F477374

General Info

Members Datasets Scaffolds Average Seq Length
721 313 1442 220

Family's Representative Sequence

Representative Sequence 3300031456|Ga0307513_10332481|Ga0307513_103324812
Length 213
Sequence MRVLVVEDQVELADSIGRVLRREGMAVDVVYDGGQALEHTGVTGYDVVVLDRDIPVVHGDDVCRELTGPRVLMLTASGTLADRVEGLNLGADDYLPKPFAYAELVARVRAIGRRSQPAVPTLLTHRDLELDPAKRVATRGGVRLVLTPKEFAVLEHLLAAQHRVVSAEELLDRVWDEAADPFTTTVKATINRLRGKLGAPPLIETVPRSGYRI

Samples

Sample ID Description Type Environment
1 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
65 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
66 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
67 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
68 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
104 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
105 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
106 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
107 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
108 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
109 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
110 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
111 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
112 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
113 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
114 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
115 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
116 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
117 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
118 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
119 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
120 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
121 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
122 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
123 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
124 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
125 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
126 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
127 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
128 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
129 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
130 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
131 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
132 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
133 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
136 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
137 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
138 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
139 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
140 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
141 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
142 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
143 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
144 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
145 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
146 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
147 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
148 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
149 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
150 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
151 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
152 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
153 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
154 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
155 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
156 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
157 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
158 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
159 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
160 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
161 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
162 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
163 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
164 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
165 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
166 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
167 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
168 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
169 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
171 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
172 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
173 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
174 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
175 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
176 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
177 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
178 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
179 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
180 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
181 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
182 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
183 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
184 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
185 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
186 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
187 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
188 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
189 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
190 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
191 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
192 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
193 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
194 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
195 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
196 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
197 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
198 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
199 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
200 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
201 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
202 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
203 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
204 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
205 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
206 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
207 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
208 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
209 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
210 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
211 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
212 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
213 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
214 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
215 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
216 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
217 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
218 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
219 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
220 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
221 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
222 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
223 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
224 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
225 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
226 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
227 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
228 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
229 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
230 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
231 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
232 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
