 | |||
| 836 | Ga0070712_100001468 | |||
| 837 | Ga0070712_100014450 | |||
| 838 | Ga0070712_100030346 | |||
| 839 | Ga0070712_100067409 | |||
| 840 | Ga0070712_100070499 | |||
| 841 | Ga0070712_100264242 | |||
| 842 | Ga0070712_100310936 | |||
| 843 | Ga0075428_100389121 | |||
| 844 | Ga0075431_100010116 | |||
| 845 | Ga0075434_100085098 | |||
| 846 | Ga0075434_100144568 | |||
| 847 | Ga0075436_100137075 | |||
| 848 | Ga0097620_100000073 | |||
| 849 | Ga0075435_100097225 | |||
| 850 | Ga0105240_10229716 | |||
| 851 | Ga0105241_10000454 | |||
| 852 | Ga0105248_10000034 | |||
| 853 | Ga0105248_10195350 | |||
| 854 | Ga0105237_10246415 | |||
| 855 | Ga0105237_10535184 | |||
| 856 | Ga0105238_10072802 | |||
| 857 | Ga0105249_10019175 | |||
| 858 | Ga0105239_10094755 | |||
| 859 | Ga0157370_10589908 | |||
| 860 | Ga0157369_10025153 | |||
| 861 | Ga0157369_10659436 | |||
| 862 | Ga0163162_10399704 | |||
| 863 | Ga0157372_10666074 | |||
| 864 | Ga0157375_10308505 | |||
| 865 | Ga0163163_10019517 | |||
| 866 | Ga0163163_10288242 | |||
| 867 | Ga0163163_10524780 | |||
| 868 | Ga0157379_10158269 | |||
| 869 | Ga0157376_10527972 | |||
| 870 | Ga0213874_10008181 | |||
| 871 | Ga0213876_10017094 | |||
| 872 | Ga0213876_10089910 | |||
| 873 | Ga0213875_10001518 | |||
| 874 | Ga0213875_10004855 | |||
| 875 | Ga0213875_10038934 | |||
| 876 | Ga0213875_10053238 | |||
| 877 | Ga0213875_10214024 | |||
| 878 | Ga0213875_10273218 | |||
| 879 | Ga0224572_1003639 | |||
| 880 | Ga0224572_1025107 | |||
| 881 | Ga0207682_10000012 | |||
| 882 | Ga0207692_10001357 | |||
| 883 | Ga0207692_10001832 | |||
| 884 | Ga0207692_10020312 | |||
| 885 | Ga0207692_10124225 | |||
| 886 | Ga0207692_10150251 | |||
| 887 | Ga0207680_10004600 | |||
| 888 | Ga0207685_10000141 | |||
| 889 | Ga0207699_10002220 | |||
| 890 | Ga0207699_10004654 | |||
| 891 | Ga0207699_10006547 | |||
| 892 | Ga0207699_10058573 | |||
| 893 | Ga0207705_10032208 | |||
| 894 | Ga0207684_10001155 | |||
| 895 | Ga0207684_10077001 | |||
| 896 | Ga0207684_10157249 | |||
| 897 | Ga0207654_10014748 | |||
| 898 | Ga0207707_10036623 | |||
| 899 | Ga0207707_10390735 | |||
| 900 | Ga0207695_10023117 | |||
| 901 | Ga0207671_10000816 | |||
| 902 | Ga0207693_10002447 | |||
| 903 | Ga0207693_10006701 | |||
| 904 | Ga0207693_10012999 | |||
| 905 | Ga0207693_10021261 | |||
| 906 | Ga0207693_10046995 | |||
| 907 | Ga0207693_10129730 | |||
| 908 | Ga0207693_10242932 | |||
| 909 | Ga0207693_10306332 | |||
| 910 | Ga0207693_10331510 | |||
| 911 | Ga0207663_10001744 | |||
| 912 | Ga0207663_10002264 | |||
| 913 | Ga0207663_10004959 | |||
| 914 | Ga0207663_10095333 | |||
| 915 | Ga0207663_10141969 | |||
| 916 | Ga0207663_10144505 | |||
| 917 | Ga0207649_10134717 | |||