233 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
234 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
235 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
236 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
237 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
238 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
239 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
240 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
241 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
242 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
243 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
244 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
245 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
246 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
247 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
248 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
249 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
250 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
251 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
252 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
253 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
254 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
255 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
256 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
270 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
271 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
272 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
273 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
274 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
275 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
276 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
277 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
278 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
279 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
282 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
283 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
284 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
285 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
286 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
287 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
288 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
289 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
290 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
291 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
292 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
293 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
294 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
295 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
296 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
297 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
298 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
299 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
300 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
301 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
302 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
303 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
304 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
305 8002784119 Frankia sp. AgB1.9 Isolate Nodule
306 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
307 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
308 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
309 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
310 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
311 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
312 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
313 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.26
Metatranscriptomes 0.83
Isolates 2.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.83
Nodule 0.28
Rhizoplane 4.72
Rhizosphere 84.6
Stem 0
Stem Tuber 0
Unclassified 0.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307513_10332481 3300031456 Bacteria 1273
2 rootL2_10161055 3300003322 Bacteria 2359
3 Ga0070658_10121097 3300005327 Bacteria 2174
4 Ga0070683_100003527 3300005329 Bacteria 12732
5 Ga0070683_100030232 3300005329 Bacteria 4913
6 Ga0070677_10000002 3300005333 Bacteria 87295
7 Ga0070682_100161446 3300005337 Bacteria 1548
8 Ga0068868_100762264 3300005338 Bacteria 870
9 Ga0070661_100051914 3300005344 Bacteria 3001
10 Ga0070661_100080899 3300005344 Bacteria 2398
11 Ga0070668_100042584 3300005347 Bacteria 3480
12 Ga0070688_100248646 3300005365 Bacteria 1265
13 Ga0070667_100010602 3300005367 Bacteria 7610
14 Ga0070667_100017131 3300005367 Bacteria 6002
15 Ga0070709_10000304 3300005434 Bacteria 31234
16 Ga0070709_10008267 3300005434 Bacteria 5715
17 Ga0070714_100002439 3300005435 Bacteria 13710
18 Ga0070714_100002881 3300005435 Bacteria 12726
19 Ga0070714_100006786 3300005435 Bacteria 8875
20 Ga0070714_100013384 3300005435 Bacteria 6573
21 Ga0070714_100035129 3300005435 Bacteria 4199
22 Ga0070714_100047951 3300005435 Bacteria 3631
23 Ga0070714_100059771 3300005435 Bacteria 3269
24 Ga0070714_100111240 3300005435 Bacteria 2425
25 Ga0070714_100168438 3300005435 Bacteria 1986
26 Ga0070714_100333487 3300005435 Bacteria 1421
27 Ga0070714_100378079 3300005435 Bacteria 1335
28 Ga0070714_100670638 3300005435 Bacteria 999
29 Ga0070713_100006687 3300005436 Bacteria 8026
30 Ga0070713_100017143 3300005436 Bacteria 5469
31 Ga0070713_100036517 3300005436 Bacteria 3965
32 Ga0070713_100036914 3300005436 Bacteria 3947
33 Ga0070713_100049125 3300005436 Bacteria 3479
34 Ga0070713_100080203 3300005436 Bacteria 2782
35 Ga0070713_100103397 3300005436 Bacteria 2472
36 Ga0070713_100108094 3300005436 Bacteria 2421
37 Ga0070713_100121190 3300005436 Bacteria 2294
38 Ga0070713_100127687 3300005436 Unclassified 2239
39 Ga0070713_100164583 3300005436 Bacteria 1982
40 Ga0070713_100166005 3300005436 Bacteria 1974
41 Ga0070713_100182093 3300005436 Bacteria 1888
42 Ga0070713_100260667 3300005436 Bacteria 1584
43 Ga0070713_100354391 3300005436 Bacteria 1362
44 Ga0070713_100359433 3300005436 Bacteria 1352
45 Ga0070713_100894977 3300005436 Bacteria 854
46 Ga0070710_10006988 3300005437 Bacteria 5445
47 Ga0070710_10009828 3300005437 Bacteria 4688
48 Ga0070710_10023690 3300005437 Bacteria 3230
49 Ga0070710_10051112 3300005437 Bacteria 2320
50 Ga0070710_10111385 3300005437 Bacteria 1645
51 Ga0070711_100008504 3300005439 Bacteria 6289
52 Ga0070711_100018037 3300005439 Bacteria 4502
53 Ga0070711_100021516 3300005439 Bacteria 4172
54 Ga0070711_100058594 3300005439 Bacteria 2671
55 Ga0070711_100073092 3300005439 Bacteria 2421
56 Ga0070711_100229739 3300005439 Bacteria 1446
57 Ga0070708_100040380 3300005445 Bacteria 4086
58 Ga0070708_100437479 3300005445 Bacteria 1234
59 Ga0070708_100441292 3300005445 Bacteria 1228
60 Ga0070681_10047270 3300005458 Bacteria 4301
61 Ga0070681_10121682 3300005458 Bacteria 2544
62 Ga0070681_10237534 3300005458 Bacteria 1736
63 Ga0070706_100028740 3300005467 Bacteria 5120
64 Ga0070706_100040281 3300005467 Bacteria 4312
65 Ga0070706_100092397 3300005467 Bacteria 2807
66 Ga0070698_100015832 3300005471 Bacteria 7964
67 Ga0070698_100097015 3300005471 Bacteria 2924
68 Ga0070698_100464257 3300005471 Bacteria 1202
69 Ga0070698_100637386 3300005471 Bacteria 1007
70 Ga0070699_100527561 3300005518 Bacteria 1074
71 Ga0070679_100289461 3300005530 Bacteria 1589
72 Ga0070684_100010494 3300005535 Bacteria 7340
73 Ga0070684_100044764 3300005535 Bacteria 3829
74 Ga0070684_100097776 3300005535 Bacteria 2618
75 Ga0070684_100208581 3300005535 Bacteria 1781
76 Ga0068853_100056346 3300005539 Bacteria 3389
77 Ga0070665_100048757 3300005548 Bacteria 4251
78 Ga0070665_100087523 3300005548 Bacteria 3121
79 Ga0070665_100244713 3300005548 Bacteria 1794
80 Ga0070665_100690699 3300005548 Bacteria 1034
81 Ga0068855_100007036 3300005563 Bacteria 13650
82 Ga0070664_100034597 3300005564 Bacteria 4238
83 Ga0070664_100040038 3300005564 Bacteria 3951
84 Ga0070664_100101158 3300005564 Bacteria 2506
85 Ga0068857_100071362 3300005577 Bacteria 3094
86 Ga0068857_100250736 3300005577 Bacteria 1623
87 Ga0068856_100056913 3300005614 Bacteria 3860
88 Ga0068856_100183370 3300005614 Bacteria 2107
89 Ga0068852_100018248 3300005616 Bacteria 5525
90 Ga0068864_100251181 3300005618 Bacteria 1642
91 Ga0068864_100412861 3300005618 Bacteria 1285
92 Ga0068863_100350809 3300005841 Bacteria 1437
93 Ga0068863_100445725 3300005841 Bacteria 1270
94 Ga0068858_100023769 3300005842 Bacteria 5710
95 Ga0068858_100175232 3300005842 Bacteria 2023
96 Ga0068860_100015723 3300005843 Bacteria 7388
97 Ga0068862_100000226 3300005844 Bacteria 62735
98 Ga0081455_10008990 3300005937 Bacteria 10318
99 Ga0081538_10006523 3300005981 Bacteria 10255
100 Ga0081539_10000135 3300005985 Bacteria 172789
101 Ga0070717_10005799 3300006028 Bacteria 9045
102 Ga0070717_10007966 3300006028 Bacteria 7891
103 Ga0070717_10013585 3300006028 Bacteria 6246
104 Ga0070717_10036856 3300006028 Bacteria 3968
105 Ga0070717_10073734 3300006028 Bacteria 2853
106 Ga0070717_10105962 3300006028 Bacteria 2393
107 Ga0070717_10107587 3300006028 Bacteria 2375
108 Ga0070717_10125477 3300006028 Bacteria 2203
109 Ga0070717_10127810 3300006028 Bacteria 2183
110 Ga0070715_10004858 3300006163 Bacteria 4451
111 Ga0070715_10027432 3300006163 Bacteria 2275
112 Ga0070715_10068587 3300006163 Bacteria 1577
113 Ga0070716_100006515 3300006173 Bacteria 5706
114 Ga0070716_100013232 3300006173 Bacteria 4201
115 Ga0070712_100001468 3300006175 Bacteria 14378
116 Ga0070712_100014450 3300006175 Bacteria 5068
117 Ga0070712_100030346 3300006175 Bacteria 3631
118 Ga0070712_100067409 3300006175 Bacteria 2546
119 Ga0070712_100070499 3300006175 Bacteria 2498
120 Ga0070712_100264242 3300006175 Bacteria 1380
121 Ga0070712_100310936 3300006175 Bacteria 1278
122 Ga0075428_100389121 3300006844 Bacteria 1495
123 Ga0075431_100010116 3300006847 Bacteria 9478
124 Ga0075434_100085098 3300006871 Bacteria 3161
125 Ga0075434_100144568 3300006871 Bacteria 2398
126 Ga0075436_100137075 3300006914 Bacteria 1719
127 Ga0097620_100000073 3300006931 Bacteria 93018
128 Ga0075435_100097225 3300007076 Bacteria 2436
129 Ga0105240_10229716 3300009093 Bacteria 2157
130 Ga0105241_10000454 3300009174 Bacteria 30798
131 Ga0105248_10000034 3300009177 Bacteria 192324
132 Ga0105248_10195350 3300009177 Bacteria 2280
133 Ga0105237_10246415 3300009545 Bacteria 1788
134 Ga0105237_10535184 3300009545 Bacteria 1178
135 Ga0105238_10072802 3300009551 Bacteria 3431
136 Ga0105249_10019175 3300009553 Bacteria 6100
137 Ga0105239_10094755 3300010375 Bacteria 3298
138 Ga0157370_10589908 3300013104 Bacteria 1018
139 Ga0157369_10025153 3300013105 Bacteria 6610
140 Ga0157369_10659436 3300013105 Bacteria 1079
141 Ga0163162_10399704 3300013306 Bacteria 1507
142 Ga0157372_10666074 3300013307 Bacteria 1212
143 Ga0157375_10308505 3300013308 Bacteria 1746
144 Ga0163163_10019517 3300014325 Bacteria 6368
145 Ga0163163_10288242 3300014325 Bacteria 1694
146 Ga0163163_10524780 3300014325 Bacteria 1246
147 Ga0157379_10158269 3300014968 Bacteria 2044
148 Ga0157376_10527972 3300014969 Bacteria 1164
149 Ga0213874_10008181 3300021377 Bacteria 2540
150 Ga0213876_10017094 3300021384 Bacteria 3831
151 Ga0213876_10089910 3300021384 Bacteria 1626
152 Ga0213875_10001518 3300021388 Bacteria 14932
153 Ga0213875_10004855 3300021388 Bacteria 7301
154 Ga0213875_10038934 3300021388 Bacteria 2240
155 Ga0213875_10053238 3300021388 Bacteria 1895
156 Ga0213875_10214024 3300021388 Bacteria 907
157 Ga0213875_10273218 3300021388 Bacteria 798
158 Ga0224572_1003639 3300024225 Bacteria 2619
159 Ga0224572_1025107 3300024225 Bacteria 1144
160 Ga0207682_10000012 3300025893 Bacteria 84521
161 Ga0207692_10001357 3300025898 Bacteria 9136
162 Ga0207692_10001832 3300025898 Bacteria 8072
163 Ga0207692_10020312 3300025898 Bacteria 3018
164 Ga0207692_10124225 3300025898 Bacteria 1449
165 Ga0207692_10150251 3300025898 Bacteria 1333
166 Ga0207680_10004600 3300025903 Bacteria 6548
167 Ga0207685_10000141 3300025905 Bacteria 10686
168 Ga0207699_10002220 3300025906 Bacteria 9160
169 Ga0207699_10004654 3300025906 Bacteria 6565
170 Ga0207699_10006547 3300025906 Bacteria 5649
171 Ga0207699_10058573 3300025906 Bacteria 2304
172 Ga0207705_10032208 3300025909 Bacteria 3745
173 Ga0207684_10001155 3300025910 Bacteria 29461
174 Ga0207684_10077001 3300025910 Bacteria 2835
175 Ga0207684_10157249 3300025910 Bacteria 1956
176 Ga0207654_10014748 3300025911 Bacteria 4042
177 Ga0207707_10036623 3300025912 Bacteria 4289
178 Ga0207707_10390735 3300025912 Bacteria 1195
179 Ga0207695_10023117 3300025913 Bacteria 7035
180 Ga0207671_10000816 3300025914 Bacteria 39430
181 Ga0207693_10002447 3300025915 Bacteria 16123
182 Ga0207693_10006701 3300025915 Bacteria 9510
183 Ga0207693_10012999 3300025915 Bacteria 6716
184 Ga0207693_10021261 3300025915 Bacteria 5156
185 Ga0207693_10046995 3300025915 Bacteria 3392
186 Ga0207693_10129730 3300025915 Bacteria 1982
187 Ga0207693_10242932 3300025915 Bacteria 1413
188 Ga0207693_10306332 3300025915 Bacteria 1244
189 Ga0207693_10331510 3300025915 Bacteria 1191
190 Ga0207663_10001744 3300025916 Bacteria 10227
191 Ga0207663_10002264 3300025916 Bacteria 9213
192 Ga0207663_10004959 3300025916 Bacteria 6666
193 Ga0207663_10095333 3300025916 Bacteria 1985
194 Ga0207663_10141969 3300025916 Bacteria 1674
195 Ga0207663_10144505 3300025916 Bacteria 1661
196 Ga0207649_10134717 3300025920 Bacteria 1683
197 Ga0207646_10072741 3300025922 Bacteria 3070
198 Ga0207694_10006139 3300025924 Bacteria 9177
199 Ga0207700_10004453 3300025928 Bacteria 8260
200 Ga0207700_10010978 3300025928 Bacteria 5752
201 Ga0207700_10016766 3300025928 Bacteria 4877
202 Ga0207700_10030966 3300025928 Bacteria 3795
203 Ga0207700_10038144 3300025928 Bacteria 3485
204 Ga0207700_10040897 3300025928 Bacteria 3387
205 Ga0207700_10069710 3300025928 Bacteria 2700
206 Ga0207700_10070078 3300025928 Bacteria 2694
207 Ga0207700_10100569 3300025928 Unclassified 2305
208 Ga0207700_10133768 3300025928 Bacteria 2028
209 Ga0207700_10165225 3300025928 Bacteria 1841
210 Ga0207700_10232288 3300025928 Bacteria 1569
211 Ga0207700_10238301 3300025928 Bacteria 1549
212 Ga0207700_10271590 3300025928 Bacteria 1455
213 Ga0207700_10334828 3300025928 Bacteria 1314
214 Ga0207664_10002017 3300025929 Bacteria 13371
215 Ga0207664_10014150 3300025929 Bacteria 5753
216 Ga0207664_10014922 3300025929 Bacteria 5624
217 Ga0207664_10028825 3300025929 Bacteria 4222
218 Ga0207664_10033567 3300025929 Bacteria 3943
219 Ga0207664_10040268 3300025929 Bacteria 3632
220 Ga0207664_10044933 3300025929 Bacteria 3461
221 Ga0207664_10051540 3300025929 Bacteria 3250
222 Ga0207664_10057613 3300025929 Bacteria 3089
223 Ga0207664_10066448 3300025929 Bacteria 2891
224 Ga0207664_10067781 3300025929 Bacteria 2865
225 Ga0207664_10090751 3300025929 Bacteria 2504
226 Ga0207664_10347151 3300025929 Bacteria 1313
227 Ga0207664_10479262 3300025929 Bacteria 1113
228 Ga0207664_10506803 3300025929 Bacteria 1081
229 Ga0207665_10004714 3300025939 Bacteria 9055
230 Ga0207665_10013433 3300025939 Bacteria 5384
231 Ga0207711_10004985 3300025941 Bacteria 11263
232 Ga0207711_10062925 3300025941 Bacteria 3202
233 Ga0207689_10099692 3300025942 Bacteria 2387
234 Ga0207689_10243185 3300025942 Bacteria 1488
235 Ga0207661_10012244 3300025944 Bacteria 6232
236 Ga0207661_10028961 3300025944 Bacteria 4248
237 Ga0207661_10120752 3300025944 Bacteria 2230
238 Ga0207679_10039166 3300025945 Bacteria 3383
239 Ga0207667_10070912 3300025949 Bacteria 3625
240 Ga0207712_10042223 3300025961 Bacteria 3139
241 Ga0207703_10025241 3300026035 Bacteria 4674
242 Ga0207639_10170036 3300026041 Bacteria 1845
243 Ga0207702_10008511 3300026078 Bacteria 8649
244 Ga0207702_10144455 3300026078 Bacteria 2157
245 Ga0207641_10063829 3300026088 Bacteria 3147
246 Ga0207641_10105419 3300026088 Bacteria 2490
247 Ga0207641_10381739 3300026088 Bacteria 1349
248 Ga0207676_10168118 3300026095 Bacteria 1908
249 Ga0207674_10073930 3300026116 Bacteria 3421
250 Ga0207674_10216959 3300026116 Bacteria 1861
251 Ga0207698_10055112 3300026142 Bacteria 3062
252 Ga0268266_10000715 3300028379 Bacteria 44804
253 Ga0268266_10019465 3300028379 Bacteria 5782