| 918 | Ga0207646_10072741 | |||
| 919 | Ga0207694_10006139 | |||
| 920 | Ga0207700_10004453 | |||
| 921 | Ga0207700_10010978 | |||
| 922 | Ga0207700_10016766 | |||
| 923 | Ga0207700_10030966 | |||
| 924 | Ga0207700_10038144 | |||
| 925 | Ga0207700_10040897 | |||
| 926 | Ga0207700_10069710 | |||
| 927 | Ga0207700_10070078 | |||
| 928 | Ga0207700_10100569 | |||
| 929 | Ga0207700_10133768 | |||
| 930 | Ga0207700_10165225 | |||
| 931 | Ga0207700_10232288 | |||
| 932 | Ga0207700_10238301 | |||
| 933 | Ga0207700_10271590 | |||
| 934 | Ga0207700_10334828 | |||
| 935 | Ga0207664_10002017 | |||
| 936 | Ga0207664_10014150 | |||
| 937 | Ga0207664_10014922 | |||
| 938 | Ga0207664_10028825 | |||
| 939 | Ga0207664_10033567 | |||
| 940 | Ga0207664_10040268 | |||
| 941 | Ga0207664_10044933 | |||
| 942 | Ga0207664_10051540 | |||
| 943 | Ga0207664_10057613 | |||
| 944 | Ga0207664_10066448 | |||
| 945 | Ga0207664_10067781 | |||
| 946 | Ga0207664_10090751 | |||
| 947 | Ga0207664_10347151 | |||
| 948 | Ga0207664_10479262 | |||
| 949 | Ga0207664_10506803 | |||
| 950 | Ga0207665_10004714 | |||
| 951 | Ga0207665_10013433 | |||
| 952 | Ga0207711_10004985 | |||
| 953 | Ga0207711_10062925 | |||
| 954 | Ga0207689_10099692 | |||
| 955 | Ga0207689_10243185 | |||
| 956 | Ga0207661_10012244 | |||
| 957 | Ga0207661_10028961 | |||
| 958 | Ga0207661_10120752 | |||
| 959 | Ga0207679_10039166 | |||
| 960 | Ga0207667_10070912 | |||
| 961 | Ga0207712_10042223 | |||
| 962 | Ga0207703_10025241 | |||
| 963 | Ga0207639_10170036 | |||
| 964 | Ga0207702_10008511 | |||
| 965 | Ga0207702_10144455 | |||
| 966 | Ga0207641_10063829 | |||
| 967 | Ga0207641_10105419 | |||
| 968 | Ga0207641_10381739 | |||
| 969 | Ga0207676_10168118 | |||
| 970 | Ga0207674_10073930 | |||
| 971 | Ga0207674_10216959 | |||
| 972 | Ga0207698_10055112 | |||
| 973 | Ga0268266_10000715 | |||
| 974 | Ga0268266_10019465 | |||
| 975 | Ga0268266_10145281 | |||
| 976 | Ga0268266_10476447 | |||
| 977 | Ga0268265_10000015 | |||
| 978 | Ga0268264_10035620 | |||
| 979 | Ga0265337_1000279 | |||
| 980 | Ga0265337_1001875 | |||
| 981 | Ga0265326_10000533 | |||
| 982 | Ga0265326_10005497 | |||
| 983 | Ga0265319_1000741 | |||
| 984 | Ga0265319_1001077 | |||
| 985 | Ga0265334_10000292 | |||
| 986 | Ga0265334_10003283 | |||
| 987 | Ga0265318_10028768 | |||
| 988 | Ga0265318_10067264 | |||
| 989 | Ga0265323_10001007 | |||
| 990 | Ga0265323_10018964 | |||
| 991 | Ga0265322_10002610 | |||
| 992 | Ga0265336_10001849 | |||
| 993 | Ga0265336_10004242 | |||
| 994 | Ga0307515_10001780 | |||
| 995 | Ga0307515_10068192 | |||
| 996 | Ga0265338_10001313 | |||
| 997 | Ga0265338_10002068 | |||
| 998 | Ga0265338_10003087 | |||
| 999 | Ga0265324_10000826 | |||
| 1000 | Ga0265324_10003928 | |||