254 Ga0268266_10145281 3300028379 Bacteria 2132
255 Ga0268266_10476447 3300028379 Bacteria 1189
256 Ga0268265_10000015 3300028380 Bacteria 322854
257 Ga0268264_10035620 3300028381 Bacteria 4097
258 Ga0265337_1000279 3300028556 Bacteria 27809
259 Ga0265337_1001875 3300028556 Bacteria 10026
260 Ga0265326_10000533 3300028558 Bacteria 14447
261 Ga0265326_10005497 3300028558 Bacteria 3995
262 Ga0265319_1000741 3300028563 Bacteria 21267
263 Ga0265319_1001077 3300028563 Bacteria 16964
264 Ga0265334_10000292 3300028573 Bacteria 27991
265 Ga0265334_10003283 3300028573 Bacteria 7383
266 Ga0265318_10028768 3300028577 Bacteria 2170
267 Ga0265318_10067264 3300028577 Bacteria 1330
268 Ga0265323_10001007 3300028653 Bacteria 14691
269 Ga0265323_10018964 3300028653 Bacteria 2658
270 Ga0265322_10002610 3300028654 Bacteria 5538
271 Ga0265336_10001849 3300028666 Bacteria 9197
272 Ga0265336_10004242 3300028666 Bacteria 5453
273 Ga0307515_10001780 3300028794 Bacteria 47995
274 Ga0307515_10068192 3300028794 Bacteria 4892
275 Ga0265338_10001313 3300028800 Bacteria 40731
276 Ga0265338_10002068 3300028800 Bacteria 30992
277 Ga0265338_10003087 3300028800 Bacteria 23899
278 Ga0265324_10000826 3300029957 Bacteria 20096
279 Ga0265324_10003928 3300029957 Bacteria 6898
280 Ga0307512_10001804 3300030522 Bacteria 28918
281 Ga0307512_10029868 3300030522 Bacteria 4751
282 Ga0265760_10054501 3300031090 Bacteria 1208
283 Ga0265332_10000688 3300031238 Bacteria 21619
284 Ga0265332_10001644 3300031238 Bacteria 12207
285 Ga0265320_10000591 3300031240 Bacteria 27892
286 Ga0265320_10010036 3300031240 Bacteria 5661
287 Ga0265325_10005697 3300031241 Bacteria 7658
288 Ga0265325_10008122 3300031241 Bacteria 6218
289 Ga0265340_10000611 3300031247 Bacteria 19983
290 Ga0265340_10007717 3300031247 Bacteria 5834
291 Ga0265340_10009127 3300031247 Bacteria 5332
292 Ga0265340_10068978 3300031247 Bacteria 1678
293 Ga0265339_10005617 3300031249 Bacteria 8325
294 Ga0265316_10005669 3300031344 Bacteria 12084
295 Ga0265316_10066740 3300031344 Bacteria 2783
296 Ga0307513_10036048 3300031456 Bacteria 5527
297 Ga0307513_10178032 3300031456 Bacteria 1994
298 Ga0307513_10181284 3300031456 Bacteria 1969
299 Ga0307509_10005853 3300031507 Bacteria 16868
300 Ga0307408_100571318 3300031548 Bacteria 1001
301 Ga0265313_10002273 3300031595 Bacteria 16850
302 Ga0265313_10019494 3300031595 Bacteria 3771
303 Ga0307508_10008069 3300031616 Bacteria 9765
304 Ga0307508_10283228 3300031616 Bacteria 1251
305 Ga0265314_10002719 3300031711 Bacteria 17696
306 Ga0265314_10029362 3300031711 Bacteria 4088
307 Ga0265342_10003526 3300031712 Bacteria 12800
308 Ga0265342_10010569 3300031712 Bacteria 6386
309 Ga0307405_10006726 3300031731 Bacteria 5682
310 Ga0307413_10186880 3300031824 Bacteria 1483
311 Ga0307413_10269572 3300031824 Bacteria 1274
312 Ga0307413_10322756 3300031824 Bacteria 1180
313 Ga0307518_10048166 3300031838 Bacteria 3098
314 Ga0307406_10005437 3300031901 Bacteria 6971
315 Ga0307406_10098309 3300031901 Bacteria 1987
316 Ga0307406_10308898 3300031901 Bacteria 1218
317 Ga0307412_10035372 3300031911 Bacteria 3191
318 Ga0307409_100000113 3300031995 Bacteria 29745
319 Ga0307416_100327628 3300032002 Bacteria 1537
320 Ga0307416_100498419 3300032002 Bacteria 1282
321 Ga0307416_100519096 3300032002 Bacteria 1259
322 Ga0307411_10692252 3300032005 Bacteria 887
323 Ga0307415_100000026 3300032126 Bacteria 62017
324 Ga0307415_100320764 3300032126 Bacteria 1292
325 Ga0307415_100592894 3300032126 Bacteria 985
326 Ga0307507_10021177 3300033179 Bacteria 7250
327 Ga0307507_10122475 3300033179 Bacteria 2074
328 Ga0316215_1005851 3300033544 Bacteria 1189
329 Ga0316214_1005087 3300033545 Bacteria 1714
330 Ga0316214_1009529 3300033545 Bacteria 1311
331 Ga0316212_1010630 3300033547 Bacteria 1320
332 Ga0373926_0024770 3300035083 Bacteria 2091
333 Ga0373929_0004862 3300035085 Bacteria 2408
334 Ga0373934_0000111 3300035086 Bacteria 29169
335 Ga0373934_0038433 3300035086 Bacteria 1885
336 Ga0373940_0045295 3300035088 Bacteria 1221
337 Ga0373951_0008124 3300035091 Bacteria 2379
338 Ga0373923_0029502 3300035111 Bacteria 2200
339 Ga0373923_0053846 3300035111 Bacteria 1692
340 Ga0373936_0024986 3300035113 Bacteria 2335
341 Ga0373939_0026379 3300035114 Bacteria 1637
342 Ga0373945_0049689 3300035116 Bacteria 1539
343 Ga0373953_0000880 3300035117 Bacteria 8410
344 Ga0373953_0004946 3300035117 Bacteria 4289
345 Ga0373953_0025929 3300035117 Bacteria 2243
346 Ga0373953_0030819 3300035117 Bacteria 2082
347 Ga0373954_0120255 3300035118 Bacteria 1274
348 Ga0373956_0001515 3300035119 Bacteria 9598
349 Ga0373956_0008097 3300035119 Bacteria 4253
350 Ga0373956_0044340 3300035119 Bacteria 1982
351 Ga0373956_0057772 3300035119 Bacteria 1754
352 Ga0373956_0172623 3300035119 Bacteria 1021
353 Ga0373956_0281555 3300035119 Bacteria 791
354 Ga0373957_0004429 3300035120 Bacteria 4274
355 Ga0373957_0005016 3300035120 Bacteria 4082
356 Ga0373960_0002032 3300035121 Bacteria 4551
357 Ga0373943_0024193 3300035170 Bacteria 2830
358 Ga0373946_0050763 3300035171 Bacteria 1733
359 Ga0373955_0001442 3300035172 Bacteria 10103
360 Ga0373955_0009346 3300035172 Bacteria 4589
361 Ga0373955_0307893 3300035172 Bacteria 956
362 Ga0373942_0094040 3300035207 Bacteria 907
363 Ga0373961_0003194 3300035241 Bacteria 4091
364 Ga0373962_0005094 3300035242 Bacteria 3175
365 Ga0373962_0005435 3300035242 Bacteria 3084
366 Ga0373924_0002893 3300035410 Bacteria 5816
367 Ga0373924_0149176 3300035410 Bacteria 1022
368 Ga0373931_0003534 3300035691 Bacteria 7046
369 Ga0373935_0006968 3300035692 Bacteria 6748
370 Ga0373935_0014756 3300035692 Bacteria 4716
371 Ga0373935_0150696 3300035692 Bacteria 1578
372 Ga0373935_0326632 3300035692 Bacteria 1090
373 Ga0373927_0551225 3300035695 Bacteria 762
374 Ga0373933_0000358 3300035724 Bacteria 29171
375 Ga0373933_0007543 3300035724 Bacteria 5945
376 Ga0373933_0031339 3300035724 Bacteria 3084
377 Ga0373933_0148378 3300035724 Bacteria 1484
378 Ga0373947_0074452 3300035725 Bacteria 2089
379 Ga0373947_0075650 3300035725 Bacteria 2073
380 Ga0373947_0279417 3300035725 Bacteria 1110
381 Ga0373937_0000703 3300036401 Bacteria 29180
382 Ga0373937_0002308 3300036401 Bacteria 15936
383 Ga0373937_0028895 3300036401 Bacteria 5021
384 Ga0373937_0123640 3300036401 Bacteria 2412
385 Ga0373937_0129587 3300036401 Bacteria 2355
386 Ga0373937_0143877 3300036401 Bacteria 2231
387 Ga0373937_0215151 3300036401 Bacteria 1808
388 Ga0372808_000712 3300036459 Bacteria 2918
389 Ga0372808_001246 3300036459 Bacteria 2565
390 Ga0372808_007114 3300036459 Bacteria 1525
391 Ga0372808_014509 3300036459 Bacteria 1125
392 Ga0372808_014827 3300036459 Bacteria 1113
393 Ga0373925_0000041 3300037068 Bacteria 137281
394 Ga0373925_0030235 3300037068 Bacteria 3975
395 Ga0373925_0040701 3300037068 Bacteria 3442
396 Ga0373925_0044464 3300037068 Bacteria 3297
397 Ga0395900_0588854 3300037418 Bacteria 1054
398 Ga0395900_0863152 3300037418 Bacteria 830
399 Ga0395898_0369244 3300037466 Bacteria 1368
400 Ga0395898_0662846 3300037466 Bacteria 986
401 Ga0436364_0059581 3300037853 Bacteria 1230
402 Ga0436364_0154658 3300037853 Bacteria 22988
403 Ga0436364_0165739 3300037853 Bacteria 1476
404 Ga0436364_0580721 3300037853 Bacteria 2339
405 Ga0436364_0785455 3300037853 Bacteria 1426
406 Ga0436364_0898752 3300037853 Bacteria 2677
407 Ga0436364_0993389 3300037853 Bacteria 4041
408 Ga0436364_1242135 3300037853 Bacteria 1028
409 Ga0436364_1544583 3300037853 Bacteria 2155
410 Ga0395901_0378590 3300038443 Bacteria 1457
411 Ga0242420_006594 3300038996 Bacteria 1839
412 Ga0436365_0103846 3300039437 Bacteria 7931
413 Ga0436365_0304993 3300039437 Bacteria 3234
414 Ga0436365_0439231 3300039437 Bacteria 18529
415 Ga0436365_0512239 3300039437 Bacteria 4445
416 Ga0436363_0425661 3300039450 Bacteria 9513
417 Ga0436363_0872421 3300039450 Bacteria 1345
418 Ga0436363_1171956 3300039450 Bacteria 1950
419 Ga0451835_0897398 3300041492 Bacteria 1317
420 Ga0451853_0372355 3300041512 Bacteria 3786
421 Ga0466969_0004127 3300044656 Bacteria 7710
422 Ga0466969_0017275 3300044656 Bacteria 3770
423 Ga0466969_0103023 3300044656 Bacteria 1342
424 Ga0466966_0122462 3300044684 Bacteria 1597
425 Ga0466966_0139922 3300044684 Bacteria 1479
426 Ga0466966_0156493 3300044684 Bacteria 1388
427 Ga0466961_0334322 3300044693 Bacteria 923
428 Ga0466963_0002213 3300044694 Bacteria 10756
429 Ga0466963_0097722 3300044694 Bacteria 2006
430 Ga0466964_0063558 3300044706 Bacteria 1542
431 Ga0466971_0017933 3300044719 Bacteria 3135
432 Ga0466968_0174056 3300044735 Bacteria 998
433 Ga0466970_0024799 3300044765 Bacteria 3137
434 Ga0466957_0069478 3300044842 Bacteria 2176
435 Ga0466957_0089202 3300044842 Bacteria 1930
436 Ga0466957_0283855 3300044842 Bacteria 1109
437 Ga0466959_0000352 3300045049 Bacteria 27249
438 Ga0466959_0071059 3300045049 Bacteria 2521
439 Ga0466959_0075538 3300045049 Bacteria 2434
440 Ga0466959_0132778 3300045049 Bacteria 1764
441 Ga0466959_0189928 3300045049 Bacteria 1434
442 Ga0466958_0000550 3300045836 Bacteria 15964
443 Ga0466958_0001732 3300045836 Bacteria 10547
444 Ga0466958_0070704 3300045836 Bacteria 2136
445 Ga0466958_0209387 3300045836 Bacteria 1242
446 Ga0466967_0001582 3300045976 Bacteria 13376
447 Ga0466967_0228786 3300045976 Bacteria 1770
448 Ga0495592_0000483 3300046454 Bacteria 29089
449 Ga0495592_0030186 3300046454 Bacteria 4100
450 Ga0495592_0109232 3300046454 Bacteria 1959
451 Ga0495592_0281057 3300046454 Bacteria 1088
452 Ga0495629_0011203 3300046459 Bacteria 6512
453 Ga0495629_0164300 3300046459 Bacteria 1542
454 Ga0495641_0007602 3300046461 Bacteria 6744
455 Ga0495651_0000542 3300046462 Bacteria 29179
456 Ga0495651_0039447 3300046462 Bacteria 3676
457 Ga0495651_0060196 3300046462 Bacteria 2909
458 Ga0495651_0066345 3300046462 Bacteria 2755
459 Ga0495651_0163480 3300046462 Bacteria 1592
460 Ga0495653_0003360 3300046463 Bacteria 12863
461 Ga0495653_0033254 3300046463 Bacteria 4087
462 Ga0495653_0048513 3300046463 Bacteria 3277
463 Ga0495653_0106622 3300046463 Bacteria 2020
464 Ga0495580_0057069 3300046472 Bacteria 2748
465 Ga0495582_0014877 3300046473 Bacteria 4275
466 Ga0495582_0096130 3300046473 Bacteria 1655
467 Ga0495639_0045211 3300046475 Bacteria 1992
468 Ga0495639_0286957 3300046475 Bacteria 819
469 Ga0495662_0002848 3300046476 Bacteria 8751
470 Ga0495662_0074632 3300046476 Bacteria 1645
471 Ga0495664_0018598 3300046477 Bacteria 3984
472 Ga0495664_0029488 3300046477 Bacteria 3209
473 Ga0495664_0095707 3300046477 Bacteria 1787
474 Ga0495594_0063441 3300046499 Bacteria 2047
475 Ga0495608_0004453 3300046511 Bacteria 10027
476 Ga0495608_0013972 3300046511 Bacteria 5569
477 Ga0495608_0017138 3300046511 Bacteria 5014
478 Ga0495608_0024944 3300046511 Bacteria 4086
479 Ga0495608_0219074 3300046511 Bacteria 1194
480 Ga0495618_0035439 3300046514 Bacteria 3131
481 Ga0495618_0050938 3300046514 Bacteria 2616
482 Ga0495618_0097010 3300046514 Bacteria 1885
483 Ga0495618_0184311 3300046514 Bacteria 1325
484 Ga0495628_0006726 3300046516 Bacteria 10019
485 Ga0495628_0091170 3300046516 Bacteria 2359
486 Ga0495628_0186914 3300046516 Bacteria 1565
487 Ga0495630_0050986 3300046517 Bacteria 3096
488 Ga0495630_0193297 3300046517 Bacteria 1552
489 Ga0495666_0015013 3300046526 Bacteria 3855
490 Ga0495652_0032522 3300046529 Bacteria 4561
491 Ga0495652_0045024 3300046529 Bacteria 3797
492 Ga0495652_0181182 3300046529 Bacteria 1616
493 Ga0495652_0199846 3300046529 Bacteria 1518
494 Ga0495665_0026677 3300046531 Bacteria 3102
495 Ga0495665_0109835 3300046531 Bacteria 1446
496 Ga0495640_0046911 3300046533 Bacteria 2991
497 Ga0495640_0088012 3300046533 Bacteria 2053
498 Ga0495586_0046516 3300046535 Bacteria 2339
499 Ga0495587_0000440 3300046536 Bacteria 29136
500 Ga0495587_0044100 3300046536 Bacteria 2653
501 Ga0495587_0058698 3300046536 Bacteria 2260
502 Ga0495587_0395235 3300046536 Bacteria 768
503 Ga0495645_0027726 3300046543 Bacteria 4114
504 Ga0495645_0030498 3300046543 Bacteria 3927
505 Ga0495645_0225272 3300046543 Bacteria 1259
506 Ga0495645_0382363 3300046543 Bacteria 900
507 Ga0495645_0386299 3300046543 Bacteria 894
508 Ga0495667_0000437 3300046559 Bacteria 26662
509 Ga0495667_0007631 3300046559 Bacteria 7339
510 Ga0495667_0015460 3300046559 Bacteria 5156
511 Ga0495667_0123595 3300046559 Bacteria 1670
512 Ga0495667_0124511 3300046559 Bacteria 1663
513 Ga0495667_0351140 3300046559 Bacteria 931
514 Ga0495634_0010227 3300046642 Bacteria 6879
515 Ga0495634_0077665 3300046642 Bacteria 2177
516 Ga0495634_0384824 3300046642 Bacteria 835
517 Ga0495625_0000323 3300046660 Bacteria 72852
518 Ga0495635_0054935 3300046663 Bacteria 2743
519 Ga0495635_0071929 3300046663 Bacteria 2370
520 Ga0495635_0429835 3300046663 Bacteria 875
521 Ga0495588_0113563 3300046674 Bacteria 1427
522 Ga0495657_0000776 3300046675 Bacteria 28391
523 Ga0495657_0059344 3300046675 Bacteria 2537
524 Ga0495657_0157351 3300046675 Bacteria 1407
525 Ga0495599_0044698 3300046678 Bacteria 2777
526 Ga0495599_0077009 3300046678 Bacteria 2082
527 Ga0495599_0293015 3300046678 Bacteria 983
528 Ga0495623_0000376 3300046679 Bacteria 29151
529 Ga0495623_0066807 3300046679 Bacteria 2245
530 Ga0495623_0261942 3300046679 Bacteria 968
531 Ga0495623_0303448 3300046679 Bacteria 881
532 Ga0495646_0038112 3300046680 Bacteria 2969
533 Ga0495646_0064509 3300046680 Bacteria 2171
534 Ga0495646_0098486 3300046680 Bacteria 1679
535 Ga0495646_0099433 3300046680 Bacteria 1670
536 Ga0495647_0141376 3300046681 Bacteria 1026
537 Ga0495658_0025229 3300046683 Bacteria 3175
538 Ga0495658_0053384 3300046683 Bacteria 2295
539 Ga0495613_0014394 3300046689 Bacteria 5871
540 Ga0495613_0101876 3300046689 Bacteria 2073
541 Ga0495613_0141871 3300046689 Bacteria 1716
542 Ga0495624_0016119 3300046690 Bacteria 5032
543 Ga0495624_0162574 3300046690 Bacteria 1364
544 Ga0495624_0253994 3300046690 Bacteria 1063
545 Ga0495624_0310894 3300046690 Bacteria 949
546 Ga0495600_0002787 3300046809 Bacteria 10144
547 Ga0495600_0014584 3300046809 Bacteria 4953
548 Ga0495600_0020053 3300046809 Bacteria 4275
549 Ga0495600_0035497 3300046809 Bacteria 3238
550 Ga0495581_0009163 3300047315 Bacteria 5727
551 Ga0495581_0046324 3300047315 Bacteria 2512
552 Ga0495604_0000664 3300047317 Bacteria 29179
553 Ga0495604_0018564 3300047317 Bacteria 5572
554 Ga0495604_0107044 3300047317 Bacteria 2044
555 Ga0495604_0187253 3300047317 Bacteria 1444
556 Ga0495604_0191698 3300047317 Bacteria 1424
557 Ga0495674_0020938 3300047319 Bacteria 6052
558 Ga0495674_0030922 3300047319 Bacteria 4865
559 Ga0495674_0070381 3300047319 Bacteria 3023
560 Ga0495674_0103882 3300047319 Bacteria 2416
561 Ga0495674_0150399 3300047319 Bacteria 1952
562 Ga0495676_0120075 3300047321 Bacteria 1913
563 Ga0495676_0140124 3300047321 Bacteria 1734
564 Ga0495676_0192511 3300047321 Bacteria 1422
565 Ga0495676_0414730 3300047321 Bacteria 892
566 Ga0495680_0001147 3300047322 Bacteria 29179
567 Ga0495680_0037409 3300047322 Bacteria 3887
568 Ga0495680_0050055 3300047322 Bacteria 3268
569 Ga0495680_0156485 3300047322 Bacteria 1657
570 Ga0495680_0165759 3300047322 Bacteria 1602
571 Ga0495680_0167614 3300047322 Bacteria 1591
572 Ga0495675_0001923 3300047444 Bacteria 12383
573 Ga0495675_0049591 3300047444 Bacteria 2668
574 Ga0495675_0055205 3300047444 Bacteria 2519
575 Ga0495675_0156705 3300047444 Bacteria 1404
576 Ga0495684_0012683 3300047471 Bacteria 6503
577 Ga0495684_0043948 3300047471 Bacteria 3420
578 Ga0495684_0313441 3300047471 Bacteria 1123
579 Ga0495684_0488445 3300047471 Bacteria 849
580 Ga0495593_0052536 3300047673 Bacteria 2154
581 Ga0495602_0000872 3300048088 Bacteria 29136
582 Ga0495602_0004455 3300048088 Bacteria 14611
583 Ga0495602_0061723 3300048088 Bacteria 3256
584 Ga0495602_0094950 3300048088 Bacteria 2463
585 Ga0495602_0159171 3300048088 Bacteria 1765
586 Ga0495602_0349191 3300048088 Bacteria 1068
587 Ga0495602_0518279 3300048088 Bacteria 831
588 Ga0495614_0068895 3300048089 Bacteria 1523
589 Ga0496100_0007870 3300048903 Bacteria 5917
590 Ga0496101_0007048 3300048904 Bacteria 7266
591 Ga0496101_0659085 3300048904 Bacteria 827
592 Ga0496102_0000546 3300048905 Bacteria 40572
593 Ga0496102_0077224 3300048905 Bacteria 3065
594 Ga0496103_0000368 3300048906 Bacteria 40572
595 Ga0496103_0245046 3300048906 Bacteria 1153
596 Ga0496104_0004911 3300048907 Bacteria 11663