| 1001 | Ga0307512_10001804 | |||
| 1002 | Ga0307512_10029868 | |||
| 1003 | Ga0265760_10054501 | |||
| 1004 | Ga0265332_10000688 | |||
| 1005 | Ga0265332_10001644 | |||
| 1006 | Ga0265320_10000591 | |||
| 1007 | Ga0265320_10010036 | |||
| 1008 | Ga0265325_10005697 | |||
| 1009 | Ga0265325_10008122 | |||
| 1010 | Ga0265340_10000611 | |||
| 1011 | Ga0265340_10007717 | |||
| 1012 | Ga0265340_10009127 | |||
| 1013 | Ga0265340_10068978 | |||
| 1014 | Ga0265339_10005617 | |||
| 1015 | Ga0265316_10005669 | |||
| 1016 | Ga0265316_10066740 | |||
| 1017 | Ga0307513_10036048 | |||
| 1018 | Ga0307513_10178032 | |||
| 1019 | Ga0307513_10181284 | |||
| 1020 | Ga0307509_10005853 | |||
| 1021 | Ga0307408_100571318 | |||
| 1022 | Ga0265313_10002273 | |||
| 1023 | Ga0265313_10019494 | |||
| 1024 | Ga0307508_10008069 | |||
| 1025 | Ga0307508_10283228 | |||
| 1026 | Ga0265314_10002719 | |||
| 1027 | Ga0265314_10029362 | |||
| 1028 | Ga0265342_10003526 | |||
| 1029 | Ga0265342_10010569 | |||
| 1030 | Ga0307405_10006726 | |||
| 1031 | Ga0307413_10186880 | |||
| 1032 | Ga0307413_10269572 | |||
| 1033 | Ga0307413_10322756 | |||
| 1034 | Ga0307518_10048166 | |||
| 1035 | Ga0307406_10005437 | |||
| 1036 | Ga0307406_10098309 | |||
| 1037 | Ga0307406_10308898 | |||
| 1038 | Ga0307412_10035372 | |||
| 1039 | Ga0307409_100000113 | |||
| 1040 | Ga0307416_100327628 | |||
| 1041 | Ga0307416_100498419 | |||
| 1042 | Ga0307416_100519096 | |||
| 1043 | Ga0307411_10692252 | |||
| 1044 | Ga0307415_100000026 | |||
| 1045 | Ga0307415_100320764 | |||
| 1046 | Ga0307415_100592894 | |||
| 1047 | Ga0307507_10021177 | |||
| 1048 | Ga0307507_10122475 | |||
| 1049 | Ga0316215_1005851 | |||
| 1050 | Ga0316214_1005087 | |||
| 1051 | Ga0316214_1009529 | |||
| 1052 | Ga0316212_1010630 | |||
| 1053 | Ga0373926_0024770 | |||
| 1054 | Ga0373929_0004862 | |||
| 1055 | Ga0373934_0000111 | |||
| 1056 | Ga0373934_0038433 | |||
| 1057 | Ga0373940_0045295 | |||
| 1058 | Ga0373951_0008124 | |||
| 1059 | Ga0373923_0029502 | |||
| 1060 | Ga0373923_0053846 | |||
| 1061 | Ga0373936_0024986 | |||
| 1062 | Ga0373939_0026379 | |||
| 1063 | Ga0373945_0049689 | |||
| 1064 | Ga0373953_0000880 | |||
| 1065 | Ga0373953_0004946 | |||
| 1066 | Ga0373953_0025929 | |||
| 1067 | Ga0373953_0030819 | |||
| 1068 | Ga0373954_0120255 | |||
| 1069 | Ga0373956_0001515 | |||
| 1070 | Ga0373956_0008097 | |||
| 1071 | Ga0373956_0044340 | |||
| 1072 | Ga0373956_0057772 | |||
| 1073 | Ga0373956_0172623 | |||
| 1074 | Ga0373956_0281555 | |||
| 1075 | Ga0373957_0004429 | |||
| 1076 | Ga0373957_0005016 | |||
| 1077 | Ga0373960_0002032 | |||
| 1078 | Ga0373943_0024193 | |||
| 1079 | Ga0373946_0050763 | |||
| 1080 | Ga0373955_0001442 | |||
| 1081 | Ga0373955_0009346 | |||
| 1082 | Ga0373955_0307893 | |||
| 1083 | Ga0373942_0094040 | |||
| 1084 | Ga0373961_0003194 | |||
| 1085 | Ga0373962_0005094 | |||
| 1086 | Ga0373962_0005435 | |||
| 1087 | Ga0373924_0002893 | |||
| 1088 | Ga0373924_0149176 | |||
| 1089 | Ga0373931_0003534 | |||
| 1090 | Ga0373935_0006968 | |||
| 1091 | Ga0373935_0014756 | |||
| 1092 | Ga0373935_0150696 | |||
| 1093 | Ga0373935_0326632 | |||
| 1094 | Ga0373927_0551225 | |||
| 1095 | Ga0373933_0000358 | |||
| 1096 | Ga0373933_0007543 | |||
| 1097 | Ga0373933_0031339 | |||
| 1098 | Ga0373933_0148378 | |||
| 1099 | Ga0373947_0074452 | |||
| 1100 | Ga0373947_0075650 | |||
| 1101 | Ga0373947_0279417 | |||
| 1102 | Ga0373937_0000703 | |||
| 1103 | Ga0373937_0002308 | |||
| 1104 | Ga0373937_0028895 | |||
| 1105 | Ga0373937_0123640 | |||
| 1106 | Ga0373937_0129587 | |||
| 1107 | Ga0373937_0143877 | |||
| 1108 | Ga0373937_0215151 | |||
| 1109 | Ga0372808_000712 | |||
| 1110 | Ga0372808_001246 | |||
| 1111 | Ga0372808_007114 | |||
| 1112 | Ga0372808_014509 | |||
| 1113 | Ga0372808_014827 | |||
| 1114 | Ga0373925_0000041 | |||
| 1115 | Ga0373925_0030235 | |||
| 1116 | Ga0373925_0040701 | |||
| 1117 | Ga0373925_0044464 | |||
| 1118 | Ga0395900_0588854 | |||
| 1119 | Ga0395900_0863152 | |||
| 1120 | Ga0395898_0369244 | |||
| 1121 | Ga0395898_0662846 | |||
| 1122 | Ga0436364_0059581 | |||
| 1123 | Ga0436364_0154658 | |||
| 1124 | Ga0436364_0165739 | |||
| 1125 | Ga0436364_0580721 | |||
| 1126 | Ga0436364_0785455 | |||
| 1127 | Ga0436364_0898752 | |||
| 1128 | Ga0436364_0993389 | |||
| 1129 | Ga0436364_1242135 | |||
| 1130 | Ga0436364_1544583 | |||
| 1131 | Ga0395901_0378590 | |||
| 1132 | Ga0242420_006594 | |||
| 1133 | Ga0436365_0103846 | |||
| 1134 | Ga0436365_0304993 | |||
| 1135 | Ga0436365_0439231 | |||
| 1136 | Ga0436365_0512239 | |||
| 1137 | Ga0436363_0425661 | |||
| 1138 | Ga0436363_0872421 | |||
| 1139 | Ga0436363_1171956 | |||
| 1140 | Ga0451835_0897398 | |||
| 1141 | Ga0451853_0372355 | |||
| 1142 | Ga0466969_0004127 | |||
| 1143 | Ga0466969_0017275 | |||
| 1144 | Ga0466969_0103023 | |||
| 1145 | Ga0466966_0122462 | |||
| 1146 | Ga0466966_0139922 | |||
| 1147 | Ga0466966_0156493 | |||
| 1148 | Ga0466961_0334322 | |||
| 1149 | Ga0466963_0002213 | |||
| 1150 | Ga0466963_0097722 | |||
| 1151 | Ga0466964_0063558 | |||
| 1152 | Ga0466971_0017933 | |||
| 1153 | Ga0466968_0174056 | |||
| 1154 | Ga0466970_0024799 | |||
| 1155 | Ga0466957_0069478 | |||
| 1156 | Ga0466957_0089202 | |||
| 1157 | Ga0466957_0283855 | |||
| 1158 | Ga0466959_0000352 | |||
| 1159 | Ga0466959_0071059 | |||
| 1160 | Ga0466959_0075538 | |||
| 1161 | Ga0466959_0132778 | |||
| 1162 | Ga0466959_0189928 | |||
| 1163 | Ga0466958_0000550 | |||
| 1164 | Ga0466958_0001732 | |||