597 Ga0496104_0041222 3300048907 Bacteria 4328
598 Ga0496104_0296109 3300048907 Bacteria 1530
599 Ga0496104_0388366 3300048907 Bacteria 1308
600 Ga0496105_0002740 3300048908 Bacteria 12858
601 Ga0496105_0127559 3300048908 Bacteria 2097
602 Ga0496105_0323701 3300048908 Bacteria 1235
603 Ga0496106_0007035 3300048909 Bacteria 8310
604 Ga0496107_0073490 3300048910 Bacteria 2487
605 Ga0496108_0003523 3300048911 Bacteria 12548
606 Ga0496108_0046534 3300048911 Bacteria 3625
607 Ga0496108_0178498 3300048911 Bacteria 1838
608 Ga0496109_0015874 3300048912 Bacteria 6576
609 Ga0496109_0041199 3300048912 Bacteria 4185
610 Ga0496110_0064932 3300048913 Bacteria 3227
611 Ga0496110_0402874 3300048913 Bacteria 1247
612 Ga0496112_0021922 3300048915 Bacteria 6079
613 Ga0496112_0034460 3300048915 Bacteria 4927
614 Ga0496112_0047389 3300048915 Bacteria 4216
615 Ga0496113_0004273 3300048916 Bacteria 8753
616 Ga0496114_0005278 3300048917 Bacteria 10095
617 Ga0496114_0036326 3300048917 Bacteria 4072
618 Ga0496115_0005053 3300048918 Bacteria 9588
619 Ga0496115_0012606 3300048918 Bacteria 6368
620 Ga0496115_0186294 3300048918 Bacteria 1715
621 Ga0496115_0609583 3300048918 Bacteria 867
622 Ga0496117_0020327 3300048920 Bacteria 5415
623 Ga0496118_0020562 3300048921 Bacteria 5849
624 Ga0496124_0029824 3300048927 Bacteria 4853
625 Ga0496126_0031689 3300048929 Bacteria 4990
626 Ga0496126_0160568 3300048929 Bacteria 1921
627 Ga0496126_0170441 3300048929 Bacteria 1855
628 Ga0496126_0407494 3300048929 Bacteria 1101
629 Ga0501031_0003150 3300049568 Bacteria 10580
630 Ga0501031_0080670 3300049568 Bacteria 2120
631 Ga0501032_0001503 3300049569 Bacteria 18641
632 Ga0501032_0068599 3300049569 Bacteria 2367
633 Ga0501032_0136428 3300049569 Bacteria 1617
634 Ga0501033_0004824 3300049570 Bacteria 10762
635 Ga0501034_0015402 3300049571 Bacteria 7859
636 Ga0501034_0150811 3300049571 Bacteria 2300
637 Ga0501036_0009842 3300049572 Bacteria 7872
638 Ga0501036_0547589 3300049572 Bacteria 962
639 Ga0501037_0003839 3300049573 Bacteria 10912
640 Ga0501038_0006610 3300049574 Bacteria 10726
641 Ga0501039_0004345 3300049575 Bacteria 10689
642 Ga0501039_0180541 3300049575 Bacteria 1660
643 Ga0501042_0021761 3300049578 Bacteria 4472
644 Ga0501042_0036688 3300049578 Bacteria 3478
645 Ga0501043_0002854 3300049579 Bacteria 14430
646 Ga0501043_0185311 3300049579 Bacteria 1621
647 Ga0501043_0363048 3300049579 Bacteria 1099
648 Ga0501046_0006075 3300049580 Bacteria 10745
649 Ga0501046_0021033 3300049580 Bacteria 5388
650 Ga0501047_0006595 3300049581 Bacteria 10924
651 Ga0501047_0195148 3300049581 Bacteria 1887
652 Ga0501047_0207306 3300049581 Bacteria 1820
653 Ga0501047_0251262 3300049581 Bacteria 1616
654 Ga0501048_0004454 3300049582 Bacteria 10658
655 Ga0501067_0048865 3300049583 Bacteria 2345
656 Ga0501068_0023427 3300049584 Bacteria 3618
657 Ga0501069_0031935 3300049585 Bacteria 2898
658 Ga0501070_0005358 3300049586 Bacteria 10945
659 Ga0501070_0010354 3300049586 Bacteria 7882
660 Ga0501072_0049870 3300049588 Bacteria 3295
661 Ga0501073_0008885 3300049589 Bacteria 7428
662 Ga0501074_0003906 3300049590 Bacteria 10615
663 Ga0501074_0042042 3300049590 Bacteria 3308
664 Ga0501074_0115390 3300049590 Bacteria 1921
665 Ga0501074_0155962 3300049590 Bacteria 1631
666 Ga0501079_0016604 3300049741 Bacteria 5622
667 Ga0501080_0012286 3300049742 Bacteria 7845
668 Ga0501083_0007590 3300049744 Bacteria 7684
669 Ga0501035_0006695 3300049822 Bacteria 10768
670 Ga0501035_0057657 3300049822 Bacteria 3462
671 Ga0501044_0003535 3300049823 Bacteria 17595
672 Ga0501044_0009251 3300049823 Bacteria 10759
673 Ga0501044_0024307 3300049823 Bacteria 6435
674 Ga0501044_0129597 3300049823 Bacteria 2517
675 Ga0501044_0327596 3300049823 Bacteria 1455
676 Ga0501045_0026473 3300049824 Bacteria 4172
677 nmdc:mga06r32_7823_c1 3300050510 Bacteria 9608
678 nmdc:mga0n895_47552_c1 3300050512 Bacteria 4195
679 nmdc:mga0n895_58859_c1 3300050512 Bacteria 3790
680 nmdc:mga0rr50_4382_c1 3300050513 Bacteria 8293
681 nmdc:mga08x19_184623_c1 3300050514 Bacteria 1425
682 nmdc:mga08x19_76842_c1 3300050514 Bacteria 2186
683 nmdc:mga0a205_126520_c1 3300050515 Bacteria 2455
684 Ga0495601_0032968 3300053077 Bacteria 3226
685 Ga0495601_0295737 3300053077 Bacteria 1055
686 Ga0495612_0009073 3300053078 Bacteria 4033
687 Ga0495612_0009732 3300053078 Bacteria 3893
688 Ga0495595_0027561 3300053084 Bacteria 2532
689 Ga0495595_0033675 3300053084 Bacteria 2313
690 Ga0495595_0102647 3300053084 Bacteria 1381
691 Ga0495619_0024571 3300053085 Bacteria 3865
692 Ga0495619_0028487 3300053085 Bacteria 3603
693 Ga0495619_0240477 3300053085 Bacteria 1254
694 Ga0500646_0000384 3300053090 Bacteria 13266
695 Ga0500646_0000609 3300053090 Bacteria 10231
696 Ga0500646_0005482 3300053090 Bacteria 3208
697 Ga0500583_0029591 3300053092 Bacteria 2390
698 Ga0500651_0133821 3300053093 Bacteria 1498
699 Ga0500641_0245102 3300053096 Bacteria 753
700 Ga0501082_0011327 3300060353 Bacteria 7665
701 2686538288 2684623035 Bacteria 8032739
702 2753270282 2751185782 Bacteria 11227053
703 2753272367 2751185782 Bacteria 11227053
704 2793982432 2791355406 Bacteria 11364898
705 2873152461 2873151551 Bacteria 8625867
706 2880489949 2880489317 Bacteria 7096270
707 2884699327 2884693830 Bacteria 11273186
708 2884702153 2884693830 Bacteria 11273186
709 2891399318 2891395885 Bacteria 9251614
710 2895445305 2895442618 Bacteria 11027144
711 2895447490 2895442618 Bacteria 11027144
712 2895881744 2895880812 Bacteria 11255272
713 8002785561 8002784119 Bacteria 9788632
714 8033690794 8033684223 Bacteria 6906479
715 8047894662 8047893842 Bacteria 11723082
716 8048364387 8048356638 Bacteria 11044339
717 8048371681 8048369669 Bacteria 11666822
718 8048380615 8048379754 Bacteria 11877923
719 8054733368 8054727385 Bacteria 7558670
720 8055070785 8055066027 Bacteria 9479577
721 8055181221 8055172936 Bacteria 9305943
722 Ga0307513_10332481
723 rootL2_10161055
724 Ga0070658_10121097
725 Ga0070683_100003527
726 Ga0070683_100030232
727 Ga0070677_10000002
728 Ga0070682_100161446
729 Ga0068868_100762264
730 Ga0070661_100051914
731 Ga0070661_100080899
732 Ga0070668_100042584
733 Ga0070688_100248646
734 Ga0070667_100010602
735 Ga0070667_100017131
736 Ga0070709_10000304
737 Ga0070709_10008267
738 Ga0070714_100002439
739 Ga0070714_100002881
740 Ga0070714_100006786
741 Ga0070714_100013384
742 Ga0070714_100035129
743 Ga0070714_100047951
744 Ga0070714_100059771
745 Ga0070714_100111240
746 Ga0070714_100168438
747 Ga0070714_100333487
748 Ga0070714_100378079
749 Ga0070714_100670638
750 Ga0070713_100006687
751 Ga0070713_100017143
752 Ga0070713_100036517
753 Ga0070713_100036914
754 Ga0070713_100049125
755 Ga0070713_100080203
756 Ga0070713_100103397
757 Ga0070713_100108094
758 Ga0070713_100121190
759 Ga0070713_100127687
760 Ga0070713_100164583
761 Ga0070713_100166005
762 Ga0070713_100182093
763 Ga0070713_100260667
764 Ga0070713_100354391
765 Ga0070713_100359433
766 Ga0070713_100894977
767 Ga0070710_10006988
768 Ga0070710_10009828
769 Ga0070710_10023690
770 Ga0070710_10051112
771 Ga0070710_10111385
772 Ga0070711_100008504
773 Ga0070711_100018037
774 Ga0070711_100021516
775 Ga0070711_100058594
776 Ga0070711_100073092
777 Ga0070711_100229739
778 Ga0070708_100040380
779 Ga0070708_100437479
780 Ga0070708_100441292
781 Ga0070681_10047270
782 Ga0070681_10121682
783 Ga0070681_10237534
784 Ga0070706_100028740
785 Ga0070706_100040281
786 Ga0070706_100092397
787 Ga0070698_100015832
788 Ga0070698_100097015
789 Ga0070698_100464257
790 Ga0070698_100637386
791 Ga0070699_100527561
792 Ga0070679_100289461
793 Ga0070684_100010494
794 Ga0070684_100044764
795 Ga0070684_100097776
796 Ga0070684_100208581
797 Ga0068853_100056346
798 Ga0070665_100048757
799 Ga0070665_100087523
800 Ga0070665_100244713
801 Ga0070665_100690699
802 Ga0068855_100007036
803 Ga0070664_100034597
804 Ga0070664_100040038
805 Ga0070664_100101158
806 Ga0068857_100071362
807 Ga0068857_100250736
808 Ga0068856_100056913
809 Ga0068856_100183370
810 Ga0068852_100018248
811 Ga0068864_100251181
812 Ga0068864_100412861
813 Ga0068863_100350809
814 Ga0068863_100445725