| 1165 | Ga0466958_0070704 | |||
| 1166 | Ga0466958_0209387 | |||
| 1167 | Ga0466967_0001582 | |||
| 1168 | Ga0466967_0228786 | |||
| 1169 | Ga0495592_0000483 | |||
| 1170 | Ga0495592_0030186 | |||
| 1171 | Ga0495592_0109232 | |||
| 1172 | Ga0495592_0281057 | |||
| 1173 | Ga0495629_0011203 | |||
| 1174 | Ga0495629_0164300 | |||
| 1175 | Ga0495641_0007602 | |||
| 1176 | Ga0495651_0000542 | |||
| 1177 | Ga0495651_0039447 | |||
| 1178 | Ga0495651_0060196 | |||
| 1179 | Ga0495651_0066345 | |||
| 1180 | Ga0495651_0163480 | |||
| 1181 | Ga0495653_0003360 | |||
| 1182 | Ga0495653_0033254 | |||
| 1183 | Ga0495653_0048513 | |||
| 1184 | Ga0495653_0106622 | |||
| 1185 | Ga0495580_0057069 | |||
| 1186 | Ga0495582_0014877 | |||
| 1187 | Ga0495582_0096130 | |||
| 1188 | Ga0495639_0045211 | |||
| 1189 | Ga0495639_0286957 | |||
| 1190 | Ga0495662_0002848 | |||
| 1191 | Ga0495662_0074632 | |||
| 1192 | Ga0495664_0018598 | |||
| 1193 | Ga0495664_0029488 | |||
| 1194 | Ga0495664_0095707 | |||
| 1195 | Ga0495594_0063441 | |||
| 1196 | Ga0495608_0004453 | |||
| 1197 | Ga0495608_0013972 | |||
| 1198 | Ga0495608_0017138 | |||
| 1199 | Ga0495608_0024944 | |||
| 1200 | Ga0495608_0219074 | |||
| 1201 | Ga0495618_0035439 | |||
| 1202 | Ga0495618_0050938 | |||
| 1203 | Ga0495618_0097010 | |||
| 1204 | Ga0495618_0184311 | |||
| 1205 | Ga0495628_0006726 | |||
| 1206 | Ga0495628_0091170 | |||
| 1207 | Ga0495628_0186914 | |||
| 1208 | Ga0495630_0050986 | |||
| 1209 | Ga0495630_0193297 | |||
| 1210 | Ga0495666_0015013 | |||
| 1211 | Ga0495652_0032522 | |||
| 1212 | Ga0495652_0045024 | |||
| 1213 | Ga0495652_0181182 | |||
| 1214 | Ga0495652_0199846 | |||
| 1215 | Ga0495665_0026677 | |||
| 1216 | Ga0495665_0109835 | |||
| 1217 | Ga0495640_0046911 | |||
| 1218 | Ga0495640_0088012 | |||
| 1219 | Ga0495586_0046516 | |||
| 1220 | Ga0495587_0000440 | |||
| 1221 | Ga0495587_0044100 | |||
| 1222 | Ga0495587_0058698 | |||
| 1223 | Ga0495587_0395235 | |||
| 1224 | Ga0495645_0027726 | |||
| 1225 | Ga0495645_0030498 | |||
| 1226 | Ga0495645_0225272 | |||
| 1227 | Ga0495645_0382363 | |||
| 1228 | Ga0495645_0386299 | |||
| 1229 | Ga0495667_0000437 | |||
| 1230 | Ga0495667_0007631 | |||
| 1231 | Ga0495667_0015460 | |||
| 1232 | Ga0495667_0123595 | |||
| 1233 | Ga0495667_0124511 | |||
| 1234 | Ga0495667_0351140 | |||
| 1235 | Ga0495634_0010227 | |||
| 1236 | Ga0495634_0077665 | |||
| 1237 | Ga0495634_0384824 | |||
| 1238 | Ga0495625_0000323 | |||
| 1239 | Ga0495635_0054935 | |||
| 1240 | Ga0495635_0071929 | |||
| 1241 | Ga0495635_0429835 | |||
| 1242 | Ga0495588_0113563 | |||
| 1243 | Ga0495657_0000776 | |||
| 1244 | Ga0495657_0059344 | |||
| 1245 | Ga0495657_0157351 | |||
| 1246 | Ga0495599_0044698 | |||
| 1247 | Ga0495599_0077009 | |||