815 Ga0068858_100023769
816 Ga0068858_100175232
817 Ga0068860_100015723
818 Ga0068862_100000226
819 Ga0081455_10008990
820 Ga0081538_10006523
821 Ga0081539_10000135
822 Ga0070717_10005799
823 Ga0070717_10007966
824 Ga0070717_10013585
825 Ga0070717_10036856
826 Ga0070717_10073734
827 Ga0070717_10105962
828 Ga0070717_10107587
829 Ga0070717_10125477
830 Ga0070717_10127810
831 Ga0070715_10004858
832 Ga0070715_10027432
833 Ga0070715_10068587
834 Ga0070716_100006515
835 Ga0070716_100013232
836 Ga0070712_100001468
837 Ga0070712_100014450
838 Ga0070712_100030346
839 Ga0070712_100067409
840 Ga0070712_100070499
841 Ga0070712_100264242
842 Ga0070712_100310936
843 Ga0075428_100389121
844 Ga0075431_100010116
845 Ga0075434_100085098
846 Ga0075434_100144568
847 Ga0075436_100137075
848 Ga0097620_100000073
849 Ga0075435_100097225
850 Ga0105240_10229716
851 Ga0105241_10000454
852 Ga0105248_10000034
853 Ga0105248_10195350
854 Ga0105237_10246415
855 Ga0105237_10535184
856 Ga0105238_10072802
857 Ga0105249_10019175
858 Ga0105239_10094755
859 Ga0157370_10589908
860 Ga0157369_10025153
861 Ga0157369_10659436
862 Ga0163162_10399704
863 Ga0157372_10666074
864 Ga0157375_10308505
865 Ga0163163_10019517
866 Ga0163163_10288242
867 Ga0163163_10524780
868 Ga0157379_10158269
869 Ga0157376_10527972
870 Ga0213874_10008181
871 Ga0213876_10017094
872 Ga0213876_10089910
873 Ga0213875_10001518
874 Ga0213875_10004855
875 Ga0213875_10038934
876 Ga0213875_10053238
877 Ga0213875_10214024
878 Ga0213875_10273218
879 Ga0224572_1003639
880 Ga0224572_1025107
881 Ga0207682_10000012
882 Ga0207692_10001357
883 Ga0207692_10001832
884 Ga0207692_10020312
885 Ga0207692_10124225
886 Ga0207692_10150251
887 Ga0207680_10004600
888 Ga0207685_10000141
889 Ga0207699_10002220
890 Ga0207699_10004654
891 Ga0207699_10006547
892 Ga0207699_10058573
893 Ga0207705_10032208
894 Ga0207684_10001155
895 Ga0207684_10077001
896 Ga0207684_10157249
897 Ga0207654_10014748
898 Ga0207707_10036623
899 Ga0207707_10390735
900 Ga0207695_10023117
901 Ga0207671_10000816
902 Ga0207693_10002447
903 Ga0207693_10006701
904 Ga0207693_10012999
905 Ga0207693_10021261
906 Ga0207693_10046995
907 Ga0207693_10129730
908 Ga0207693_10242932
909 Ga0207693_10306332
910 Ga0207693_10331510
911 Ga0207663_10001744
912 Ga0207663_10002264
913 Ga0207663_10004959
914 Ga0207663_10095333
915 Ga0207663_10141969
916 Ga0207663_10144505
917 Ga0207649_10134717
918 Ga0207646_10072741
919 Ga0207694_10006139
920 Ga0207700_10004453
921 Ga0207700_10010978
922 Ga0207700_10016766
923 Ga0207700_10030966
924 Ga0207700_10038144
925 Ga0207700_10040897
926 Ga0207700_10069710
927 Ga0207700_10070078
928 Ga0207700_10100569
929 Ga0207700_10133768
930 Ga0207700_10165225
931 Ga0207700_10232288
932 Ga0207700_10238301
933 Ga0207700_10271590
934 Ga0207700_10334828
935 Ga0207664_10002017
936 Ga0207664_10014150
937 Ga0207664_10014922
938 Ga0207664_10028825
939 Ga0207664_10033567
940 Ga0207664_10040268
941 Ga0207664_10044933
942 Ga0207664_10051540
943 Ga0207664_10057613
944 Ga0207664_10066448
945 Ga0207664_10067781
946 Ga0207664_10090751
947 Ga0207664_10347151
948 Ga0207664_10479262
949 Ga0207664_10506803
950 Ga0207665_10004714
951 Ga0207665_10013433
952 Ga0207711_10004985
953 Ga0207711_10062925
954 Ga0207689_10099692
955 Ga0207689_10243185
956 Ga0207661_10012244
957 Ga0207661_10028961
958 Ga0207661_10120752
959 Ga0207679_10039166
960 Ga0207667_10070912
961 Ga0207712_10042223
962 Ga0207703_10025241
963 Ga0207639_10170036
964 Ga0207702_10008511
965 Ga0207702_10144455
966 Ga0207641_10063829
967 Ga0207641_10105419
968 Ga0207641_10381739
969 Ga0207676_10168118
970 Ga0207674_10073930
971 Ga0207674_10216959
972 Ga0207698_10055112
973 Ga0268266_10000715
974 Ga0268266_10019465
975 Ga0268266_10145281
976 Ga0268266_10476447
977 Ga0268265_10000015
978 Ga0268264_10035620
979 Ga0265337_1000279
980 Ga0265337_1001875
981 Ga0265326_10000533
982 Ga0265326_10005497
983 Ga0265319_1000741
984 Ga0265319_1001077
985 Ga0265334_10000292
986 Ga0265334_10003283
987 Ga0265318_10028768
988 Ga0265318_10067264
989 Ga0265323_10001007
990 Ga0265323_10018964
991 Ga0265322_10002610
992 Ga0265336_10001849
993 Ga0265336_10004242
994 Ga0307515_10001780
995 Ga0307515_10068192
996 Ga0265338_10001313
997 Ga0265338_10002068
998 Ga0265338_10003087
999 Ga0265324_10000826
1000 Ga0265324_10003928
1001 Ga0307512_10001804
1002 Ga0307512_10029868
1003 Ga0265760_10054501
1004 Ga0265332_10000688
1005 Ga0265332_10001644
1006 Ga0265320_10000591
1007 Ga0265320_10010036
1008 Ga0265325_10005697
1009 Ga0265325_10008122
1010 Ga0265340_10000611
1011 Ga0265340_10007717
1012 Ga0265340_10009127
1013 Ga0265340_10068978
1014 Ga0265339_10005617
1015 Ga0265316_10005669
1016 Ga0265316_10066740
1017 Ga0307513_10036048
1018 Ga0307513_10178032
1019 Ga0307513_10181284
1020 Ga0307509_10005853
1021 Ga0307408_100571318
1022 Ga0265313_10002273
1023 Ga0265313_10019494
1024 Ga0307508_10008069
1025 Ga0307508_10283228
1026 Ga0265314_10002719
1027 Ga0265314_10029362
1028 Ga0265342_10003526
1029 Ga0265342_10010569
1030 Ga0307405_10006726
1031 Ga0307413_10186880
1032 Ga0307413_10269572
1033 Ga0307413_10322756
1034 Ga0307518_10048166
1035 Ga0307406_10005437
1036 Ga0307406_10098309
1037 Ga0307406_10308898
1038 Ga0307412_10035372
1039 Ga0307409_100000113
1040 Ga0307416_100327628
1041 Ga0307416_100498419
1042 Ga0307416_100519096
1043 Ga0307411_10692252
1044 Ga0307415_100000026
1045 Ga0307415_100320764
1046 Ga0307415_100592894
1047 Ga0307507_10021177
1048 Ga0307507_10122475
1049 Ga0316215_1005851
1050 Ga0316214_1005087
1051 Ga0316214_1009529
1052 Ga0316212_1010630
1053 Ga0373926_0024770
1054 Ga0373929_0004862
1055 Ga0373934_0000111
1056 Ga0373934_0038433
1057 Ga0373940_0045295
1058 Ga0373951_0008124
1059 Ga0373923_0029502
1060 Ga0373923_0053846
1061 Ga0373936_0024986
1062 Ga0373939_0026379
1063 Ga0373945_0049689
1064 Ga0373953_0000880
1065 Ga0373953_0004946
1066 Ga0373953_0025929
1067 Ga0373953_0030819
1068 Ga0373954_0120255
1069 Ga0373956_0001515
1070 Ga0373956_0008097
1071 Ga0373956_0044340
1072 Ga0373956_0057772
1073 Ga0373956_0172623
1074 Ga0373956_0281555
1075 Ga0373957_0004429
1076 Ga0373957_0005016
1077 Ga0373960_0002032
1078 Ga0373943_0024193
1079 Ga0373946_0050763
1080 Ga0373955_0001442
1081 Ga0373955_0009346
1082 Ga0373955_0307893
1083 Ga0373942_0094040
1084 Ga0373961_0003194
1085 Ga0373962_0005094
1086 Ga0373962_0005435
1087 Ga0373924_0002893
1088 Ga0373924_0149176
1089 Ga0373931_0003534
1090 Ga0373935_0006968
1091 Ga0373935_0014756
1092 Ga0373935_0150696
1093 Ga0373935_0326632
1094 Ga0373927_0551225
1095 Ga0373933_0000358
1096 Ga0373933_0007543
1097 Ga0373933_0031339
1098 Ga0373933_0148378
1099 Ga0373947_0074452
1100 Ga0373947_0075650
1101 Ga0373947_0279417
1102 Ga0373937_0000703
1103 Ga0373937_0002308
1104 Ga0373937_0028895
1105 Ga0373937_0123640
1106 Ga0373937_0129587
1107 Ga0373937_0143877
1108 Ga0373937_0215151
1109 Ga0372808_000712
1110 Ga0372808_001246
1111 Ga0372808_007114
1112 Ga0372808_014509
1113 Ga0372808_014827
1114 Ga0373925_0000041
1115 Ga0373925_0030235
1116 Ga0373925_0040701
1117 Ga0373925_0044464
1118 Ga0395900_0588854
1119 Ga0395900_0863152
1120 Ga0395898_0369244
1121 Ga0395898_0662846
1122 Ga0436364_0059581
1123 Ga0436364_0154658
1124 Ga0436364_0165739
1125 Ga0436364_0580721
1126 Ga0436364_0785455
1127 Ga0436364_0898752
1128 Ga0436364_0993389
1129 Ga0436364_1242135
1130 Ga0436364_1544583
1131 Ga0395901_0378590
1132 Ga0242420_006594
1133 Ga0436365_0103846
1134 Ga0436365_0304993
1135 Ga0436365_0439231
1136 Ga0436365_0512239
1137 Ga0436363_0425661
1138 Ga0436363_0872421
1139 Ga0436363_1171956
1140 Ga0451835_0897398
1141 Ga0451853_0372355
1142 Ga0466969_0004127
1143 Ga0466969_0017275
1144 Ga0466969_0103023
1145 Ga0466966_0122462
1146 Ga0466966_0139922
1147 Ga0466966_0156493
1148 Ga0466961_0334322
1149 Ga0466963_0002213
1150 Ga0466963_0097722
1151 Ga0466964_0063558
1152 Ga0466971_0017933
1153 Ga0466968_0174056
1154 Ga0466970_0024799
1155 Ga0466957_0069478
1156 Ga0466957_0089202
1157 Ga0466957_0283855
1158 Ga0466959_0000352
1159 Ga0466959_0071059
1160 Ga0466959_0075538
1161 Ga0466959_0132778
1162 Ga0466959_0189928
1163 Ga0466958_0000550
1164 Ga0466958_0001732