| 1248 | Ga0495599_0293015 | |||
| 1249 | Ga0495623_0000376 | |||
| 1250 | Ga0495623_0066807 | |||
| 1251 | Ga0495623_0261942 | |||
| 1252 | Ga0495623_0303448 | |||
| 1253 | Ga0495646_0038112 | |||
| 1254 | Ga0495646_0064509 | |||
| 1255 | Ga0495646_0098486 | |||
| 1256 | Ga0495646_0099433 | |||
| 1257 | Ga0495647_0141376 | |||
| 1258 | Ga0495658_0025229 | |||
| 1259 | Ga0495658_0053384 | |||
| 1260 | Ga0495613_0014394 | |||
| 1261 | Ga0495613_0101876 | |||
| 1262 | Ga0495613_0141871 | |||
| 1263 | Ga0495624_0016119 | |||
| 1264 | Ga0495624_0162574 | |||
| 1265 | Ga0495624_0253994 | |||
| 1266 | Ga0495624_0310894 | |||
| 1267 | Ga0495600_0002787 | |||
| 1268 | Ga0495600_0014584 | |||
| 1269 | Ga0495600_0020053 | |||
| 1270 | Ga0495600_0035497 | |||
| 1271 | Ga0495581_0009163 | |||
| 1272 | Ga0495581_0046324 | |||
| 1273 | Ga0495604_0000664 | |||
| 1274 | Ga0495604_0018564 | |||
| 1275 | Ga0495604_0107044 | |||
| 1276 | Ga0495604_0187253 | |||
| 1277 | Ga0495604_0191698 | |||
| 1278 | Ga0495674_0020938 | |||
| 1279 | Ga0495674_0030922 | |||
| 1280 | Ga0495674_0070381 | |||
| 1281 | Ga0495674_0103882 | |||
| 1282 | Ga0495674_0150399 | |||
| 1283 | Ga0495676_0120075 | |||
| 1284 | Ga0495676_0140124 | |||
| 1285 | Ga0495676_0192511 | |||
| 1286 | Ga0495676_0414730 | |||
| 1287 | Ga0495680_0001147 | |||
| 1288 | Ga0495680_0037409 | |||
| 1289 | Ga0495680_0050055 | |||
| 1290 | Ga0495680_0156485 | |||
| 1291 | Ga0495680_0165759 | |||
| 1292 | Ga0495680_0167614 | |||
| 1293 | Ga0495675_0001923 | |||
| 1294 | Ga0495675_0049591 | |||
| 1295 | Ga0495675_0055205 | |||
| 1296 | Ga0495675_0156705 | |||
| 1297 | Ga0495684_0012683 | |||
| 1298 | Ga0495684_0043948 | |||
| 1299 | Ga0495684_0313441 | |||
| 1300 | Ga0495684_0488445 | |||
| 1301 | Ga0495593_0052536 | |||
| 1302 | Ga0495602_0000872 | |||
| 1303 | Ga0495602_0004455 | |||
| 1304 | Ga0495602_0061723 | |||
| 1305 | Ga0495602_0094950 | |||
| 1306 | Ga0495602_0159171 | |||
| 1307 | Ga0495602_0349191 | |||
| 1308 | Ga0495602_0518279 | |||
| 1309 | Ga0495614_0068895 | |||
| 1310 | Ga0496100_0007870 | |||
| 1311 | Ga0496101_0007048 | |||
| 1312 | Ga0496101_0659085 | |||
| 1313 | Ga0496102_0000546 | |||
| 1314 | Ga0496102_0077224 | |||
| 1315 | Ga0496103_0000368 | |||
| 1316 | Ga0496103_0245046 | |||
| 1317 | Ga0496104_0004911 | |||
| 1318 | Ga0496104_0041222 | |||
| 1319 | Ga0496104_0296109 | |||
| 1320 | Ga0496104_0388366 | |||
| 1321 | Ga0496105_0002740 | |||
| 1322 | Ga0496105_0127559 | |||
| 1323 | Ga0496105_0323701 | |||
| 1324 | Ga0496106_0007035 | |||
| 1325 | Ga0496107_0073490 | |||
| 1326 | Ga0496108_0003523 | |||
| 1327 | Ga0496108_0046534 | |||
| 1328 | Ga0496108_0178498 | |||
| 1329 | Ga0496109_0015874 | |||
| 1330 | Ga0496109_0041199 | |||