1165 Ga0466958_0070704
1166 Ga0466958_0209387
1167 Ga0466967_0001582
1168 Ga0466967_0228786
1169 Ga0495592_0000483
1170 Ga0495592_0030186
1171 Ga0495592_0109232
1172 Ga0495592_0281057
1173 Ga0495629_0011203
1174 Ga0495629_0164300
1175 Ga0495641_0007602
1176 Ga0495651_0000542
1177 Ga0495651_0039447
1178 Ga0495651_0060196
1179 Ga0495651_0066345
1180 Ga0495651_0163480
1181 Ga0495653_0003360
1182 Ga0495653_0033254
1183 Ga0495653_0048513
1184 Ga0495653_0106622
1185 Ga0495580_0057069
1186 Ga0495582_0014877
1187 Ga0495582_0096130
1188 Ga0495639_0045211
1189 Ga0495639_0286957
1190 Ga0495662_0002848
1191 Ga0495662_0074632
1192 Ga0495664_0018598
1193 Ga0495664_0029488
1194 Ga0495664_0095707
1195 Ga0495594_0063441
1196 Ga0495608_0004453
1197 Ga0495608_0013972
1198 Ga0495608_0017138
1199 Ga0495608_0024944
1200 Ga0495608_0219074
1201 Ga0495618_0035439
1202 Ga0495618_0050938
1203 Ga0495618_0097010
1204 Ga0495618_0184311
1205 Ga0495628_0006726
1206 Ga0495628_0091170
1207 Ga0495628_0186914
1208 Ga0495630_0050986
1209 Ga0495630_0193297
1210 Ga0495666_0015013
1211 Ga0495652_0032522
1212 Ga0495652_0045024
1213 Ga0495652_0181182
1214 Ga0495652_0199846
1215 Ga0495665_0026677
1216 Ga0495665_0109835
1217 Ga0495640_0046911
1218 Ga0495640_0088012
1219 Ga0495586_0046516
1220 Ga0495587_0000440
1221 Ga0495587_0044100
1222 Ga0495587_0058698
1223 Ga0495587_0395235
1224 Ga0495645_0027726
1225 Ga0495645_0030498
1226 Ga0495645_0225272
1227 Ga0495645_0382363
1228 Ga0495645_0386299
1229 Ga0495667_0000437
1230 Ga0495667_0007631
1231 Ga0495667_0015460
1232 Ga0495667_0123595
1233 Ga0495667_0124511
1234 Ga0495667_0351140
1235 Ga0495634_0010227
1236 Ga0495634_0077665
1237 Ga0495634_0384824
1238 Ga0495625_0000323
1239 Ga0495635_0054935
1240 Ga0495635_0071929
1241 Ga0495635_0429835
1242 Ga0495588_0113563
1243 Ga0495657_0000776
1244 Ga0495657_0059344
1245 Ga0495657_0157351
1246 Ga0495599_0044698
1247 Ga0495599_0077009
1248 Ga0495599_0293015
1249 Ga0495623_0000376
1250 Ga0495623_0066807
1251 Ga0495623_0261942
1252 Ga0495623_0303448
1253 Ga0495646_0038112
1254 Ga0495646_0064509
1255 Ga0495646_0098486
1256 Ga0495646_0099433
1257 Ga0495647_0141376
1258 Ga0495658_0025229
1259 Ga0495658_0053384
1260 Ga0495613_0014394
1261 Ga0495613_0101876
1262 Ga0495613_0141871
1263 Ga0495624_0016119
1264 Ga0495624_0162574
1265 Ga0495624_0253994
1266 Ga0495624_0310894
1267 Ga0495600_0002787
1268 Ga0495600_0014584
1269 Ga0495600_0020053
1270 Ga0495600_0035497
1271 Ga0495581_0009163
1272 Ga0495581_0046324
1273 Ga0495604_0000664
1274 Ga0495604_0018564
1275 Ga0495604_0107044
1276 Ga0495604_0187253
1277 Ga0495604_0191698
1278 Ga0495674_0020938
1279 Ga0495674_0030922
1280 Ga0495674_0070381
1281 Ga0495674_0103882
1282 Ga0495674_0150399
1283 Ga0495676_0120075
1284 Ga0495676_0140124
1285 Ga0495676_0192511
1286 Ga0495676_0414730
1287 Ga0495680_0001147
1288 Ga0495680_0037409
1289 Ga0495680_0050055
1290 Ga0495680_0156485
1291 Ga0495680_0165759
1292 Ga0495680_0167614
1293 Ga0495675_0001923
1294 Ga0495675_0049591
1295 Ga0495675_0055205
1296 Ga0495675_0156705
1297 Ga0495684_0012683
1298 Ga0495684_0043948
1299 Ga0495684_0313441
1300 Ga0495684_0488445
1301 Ga0495593_0052536
1302 Ga0495602_0000872
1303 Ga0495602_0004455
1304 Ga0495602_0061723
1305 Ga0495602_0094950
1306 Ga0495602_0159171
1307 Ga0495602_0349191
1308 Ga0495602_0518279
1309 Ga0495614_0068895
1310 Ga0496100_0007870
1311 Ga0496101_0007048
1312 Ga0496101_0659085
1313 Ga0496102_0000546
1314 Ga0496102_0077224
1315 Ga0496103_0000368
1316 Ga0496103_0245046
1317 Ga0496104_0004911
1318 Ga0496104_0041222
1319 Ga0496104_0296109
1320 Ga0496104_0388366
1321 Ga0496105_0002740
1322 Ga0496105_0127559
1323 Ga0496105_0323701
1324 Ga0496106_0007035
1325 Ga0496107_0073490
1326 Ga0496108_0003523
1327 Ga0496108_0046534
1328 Ga0496108_0178498
1329 Ga0496109_0015874
1330 Ga0496109_0041199
1331 Ga0496110_0064932
1332 Ga0496110_0402874
1333 Ga0496112_0021922
1334 Ga0496112_0034460
1335 Ga0496112_0047389
1336 Ga0496113_0004273
1337 Ga0496114_0005278
1338 Ga0496114_0036326
1339 Ga0496115_0005053
1340 Ga0496115_0012606
1341 Ga0496115_0186294
1342 Ga0496115_0609583
1343 Ga0496117_0020327
1344 Ga0496118_0020562
1345 Ga0496124_0029824
1346 Ga0496126_0031689
1347 Ga0496126_0160568
1348 Ga0496126_0170441
1349 Ga0496126_0407494
1350 Ga0501031_0003150
1351 Ga0501031_0080670
1352 Ga0501032_0001503
1353 Ga0501032_0068599
1354 Ga0501032_0136428
1355 Ga0501033_0004824
1356 Ga0501034_0015402
1357 Ga0501034_0150811
1358 Ga0501036_0009842
1359 Ga0501036_0547589
1360 Ga0501037_0003839
1361 Ga0501038_0006610
1362 Ga0501039_0004345
1363 Ga0501039_0180541
1364 Ga0501042_0021761
1365 Ga0501042_0036688
1366 Ga0501043_0002854
1367 Ga0501043_0185311
1368 Ga0501043_0363048
1369 Ga0501046_0006075
1370 Ga0501046_0021033
1371 Ga0501047_0006595
1372 Ga0501047_0195148
1373 Ga0501047_0207306
1374 Ga0501047_0251262
1375 Ga0501048_0004454
1376 Ga0501067_0048865
1377 Ga0501068_0023427
1378 Ga0501069_0031935
1379 Ga0501070_0005358
1380 Ga0501070_0010354
1381 Ga0501072_0049870
1382 Ga0501073_0008885
1383 Ga0501074_0003906
1384 Ga0501074_0042042
1385 Ga0501074_0115390
1386 Ga0501074_0155962
1387 Ga0501079_0016604
1388 Ga0501080_0012286
1389 Ga0501083_0007590
1390 Ga0501035_0006695
1391 Ga0501035_0057657
1392 Ga0501044_0003535
1393 Ga0501044_0009251
1394 Ga0501044_0024307
1395 Ga0501044_0129597
1396 Ga0501044_0327596
1397 Ga0501045_0026473
1398 nmdc:mga06r32_7823_c1
1399 nmdc:mga0n895_47552_c1
1400 nmdc:mga0n895_58859_c1
1401 nmdc:mga0rr50_4382_c1
1402 nmdc:mga08x19_184623_c1
1403 nmdc:mga08x19_76842_c1
1404 nmdc:mga0a205_126520_c1
1405 Ga0495601_0032968
1406 Ga0495601_0295737
1407 Ga0495612_0009073
1408 Ga0495612_0009732
1409 Ga0495595_0027561
1410 Ga0495595_0033675
1411 Ga0495595_0102647
1412 Ga0495619_0024571
1413 Ga0495619_0028487
1414 Ga0495619_0240477
1415 Ga0500646_0000384
1416 Ga0500646_0000609
1417 Ga0500646_0005482
1418 Ga0500583_0029591
1419 Ga0500651_0133821
1420 Ga0500641_0245102
1421 Ga0501082_0011327
1422 2686538288
1423 2753270282
1424 2753272367
1425 2793982432
1426 2873152461
1427 2880489949
1428 2884699327
1429 2884702153
1430 2891399318
1431 2895445305
1432 2895447490
1433 2895881744
1434 8002785561
1435 8033690794
1436 8047894662
1437 8048364387
1438 8048371681
1439 8048380615
1440 8054733368
1441 8055070785
1442 8055181221

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

3

109

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8fk2-assembly1.cif.gz_B the n-terminal vicr from streptococcus mutans 0.9461 2 119
6cqg-assembly1.cif.gz_A yycf effector domain structure without dna bound 0.9436 128 217
5za3-assembly1.cif.gz_B structure of a c-terminal s. mutans response regulator vicr domain 0.9399 125 217
6ont-assembly1.cif.gz_A-2 structure of the francisella response regulator 1452 receiver domain 0.9388 2 120
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.935 1 118
ID Description Score Start End Superfamily
af_O07776_22_102_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9764 1 80 3.40.50.2300
af_Q2FXN6_3_86_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9666 1 83 3.40.50.2300
af_P9WGM1_5_87_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9655 2 80 3.40.50.2300
af_P30843_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9642 1 80 3.40.50.2300
af_P52076_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9601 1 80 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A1Z1WSF3-F1-model_v4 Transcriptional regulator 0.9761 1 212 GO:0000155
GO:0000156
GO:0000976
GO:0005829
GO:0005886
GO:0006355
GO:0032993
AF-A0A6B2W442-F1-model_v4 Response regulator transcription factor 0.97 1 217 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A7W7FRJ6-F1-model_v4 DNA-binding response OmpR family regulator 0.9681 1 217 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A1G9WT58-F1-model_v4 DNA-binding response regulator, OmpR family, contains REC and winged-helix (WHTH) domain 0.9679 1 217 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A6B2W442-F1-model_v4 Response regulator transcription factor 0.9657 1 217 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993

Map