| 1331 | Ga0496110_0064932 | |||
| 1332 | Ga0496110_0402874 | |||
| 1333 | Ga0496112_0021922 | |||
| 1334 | Ga0496112_0034460 | |||
| 1335 | Ga0496112_0047389 | |||
| 1336 | Ga0496113_0004273 | |||
| 1337 | Ga0496114_0005278 | |||
| 1338 | Ga0496114_0036326 | |||
| 1339 | Ga0496115_0005053 | |||
| 1340 | Ga0496115_0012606 | |||
| 1341 | Ga0496115_0186294 | |||
| 1342 | Ga0496115_0609583 | |||
| 1343 | Ga0496117_0020327 | |||
| 1344 | Ga0496118_0020562 | |||
| 1345 | Ga0496124_0029824 | |||
| 1346 | Ga0496126_0031689 | |||
| 1347 | Ga0496126_0160568 | |||
| 1348 | Ga0496126_0170441 | |||
| 1349 | Ga0496126_0407494 | |||
| 1350 | Ga0501031_0003150 | |||
| 1351 | Ga0501031_0080670 | |||
| 1352 | Ga0501032_0001503 | |||
| 1353 | Ga0501032_0068599 | |||
| 1354 | Ga0501032_0136428 | |||
| 1355 | Ga0501033_0004824 | |||
| 1356 | Ga0501034_0015402 | |||
| 1357 | Ga0501034_0150811 | |||
| 1358 | Ga0501036_0009842 | |||
| 1359 | Ga0501036_0547589 | |||
| 1360 | Ga0501037_0003839 | |||
| 1361 | Ga0501038_0006610 | |||
| 1362 | Ga0501039_0004345 | |||
| 1363 | Ga0501039_0180541 | |||
| 1364 | Ga0501042_0021761 | |||
| 1365 | Ga0501042_0036688 | |||
| 1366 | Ga0501043_0002854 | |||
| 1367 | Ga0501043_0185311 | |||
| 1368 | Ga0501043_0363048 | |||
| 1369 | Ga0501046_0006075 | |||
| 1370 | Ga0501046_0021033 | |||
| 1371 | Ga0501047_0006595 | |||
| 1372 | Ga0501047_0195148 | |||
| 1373 | Ga0501047_0207306 | |||
| 1374 | Ga0501047_0251262 | |||
| 1375 | Ga0501048_0004454 | |||
| 1376 | Ga0501067_0048865 | |||
| 1377 | Ga0501068_0023427 | |||
| 1378 | Ga0501069_0031935 | |||
| 1379 | Ga0501070_0005358 | |||
| 1380 | Ga0501070_0010354 | |||
| 1381 | Ga0501072_0049870 | |||
| 1382 | Ga0501073_0008885 | |||
| 1383 | Ga0501074_0003906 | |||
| 1384 | Ga0501074_0042042 | |||
| 1385 | Ga0501074_0115390 | |||
| 1386 | Ga0501074_0155962 | |||
| 1387 | Ga0501079_0016604 | |||
| 1388 | Ga0501080_0012286 | |||
| 1389 | Ga0501083_0007590 | |||
| 1390 | Ga0501035_0006695 | |||
| 1391 | Ga0501035_0057657 | |||
| 1392 | Ga0501044_0003535 | |||
| 1393 | Ga0501044_0009251 | |||
| 1394 | Ga0501044_0024307 | |||
| 1395 | Ga0501044_0129597 | |||
| 1396 | Ga0501044_0327596 | |||
| 1397 | Ga0501045_0026473 | |||
| 1398 | nmdc:mga06r32_7823_c1 | |||
| 1399 | nmdc:mga0n895_47552_c1 | |||
| 1400 | nmdc:mga0n895_58859_c1 | |||
| 1401 | nmdc:mga0rr50_4382_c1 | |||
| 1402 | nmdc:mga08x19_184623_c1 | |||
| 1403 | nmdc:mga08x19_76842_c1 | |||
| 1404 | nmdc:mga0a205_126520_c1 | |||
| 1405 | Ga0495601_0032968 | |||
| 1406 | Ga0495601_0295737 | |||
| 1407 | Ga0495612_0009073 | |||
| 1408 | Ga0495612_0009732 | |||
| 1409 | Ga0495595_0027561 | |||
| 1410 | Ga0495595_0033675 | |||
| 1411 | Ga0495595_0102647 | |||
| 1412 | Ga0495619_0024571 | |||
| 1413 | Ga0495619_0028487 | |||
| 1414 | Ga0495619_0240477 | |||
| 1415 | Ga0500646_0000384 | |||
| 1416 | Ga0500646_0000609 | |||
| 1417 | Ga0500646_0005482 | |||
| 1418 | Ga0500583_0029591 | |||
| 1419 | Ga0500651_0133821 | |||
| 1420 | Ga0500641_0245102 | |||
| 1421 | Ga0501082_0011327 | |||
| 1422 | 2686538288 | |||
| 1423 | 2753270282 | |||
| 1424 | 2753272367 | |||
| 1425 | 2793982432 | |||
| 1426 | 2873152461 | |||
| 1427 | 2880489949 | |||
| 1428 | 2884699327 | |||
| 1429 | 2884702153 | |||
| 1430 | 2891399318 | |||
| 1431 | 2895445305 | |||
| 1432 | 2895447490 | |||
| 1433 | 2895881744 | |||
| 1434 | 8002785561 | |||
| 1435 | 8033690794 | |||
| 1436 | 8047894662 | |||
| 1437 | 8048364387 | |||
| 1438 | 8048371681 | |||
| 1439 | 8048380615 | |||
| 1440 | 8054733368 | |||
| 1441 | 8055070785 | |||
| 1442 | 8055181221 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8fk2-assembly1.cif.gz_B | the n-terminal vicr from streptococcus mutans | 0.9461 | 2 | 119 |
| 6cqg-assembly1.cif.gz_A | yycf effector domain structure without dna bound | 0.9436 | 128 | 217 |
| 5za3-assembly1.cif.gz_B | structure of a c-terminal s. mutans response regulator vicr domain | 0.9399 | 125 | 217 |
| 6ont-assembly1.cif.gz_A-2 | structure of the francisella response regulator 1452 receiver domain | 0.9388 | 2 | 120 |
| 2a9r-assembly1.cif.gz_A-2 | rr02-rec phosphate in the active site | 0.935 | 1 | 118 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O07776_22_102_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9764 | 1 | 80 | 3.40.50.2300 |
| af_Q2FXN6_3_86_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9666 | 1 | 83 | 3.40.50.2300 |
| af_P9WGM1_5_87_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9655 | 2 | 80 | 3.40.50.2300 |
| af_P30843_1_80_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9642 | 1 | 80 | 3.40.50.2300 |
| af_P52076_1_80_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9601 | 1 | 80 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Z1WSF3-F1-model_v4 | Transcriptional regulator | 0.9761 | 1 | 212 |
GO:0000155
GO:0000156 GO:0000976 GO:0005829 GO:0005886 GO:0006355 GO:0032993 |
| AF-A0A6B2W442-F1-model_v4 | Response regulator transcription factor | 0.97 | 1 | 217 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A7W7FRJ6-F1-model_v4 | DNA-binding response OmpR family regulator | 0.9681 | 1 | 217 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A1G9WT58-F1-model_v4 | DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain | 0.9679 | 1 | 217 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A6B2W442-F1-model_v4 | Response regulator transcription factor | 0.9657 | 1 | 217 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |