F477321
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 720 | 323 | 1440 | 252 |
Family's Representative Sequence
| Representative Sequence | 3300044694|Ga0466963_0254649|Ga0466963_0254649_21_863 |
| Length | 280 |
| Sequence | VGSPSAVPVRGGLALPLAVCATPIGNLEDITLRVLCELRAADVVLCEDTRHTRVLLDRHGIDRPLLSYHEHNEASRTKELLPRLEAGERIALVSDAGMPGINDPGARIVRAALAAGVPVTVLPGPSAVETALVASGLVGERYQFVGFLPRKQGELAALWEELSRSPWPAVAFESPQRLPASLASLAATTPEREVAVCRELTKRFEEVVRGTATDLAARFATSPKGEITLVVGPGRGDGDDAPALAAVAELVAEGLPRRRAADVVARLTGSSKNRLYRGSL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 2 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 57 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 58 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 59 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 60 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 61 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 62 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 63 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 64 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 66 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 67 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 68 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 71 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 72 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 73 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 74 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 75 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 76 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 77 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 98 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 102 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 103 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 104 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 105 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 151 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 153 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 154 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 155 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 156 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 157 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 158 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 159 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 160 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 161 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 162 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 163 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 164 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 165 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 166 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 167 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 168 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 169 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 170 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 171 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 172 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 173 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 174 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 175 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 176 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 177 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 178 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 179 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 180 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 181 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 182 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 183 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 184 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 185 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 186 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 187 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 188 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 189 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 190 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 191 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 192 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 193 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 194 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 195 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 196 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 197 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 198 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 199 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 200 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 201 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 202 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 203 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 204 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 205 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 206 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 207 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 208 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 259 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 260 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 261 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 262 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 263 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 264 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 265 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 266 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 267 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 268 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 269 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 270 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 271 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 272 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 273 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 274 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 308 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 321 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 323 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.17 |
| Metatranscriptomes | 0.83 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.42 |
| Nodule | 0 |
| Rhizoplane | 8.75 |
| Rhizosphere | 90.69 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.36 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0466963_0254649 | 3300044694 | Bacteria | 1232 |
| 2 | JGI25407J50210_10037201 | 3300003373 | Bacteria | 1251 |
| 3 | Ga0070658_10005067 | 3300005327 | Bacteria | 10725 |
| 4 | Ga0070658_10009665 | 3300005327 | Bacteria | 7745 |
| 5 | Ga0070658_10009919 | 3300005327 | Bacteria | 7652 |
| 6 | Ga0070658_10070161 | 3300005327 | Bacteria | 2868 |
| 7 | Ga0070658_10147864 | 3300005327 | Bacteria | 1966 |
| 8 | Ga0070683_100105842 | 3300005329 | Bacteria | 2652 |
| 9 | Ga0070683_100526989 | 3300005329 | Bacteria | 1129 |
| 10 | Ga0070690_100084102 | 3300005330 | Bacteria | 2085 |
| 11 | Ga0070690_100157982 | 3300005330 | Bacteria | 1551 |
| 12 | Ga0070670_100005965 | 3300005331 | Bacteria | 10307 |
| 13 | Ga0070680_100019068 | 3300005336 | Bacteria | 5431 |
| 14 | Ga0070680_100051865 | 3300005336 | Bacteria | 3348 |
| 15 | Ga0070680_100182113 | 3300005336 | Bacteria | 1769 |
| 16 | Ga0070682_100012208 | 3300005337 | Bacteria | 4919 |
| 17 | Ga0070660_100002084 | 3300005339 | Bacteria | 13803 |
| 18 | Ga0070660_100010360 | 3300005339 | Bacteria | 6587 |
| 19 | Ga0070660_100048195 | 3300005339 | Bacteria | 3272 |
| 20 | Ga0070660_100152987 | 3300005339 | Bacteria | 1855 |
| 21 | Ga0070660_100182903 | 3300005339 | Bacteria | 1696 |
| 22 | Ga0070691_10030649 | 3300005341 | Bacteria | 2520 |
| 23 | Ga0070691_10084725 | 3300005341 | Bacteria | 1556 |
| 24 | Ga0070687_100022052 | 3300005343 | Bacteria | 3005 |
| 25 | Ga0070661_100043113 | 3300005344 | Bacteria | 3295 |
| 26 | Ga0070661_100201216 | 3300005344 | Bacteria | 1522 |
| 27 | Ga0070692_10138913 | 3300005345 | Bacteria | 1373 |
| 28 | Ga0070668_100103455 | 3300005347 | Bacteria | 2259 |
| 29 | Ga0070669_100091266 | 3300005353 | Bacteria | 2284 |
| 30 | Ga0070675_100102959 | 3300005354 | Bacteria | 2406 |
| 31 | Ga0070674_100075814 | 3300005356 | Bacteria | 2390 |
| 32 | Ga0070674_100098402 | 3300005356 | Bacteria | 2126 |
| 33 | Ga0070673_100027107 | 3300005364 | Bacteria | 4243 |
| 34 | Ga0070688_100001335 | 3300005365 | Bacteria | 12235 |
| 35 | Ga0070659_100021168 | 3300005366 | Bacteria | 4948 |
| 36 | Ga0070659_100056044 | 3300005366 | Bacteria | 3107 |
| 37 | Ga0070659_100145364 | 3300005366 | Bacteria | 1932 |
| 38 | Ga0070667_100200917 | 3300005367 | Bacteria | 1769 |
| 39 | Ga0070709_10049886 | 3300005434 | Bacteria | 2619 |
| 40 | Ga0070709_10053605 | 3300005434 | Bacteria | 2540 |
| 41 | Ga0070709_10144083 | 3300005434 | Bacteria | 1640 |
| 42 | Ga0070714_100006363 | 3300005435 | Bacteria | 9109 |
| 43 | Ga0070714_100074192 | 3300005435 | Bacteria | 2949 |
| 44 | Ga0070714_100075914 | 3300005435 | Bacteria | 2916 |
| 45 | Ga0070714_100159092 | 3300005435 | Bacteria | 2042 |
| 46 | Ga0070714_100563244 | 3300005435 | Bacteria | 1092 |
| 47 | Ga0070713_100840974 | 3300005436 | Bacteria | 881 |
| 48 | Ga0070710_10037317 | 3300005437 | Bacteria | 2662 |
| 49 | Ga0070710_10067735 | 3300005437 | Bacteria | 2049 |
| 50 | Ga0070701_10003191 | 3300005438 | Bacteria | 6449 |
| 51 | Ga0070701_10207469 | 3300005438 | Bacteria | 1162 |
| 52 | Ga0070711_100350104 | 3300005439 | Bacteria | 1187 |
| 53 | Ga0070705_100029659 | 3300005440 | Bacteria | 3012 |
| 54 | Ga0070705_100469145 | 3300005440 | Bacteria | 948 |
| 55 | Ga0070700_100097775 | 3300005441 | Bacteria | 1929 |
| 56 | Ga0070700_100138578 | 3300005441 | Bacteria | 1651 |
| 57 | Ga0070700_100244197 | 3300005441 | Bacteria | 1285 |
| 58 | Ga0070694_100217499 | 3300005444 | Bacteria | 1431 |
| 59 | Ga0070694_100293979 | 3300005444 | Bacteria | 1243 |
| 60 | Ga0070708_100030482 | 3300005445 | Bacteria | 4662 |
| 61 | Ga0070708_100115088 | 3300005445 | Bacteria | 2475 |
| 62 | Ga0070708_100224126 | 3300005445 | Bacteria | 1764 |
| 63 | Ga0070663_100008657 | 3300005455 | Bacteria | 6273 |
| 64 | Ga0070678_100173500 | 3300005456 | Bacteria | 1758 |
| 65 | Ga0070678_100204323 | 3300005456 | Bacteria | 1633 |
| 66 | Ga0070681_10000870 | 3300005458 | Bacteria | 25432 |
| 67 | Ga0070681_10011999 | 3300005458 | Bacteria | 8590 |
| 68 | Ga0070681_10026180 | 3300005458 | Bacteria | 5864 |
| 69 | Ga0070681_10145933 | 3300005458 | Bacteria | 2295 |
| 70 | Ga0070681_10350767 | 3300005458 | Bacteria | 1386 |
| 71 | Ga0068867_100002315 | 3300005459 | Bacteria | 13405 |
| 72 | Ga0068867_100112829 | 3300005459 | Bacteria | 2090 |
| 73 | Ga0070685_10319166 | 3300005466 | Bacteria | 1052 |
| 74 | Ga0070706_100009221 | 3300005467 | Bacteria | 9192 |
| 75 | Ga0070706_100025664 | 3300005467 | Bacteria | 5423 |
| 76 | Ga0070706_100104135 | 3300005467 | Bacteria | 2639 |
| 77 | Ga0070706_100157001 | 3300005467 | Bacteria | 2123 |
| 78 | Ga0070707_100000499 | 3300005468 | Bacteria | 39000 |
| 79 | Ga0070707_100102187 | 3300005468 | Bacteria | 2777 |
| 80 | Ga0070698_100007169 | 3300005471 | Bacteria | 12078 |
| 81 | Ga0070698_100169895 | 3300005471 | Bacteria | 2122 |
| 82 | Ga0070698_100366559 | 3300005471 | Bacteria | 1373 |
| 83 | Ga0070699_100086802 | 3300005518 | Bacteria | 2731 |
| 84 | Ga0070699_100395669 | 3300005518 | Bacteria | 1249 |
| 85 | Ga0070679_100115648 | 3300005530 | Bacteria | 2668 |
| 86 | Ga0070679_100199946 | 3300005530 | Bacteria | 1965 |
| 87 | Ga0070679_100256105 | 3300005530 | Bacteria | 1705 |
| 88 | Ga0070679_100299398 | 3300005530 | Bacteria | 1559 |
| 89 | Ga0070679_100308169 | 3300005530 | Bacteria | 1533 |
| 90 | Ga0070684_100082322 | 3300005535 | Bacteria | 2850 |
| 91 | Ga0070684_100207147 | 3300005535 | Bacteria | 1787 |
| 92 | Ga0070684_100360737 | 3300005535 | Unclassified | 1337 |
| 93 | Ga0070697_100128269 | 3300005536 | Bacteria | 2125 |
| 94 | Ga0068853_100080154 | 3300005539 | Bacteria | 2856 |
| 95 | Ga0068853_100479422 | 3300005539 | Bacteria | 1172 |
| 96 | Ga0070686_100005644 | 3300005544 | Bacteria | 6932 |
| 97 | Ga0070686_100024086 | 3300005544 | Bacteria | 3646 |
| 98 | Ga0070695_100000005 | 3300005545 | Bacteria | 97484 |
| 99 | Ga0070695_100046805 | 3300005545 | Bacteria | 2760 |
| 100 | Ga0070695_100133470 | 3300005545 | Bacteria | 1713 |
| 101 | Ga0070696_100027543 | 3300005546 | Bacteria | 3873 |
| 102 | Ga0070696_100036365 | 3300005546 | Bacteria | 3395 |
| 103 | Ga0070665_100038717 | 3300005548 | Bacteria | 4793 |
| 104 | Ga0070704_100010268 | 3300005549 | Bacteria | 5693 |
| 105 | Ga0070704_100091223 | 3300005549 | Bacteria | 2271 |
| 106 | Ga0070704_100108666 | 3300005549 | Bacteria | 2106 |
| 107 | Ga0070704_100294556 | 3300005549 | Bacteria | 1349 |
| 108 | Ga0068855_100213971 | 3300005563 | Bacteria | 2164 |
| 109 | Ga0068855_100679432 | 3300005563 | Bacteria | 1103 |
| 110 | Ga0070664_100142699 | 3300005564 | Bacteria | 2110 |
| 111 | Ga0070664_100164740 | 3300005564 | Bacteria | 1963 |
| 112 | Ga0070664_100343299 | 3300005564 | Bacteria | 1357 |
| 113 | Ga0068857_100007868 | 3300005577 | Bacteria | 9195 |
| 114 | Ga0068857_100038703 | 3300005577 | Bacteria | 4222 |
| 115 | Ga0068857_100232741 | 3300005577 | Bacteria | 1685 |
| 116 | Ga0068857_100375824 | 3300005577 | Unclassified | 1319 |
| 117 | Ga0068854_100048671 | 3300005578 | Bacteria | 3025 |
| 118 | Ga0068856_100141424 | 3300005614 | Bacteria | 2414 |
| 119 | Ga0068856_100174252 | 3300005614 | Bacteria | 2164 |
| 120 | Ga0068856_100567044 | 3300005614 | Bacteria | 1157 |
| 121 | Ga0068856_100750185 | 3300005614 | Bacteria | 996 |
| 122 | Ga0070702_100012206 | 3300005615 | Bacteria | 4298 |
| 123 | Ga0070702_100076447 | 3300005615 | Bacteria | 1993 |
| 124 | Ga0068852_100127396 | 3300005616 | Bacteria | 2340 |
| 125 | Ga0068852_100392871 | 3300005616 | Bacteria | 1363 |
| 126 | Ga0068866_10005257 | 3300005718 | Bacteria | 5335 |
| 127 | Ga0068866_10096757 | 3300005718 | Bacteria | 1620 |
| 128 | Ga0068870_10001681 | 3300005840 | Bacteria | 9039 |
| 129 | Ga0068863_100220564 | 3300005841 | Bacteria | 1827 |
| 130 | Ga0068860_100100032 | 3300005843 | Bacteria | 2766 |
| 131 | Ga0068860_100176733 | 3300005843 | Bacteria | 2063 |
| 132 | Ga0081455_10010902 | 3300005937 | Bacteria | 9170 |
| 133 | Ga0081455_10127859 | 3300005937 | Bacteria | 1991 |
| 134 | Ga0081538_10000531 | 3300005981 | Bacteria | 42080 |
| 135 | Ga0081538_10006735 | 3300005981 | Bacteria | 10049 |
| 136 | Ga0081538_10126919 | 3300005981 | Bacteria | 1210 |
| 137 | Ga0081539_10001582 | 3300005985 | Bacteria | 37628 |
| 138 | Ga0070717_10010897 | 3300006028 | Bacteria | 6882 |
| 139 | Ga0070717_10011613 | 3300006028 | Bacteria | 6696 |
| 140 | Ga0070717_10012034 | 3300006028 | Bacteria | 6590 |
| 141 | Ga0070717_10053273 | 3300006028 | Bacteria | 3334 |
| 142 | Ga0070717_10106177 | 3300006028 | Bacteria | 2391 |
| 143 | Ga0070717_10248596 | 3300006028 | Bacteria | 1570 |
| 144 | Ga0075365_10175590 | 3300006038 | Unclassified | 1496 |
| 145 | Ga0075364_10015843 | 3300006051 | Bacteria | 4679 |
| 146 | Ga0075432_10016731 | 3300006058 | Bacteria | 2502 |
| 147 | Ga0070716_100136889 | 3300006173 | Bacteria | 1556 |
| 148 | Ga0070712_100083999 | 3300006175 | Bacteria | 2314 |
| 149 | Ga0068871_100059434 | 3300006358 | Bacteria | 3114 |
| 150 | Ga0068871_100288602 | 3300006358 | Bacteria | 1437 |
| 151 | Ga0075428_100359776 | 3300006844 | Bacteria | 1561 |
| 152 | Ga0075431_100049253 | 3300006847 | Bacteria | 4344 |
| 153 | Ga0075431_100343762 | 3300006847 | Bacteria | 1501 |
| 154 | Ga0075433_10061216 | 3300006852 | Bacteria | 3297 |
| 155 | Ga0075433_10062999 | 3300006852 | Bacteria | 3248 |
| 156 | Ga0068865_100008726 | 3300006881 | Bacteria | 6270 |
| 157 | Ga0068865_100213549 | 3300006881 | Bacteria | 1505 |
| 158 | Ga0075436_100009010 | 3300006914 | Bacteria | 6827 |
| 159 | Ga0075435_100020369 | 3300007076 | Bacteria | 5081 |
| 160 | Ga0075435_100021671 | 3300007076 | Bacteria | 4946 |
| 161 | Ga0105240_10010278 | 3300009093 | Bacteria | 13176 |
| 162 | Ga0105240_10290427 | 3300009093 | Bacteria | 1875 |
| 163 | Ga0111539_10026631 | 3300009094 | Bacteria | 7068 |
| 164 | Ga0111539_10070886 | 3300009094 | Bacteria | 4113 |
| 165 | Ga0111539_10250925 | 3300009094 | Bacteria | 2060 |
| 166 | Ga0111539_10362946 | 3300009094 | Bacteria | 1686 |
| 167 | Ga0111539_10840104 | 3300009094 | Unclassified | 1068 |
| 168 | Ga0105245_10097836 | 3300009098 | Bacteria | 2710 |
| 169 | Ga0105245_10121059 | 3300009098 | Bacteria | 2445 |
| 170 | Ga0105247_10287186 | 3300009101 | Bacteria | 1137 |
| 171 | Ga0114129_10073321 | 3300009147 | Bacteria | 4769 |
| 172 | Ga0114129_10113350 | 3300009147 | Bacteria | 3739 |
| 173 | Ga0105243_10020894 | 3300009148 | Bacteria | 4968 |
| 174 | Ga0105243_10336224 | 3300009148 | Bacteria | 1381 |
| 175 | Ga0105242_10011334 | 3300009176 | Bacteria | 6853 |
| 176 | Ga0105248_10170911 | 3300009177 | Bacteria | 2450 |
| 177 | Ga0105248_10604925 | 3300009177 | Bacteria | 1237 |
| 178 | Ga0105237_10113772 | 3300009545 | Bacteria | 2698 |
| 179 | Ga0105237_10265665 | 3300009545 | Bacteria | 1719 |
| 180 | Ga0105238_10243998 | 3300009551 | Bacteria | 1774 |
| 181 | Ga0105249_10036376 | 3300009553 | Bacteria | 4465 |
| 182 | Ga0105249_10115126 | 3300009553 | Bacteria | 2547 |
| 183 | Ga0105239_10089971 | 3300010375 | Bacteria | 3386 |
| 184 | Ga0105239_10122930 | 3300010375 | Bacteria | 2884 |
| 185 | Ga0105239_10509577 | 3300010375 | Bacteria | 1368 |
| 186 | Ga0157371_10012788 | 3300013102 | Bacteria | 6398 |
| 187 | Ga0157370_10007418 | 3300013104 | Bacteria | 11939 |
| 188 | Ga0157370_10073012 | 3300013104 | Bacteria | 3237 |
| 189 | Ga0157370_10212724 | 3300013104 | Bacteria | 1792 |
| 190 | Ga0157370_10243339 | 3300013104 | Bacteria | 1664 |
| 191 | Ga0157369_10003200 | 3300013105 | Bacteria | 19524 |
| 192 | Ga0157369_10048500 | 3300013105 | Bacteria | 4608 |
| 193 | Ga0157369_10108289 | 3300013105 | Bacteria | 2956 |
| 194 | Ga0157369_10401179 | 3300013105 | Bacteria | 1422 |
| 195 | Ga0157374_10001910 | 3300013296 | Bacteria | 17466 |
| 196 | Ga0157378_10068324 | 3300013297 | Bacteria | 3187 |
| 197 | Ga0163162_10022800 | 3300013306 | Bacteria | 6173 |
| 198 | Ga0163162_10333502 | 3300013306 | Bacteria | 1649 |
| 199 | Ga0157375_10014891 | 3300013308 | Bacteria | 6951 |
| 200 | Ga0157375_10071713 | 3300013308 | Bacteria | 3478 |
| 201 | Ga0157375_10147870 | 3300013308 | Bacteria | 2482 |
| 202 | Ga0157375_10223878 | 3300013308 | Unclassified | 2040 |
| 203 | Ga0157375_10224644 | 3300013308 | Bacteria | 2037 |
| 204 | Ga0157380_10087954 | 3300014326 | Bacteria | 2555 |
| 205 | Ga0182008_10026919 | 3300014497 | Bacteria | 2915 |
| 206 | Ga0182008_10067478 | 3300014497 | Bacteria | 1760 |
| 207 | Ga0157377_10002074 | 3300014745 | Bacteria | 8800 |
| 208 | Ga0157376_10008931 | 3300014969 | Bacteria | 7256 |
| 209 | Ga0157376_10021984 | 3300014969 | Bacteria | 4962 |
| 210 | Ga0157376_10220874 | 3300014969 | Bacteria | 1755 |
| 211 | Ga0163161_10119548 | 3300017792 | Bacteria | 1978 |
| 212 | Ga0197907_11168973 | 3300020069 | Bacteria | 1927 |
| 213 | Ga0206356_10015860 | 3300020070 | Bacteria | 989 |
| 214 | Ga0206356_11892464 | 3300020070 | Bacteria | 3877 |
| 215 | Ga0206354_11647680 | 3300020081 | Bacteria | 1813 |
| 216 | Ga0206353_10474326 | 3300020082 | Bacteria | 4558 |
| 217 | Ga0206353_11246867 | 3300020082 | Bacteria | 1362 |
| 218 | Ga0207692_10041910 | 3300025898 | Bacteria | 2269 |
| 219 | Ga0207688_10115413 | 3300025901 | Bacteria | 1563 |
| 220 | Ga0207643_10001454 | 3300025908 | Bacteria | 13592 |
| 221 | Ga0207643_10319711 | 3300025908 | Unclassified | 969 |
| 222 | Ga0207705_10006869 | 3300025909 | Bacteria | 8412 |
| 223 | Ga0207684_10066919 | 3300025910 | Bacteria | 3052 |
| 224 | Ga0207684_10123935 | 3300025910 | Bacteria | 2216 |
| 225 | Ga0207684_10149007 | 3300025910 | Bacteria | 2013 |
| 226 | Ga0207707_10003093 | 3300025912 | Bacteria | 14761 |
| 227 | Ga0207707_10145049 | 3300025912 | Bacteria | 2075 |
| 228 | Ga0207707_10148092 | 3300025912 | Bacteria | 2052 |
| 229 | Ga0207707_10188350 | 3300025912 | Bacteria | 1800 |
| 230 | Ga0207707_10695881 | 3300025912 | Bacteria | 854 |
| 231 | Ga0207695_10024627 | 3300025913 | Bacteria | 6763 |
| 232 | Ga0207695_10041943 | 3300025913 | Bacteria | 4893 |
| 233 | Ga0207695_10228239 | 3300025913 | Bacteria | 1767 |
| 234 | Ga0207693_10000175 | 3300025915 | Bacteria | 58611 |
| 235 | Ga0207693_10005241 | 3300025915 | Bacteria | 10848 |
| 236 | Ga0207693_10124745 | 3300025915 | Bacteria | 2023 |
| 237 | Ga0207660_10016180 | 3300025917 | Bacteria | 4934 |
| 238 | Ga0207660_10169774 | 3300025917 | Bacteria | 1688 |
| 239 | Ga0207657_10002919 | 3300025919 | Bacteria | 18353 |
| 240 | Ga0207657_10007326 | 3300025919 | Bacteria | 11318 |
| 241 | Ga0207657_10009371 | 3300025919 | Bacteria | 9848 |
| 242 | Ga0207657_10027664 | 3300025919 | Bacteria | 5189 |
| 243 | Ga0207657_10045707 | 3300025919 | Bacteria | 3840 |
| 244 | Ga0207657_10046866 | 3300025919 | Bacteria | 3784 |
| 245 | Ga0207657_10053684 | 3300025919 | Bacteria | 3490 |
| 246 | Ga0207652_10045947 | 3300025921 | Bacteria | 3724 |
| 247 | Ga0207652_10224814 | 3300025921 | Bacteria | 1691 |
| 248 | Ga0207652_10236495 | 3300025921 | Bacteria | 1646 |
| 249 | Ga0207646_10000903 | 3300025922 | Bacteria | 38217 |
| 250 | Ga0207646_10013338 | 3300025922 | Bacteria | 7862 |
| 251 | Ga0207646_10265206 | 3300025922 | Bacteria | 1552 |
| 252 | Ga0207694_10102242 | 3300025924 | Bacteria | 2272 |
| 253 | Ga0207694_10235330 | 3300025924 | Bacteria | 1496 |
| 254 | Ga0207650_10018208 | 3300025925 | Bacteria | 4926 |
| 255 | Ga0207659_10156237 | 3300025926 | Bacteria | 1786 |
| 256 | Ga0207687_10259134 | 3300025927 | Bacteria | 1386 |
| 257 | Ga0207700_10680183 | 3300025928 | Bacteria | 918 |
| 258 | Ga0207664_10014135 | 3300025929 | Bacteria | 5756 |
| 259 | Ga0207664_10056229 | 3300025929 | Bacteria | 3125 |
| 260 | Ga0207664_10066412 | 3300025929 | Bacteria | 2891 |
| 261 | Ga0207664_10169161 | 3300025929 | Bacteria | 1869 |
| 262 | Ga0207664_10224073 | 3300025929 | Bacteria | 1632 |
| 263 | Ga0207664_10230705 | 3300025929 | Bacteria | 1609 |
| 264 | Ga0207664_10377730 | 3300025929 | Bacteria | 1258 |
| 265 | Ga0207664_10536220 | 3300025929 | Bacteria | 1049 |
| 266 | Ga0207644_10125205 | 3300025931 | Bacteria | 1961 |
| 267 | Ga0207690_10143537 | 3300025932 | Bacteria | 1762 |
| 268 | Ga0207690_10166348 | 3300025932 | Bacteria | 1648 |
| 269 | Ga0207690_10254007 | 3300025932 | Bacteria | 1359 |
| 270 | Ga0207706_10007998 | 3300025933 | Bacteria | 9761 |
| 271 | Ga0207706_10142098 | 3300025933 | Bacteria | 2112 |
| 272 | Ga0207669_10002491 | 3300025937 | Bacteria | 7855 |
| 273 | Ga0207669_10074594 | 3300025937 | Bacteria | 2146 |
| 274 | Ga0207669_10098358 | 3300025937 | Bacteria | 1927 |
| 275 | Ga0207665_10010583 | 3300025939 | Bacteria | 6058 |
| 276 | Ga0207691_10004674 | 3300025940 | Bacteria | 13258 |
| 277 | Ga0207711_10312537 | 3300025941 | Bacteria | 1451 |
| 278 | Ga0207689_10174339 | 3300025942 | Unclassified | 1773 |
| 279 | Ga0207661_10040413 | 3300025944 | Bacteria | 3666 |
| 280 | Ga0207661_10161114 | 3300025944 | Bacteria | 1946 |
| 281 | Ga0207661_10325895 | 3300025944 | Bacteria | 1382 |
| 282 | Ga0207661_10547560 | 3300025944 | Bacteria | 1060 |
| 283 | Ga0207679_10076890 | 3300025945 | Bacteria | 2538 |
| 284 | Ga0207679_10425207 | 3300025945 | Bacteria | 1173 |
| 285 | Ga0207667_10675803 | 3300025949 | Bacteria | 1036 |
| 286 | Ga0207667_10763371 | 3300025949 | Bacteria | 965 |
| 287 | Ga0207651_10216597 | 3300025960 | Bacteria | 1545 |
| 288 | Ga0207712_10101840 | 3300025961 | Bacteria | 2137 |
| 289 | Ga0207712_10319867 | 3300025961 | Bacteria | 1280 |
| 290 | Ga0207668_10170096 | 3300025972 | Bacteria | 1708 |
| 291 | Ga0207668_10421504 | 3300025972 | Bacteria | 1133 |
| 292 | Ga0207640_10395281 | 3300025981 | Bacteria | 1124 |
| 293 | Ga0207658_10435372 | 3300025986 | Bacteria | 1159 |
| 294 | Ga0207677_10337042 | 3300026023 | Bacteria | 1259 |
| 295 | Ga0207703_10148456 | 3300026035 | Bacteria | 2042 |
| 296 | Ga0207639_10365298 | 3300026041 | Bacteria | 1292 |
| 297 | Ga0207639_10403310 | 3300026041 | Bacteria | 1232 |
| 298 | Ga0207708_10006150 | 3300026075 | Bacteria | 8900 |
| 299 | Ga0207708_10022931 | 3300026075 | Bacteria | 4715 |
| 300 | Ga0207708_10053844 | 3300026075 | Bacteria | 3067 |
| 301 | Ga0207702_10020325 | 3300026078 | Bacteria | 5500 |
| 302 | Ga0207702_10084955 | 3300026078 | Bacteria | 2757 |
| 303 | Ga0207641_10116902 | 3300026088 | Bacteria | 2374 |
| 304 | Ga0207648_10000150 | 3300026089 | Bacteria | 70019 |
| 305 | Ga0207648_10001463 | 3300026089 | Bacteria | 25973 |
| 306 | Ga0207674_10012665 | 3300026116 | Bacteria | 9424 |
| 307 | Ga0207674_10047390 | 3300026116 | Bacteria | 4407 |
| 308 | Ga0207675_100017001 | 3300026118 | Bacteria | 6797 |
| 309 | Ga0207675_100020233 | 3300026118 | Bacteria | 6205 |
| 310 | Ga0207683_10000131 | 3300026121 | Bacteria | 61423 |
| 311 | Ga0207683_10066955 | 3300026121 | Bacteria | 3168 |
| 312 | Ga0207683_10290332 | 3300026121 | Bacteria | 1495 |
| 313 | Ga0209966_1020534 | 3300027695 | Bacteria | 1280 |
| 314 | Ga0207428_10012901 | 3300027907 | Bacteria | 7328 |
| 315 | Ga0268266_10081625 | 3300028379 | Bacteria | 2820 |
| 316 | Ga0265319_1005673 | 3300028563 | Bacteria | 5928 |
| 317 | Ga0265319_1005744 | 3300028563 | Bacteria | 5876 |
| 318 | Ga0265334_10046396 | 3300028573 | Bacteria | 1679 |
| 319 | Ga0265318_10000834 | 3300028577 | Bacteria | 20283 |
| 320 | Ga0265318_10011876 | 3300028577 | Bacteria | 3727 |
| 321 | Ga0265323_10028518 | 3300028653 | Bacteria | 2093 |
| 322 | Ga0265322_10016600 | 3300028654 | Bacteria | 2125 |
| 323 | Ga0265322_10018877 | 3300028654 | Bacteria | 1980 |
| 324 | Ga0265336_10035669 | 3300028666 | Bacteria | 1533 |
| 325 | Ga0265338_10016043 | 3300028800 | Bacteria | 8182 |
| 326 | Ga0265338_10036385 | 3300028800 | Bacteria | 4712 |
| 327 | Ga0265338_10063620 | 3300028800 | Bacteria | 3215 |
| 328 | Ga0265338_10349495 | 3300028800 | Unclassified | 1063 |
| 329 | Ga0265324_10096230 | 3300029957 | Bacteria | 1007 |
| 330 | Ga0265330_10006324 | 3300031235 | Bacteria | 5855 |
| 331 | Ga0265332_10002374 | 3300031238 | Bacteria | 9598 |
| 332 | Ga0265332_10028478 | 3300031238 | Bacteria | 2445 |
| 333 | Ga0265328_10011998 | 3300031239 | Bacteria | 3454 |
| 334 | Ga0265320_10081349 | 3300031240 | Bacteria | 1511 |
| 335 | Ga0265325_10052766 | 3300031241 | Bacteria | 2086 |
| 336 | Ga0265325_10058447 | 3300031241 | Bacteria | 1964 |
| 337 | Ga0265329_10002938 | 3300031242 | Bacteria | 7586 |
| 338 | Ga0265340_10006769 | 3300031247 | Bacteria | 6271 |
| 339 | Ga0265339_10003289 | 3300031249 | Bacteria | 11317 |
| 340 | Ga0265331_10031227 | 3300031250 | Bacteria | 2647 |
| 341 | Ga0265331_10100154 | 3300031250 | Bacteria | 1334 |
| 342 | Ga0265327_10038720 | 3300031251 | Bacteria | 2598 |
| 343 | Ga0265327_10077245 | 3300031251 | Bacteria | 1652 |
| 344 | Ga0265316_10078049 | 3300031344 | Bacteria | 2542 |
| 345 | Ga0265313_10009032 | 3300031595 | Bacteria | 6531 |
| 346 | Ga0265313_10014012 | 3300031595 | Bacteria | 4773 |
| 347 | Ga0265313_10034822 | 3300031595 | Bacteria | 2541 |
| 348 | Ga0265314_10050996 | 3300031711 | Bacteria | 2884 |
| 349 | Ga0265314_10161043 | 3300031711 | Bacteria | 1365 |
| 350 | Ga0265314_10168361 | 3300031711 | Bacteria | 1325 |
| 351 | Ga0265314_10230285 | 3300031711 | Bacteria | 1075 |
| 352 | Ga0265342_10015437 | 3300031712 | Bacteria | 5021 |
| 353 | Ga0307406_10462169 | 3300031901 | Unclassified | 1021 |
| 354 | Ga0307416_100043566 | 3300032002 | Bacteria | 3515 |
| 355 | Ga0373926_0008664 | 3300035083 | Bacteria | 3385 |
| 356 | Ga0373926_0015810 | 3300035083 | Bacteria | 2575 |
| 357 | Ga0373926_0023801 | 3300035083 | Unclassified | 2129 |
| 358 | Ga0373936_0066756 | 3300035113 | Unclassified | 1477 |
| 359 | Ga0373945_0004925 | 3300035116 | Bacteria | 4256 |
| 360 | Ga0373945_0014403 | 3300035116 | Bacteria | 2649 |
| 361 | Ga0373960_0064192 | 3300035121 | Bacteria | 1121 |
| 362 | Ga0373943_0001000 | 3300035170 | Bacteria | 12558 |
| 363 | Ga0373943_0002001 | 3300035170 | Bacteria | 9230 |
| 364 | Ga0373943_0046038 | 3300035170 | Bacteria | 2128 |
| 365 | Ga0373943_0115303 | 3300035170 | Bacteria | 1422 |
| 366 | Ga0373946_0003724 | 3300035171 | Bacteria | 5404 |
| 367 | Ga0373946_0029677 | 3300035171 | Bacteria | 2179 |
| 368 | Ga0373931_0127783 | 3300035691 | Bacteria | 1460 |
| 369 | Ga0373935_0019335 | 3300035692 | Bacteria | 4154 |
| 370 | Ga0373935_0106225 | 3300035692 | Bacteria | 1858 |
| 371 | Ga0373935_0133157 | 3300035692 | Bacteria | 1672 |
| 372 | Ga0373927_0007065 | 3300035695 | Bacteria | 7613 |
| 373 | Ga0373947_0002467 | 3300035725 | Bacteria | 11129 |
| 374 | Ga0373947_0003941 | 3300035725 | Bacteria | 8722 |
| 375 | Ga0373947_0126504 | 3300035725 | Bacteria | 1628 |
| 376 | Ga0373925_0001527 | 3300037068 | Bacteria | 19753 |
| 377 | Ga0373925_0002820 | 3300037068 | Bacteria | 13703 |
| 378 | Ga0373925_0353973 | 3300037068 | Bacteria | 1193 |
| 379 | Ga0373925_0502926 | 3300037068 | Bacteria | 995 |
| 380 | Ga0395899_0008878 | 3300037312 | Bacteria | 7738 |
| 381 | Ga0395899_0044967 | 3300037312 | Bacteria | 3289 |
| 382 | Ga0395899_0083996 | 3300037312 | Bacteria | 2315 |
| 383 | Ga0395899_0148286 | 3300037312 | Bacteria | 1664 |
| 384 | Ga0395900_0016257 | 3300037418 | Bacteria | 7583 |
| 385 | Ga0395900_0019099 | 3300037418 | Bacteria | 6989 |
| 386 | Ga0395900_0026336 | 3300037418 | Bacteria | 5955 |
| 387 | Ga0395900_0028374 | 3300037418 | Bacteria | 5732 |
| 388 | Ga0395900_0140280 | 3300037418 | Bacteria | 2475 |
| 389 | Ga0395900_0171796 | 3300037418 | Bacteria | 2206 |
| 390 | Ga0395900_0735882 | 3300037418 | Bacteria | 917 |
| 391 | Ga0395898_0016502 | 3300037466 | Bacteria | 7554 |
| 392 | Ga0395898_0020075 | 3300037466 | Bacteria | 6790 |
| 393 | Ga0395898_0054427 | 3300037466 | Bacteria | 3905 |
| 394 | Ga0395898_0058561 | 3300037466 | Bacteria | 3750 |
| 395 | Ga0395898_0072804 | 3300037466 | Bacteria | 3319 |
| 396 | Ga0395898_0117585 | 3300037466 | Bacteria | 2547 |
| 397 | Ga0395898_0154098 | 3300037466 | Bacteria | 2198 |
| 398 | Ga0395898_0430893 | 3300037466 | Bacteria | 1257 |
| 399 | Ga0395898_0495078 | 3300037466 | Bacteria | 1163 |
| 400 | Ga0395905_0022721 | 3300037471 | Bacteria | 5930 |
| 401 | Ga0395905_0035769 | 3300037471 | Bacteria | 4664 |
| 402 | Ga0395905_0059823 | 3300037471 | Bacteria | 3562 |
| 403 | Ga0395905_0142481 | 3300037471 | Bacteria | 2254 |
| 404 | Ga0395901_0018485 | 3300038443 | Bacteria | 7116 |
| 405 | Ga0395901_0035704 | 3300038443 | Bacteria | 5136 |
| 406 | Ga0395901_0053799 | 3300038443 | Bacteria | 4183 |
| 407 | Ga0395901_0057906 | 3300038443 | Bacteria | 4030 |
| 408 | Ga0395901_0139848 | 3300038443 | Bacteria | 2544 |
| 409 | Ga0395901_0159848 | 3300038443 | Bacteria | 2366 |
| 410 | Ga0395901_0244881 | 3300038443 | Bacteria | 1869 |
| 411 | Ga0395901_0697920 | 3300038443 | Bacteria | 1013 |
| 412 | Ga0439439_0004018 | 3300041406 | Bacteria | 3282 |
| 413 | Ga0439461_0039326 | 3300041410 | Bacteria | 1016 |
| 414 | Ga0451853_2920526 | 3300041512 | Bacteria | 1565 |
| 415 | Ga0439431_0029845 | 3300041997 | Bacteria | 1348 |
| 416 | Ga0450920_001273 | 3300042122 | Bacteria | 4147 |
| 417 | Ga0439446_0001447 | 3300042156 | Bacteria | 5415 |
| 418 | Ga0439434_0004304 | 3300042435 | Bacteria | 4161 |
| 419 | Ga0466961_0036487 | 3300044693 | Bacteria | 3155 |
| 420 | Ga0466963_0007240 | 3300044694 | Bacteria | 6617 |
| 421 | Ga0466963_0009165 | 3300044694 | Bacteria | 5953 |
| 422 | Ga0466963_0015568 | 3300044694 | Bacteria | 4712 |
| 423 | Ga0466963_0074598 | 3300044694 | Bacteria | 2288 |
| 424 | Ga0466963_0184361 | 3300044694 | Bacteria | 1457 |
| 425 | Ga0466963_0321593 | 3300044694 | Bacteria | 1089 |
| 426 | Ga0466963_0468949 | 3300044694 | Bacteria | 888 |
| 427 | Ga0466964_0007647 | 3300044706 | Bacteria | 4044 |
| 428 | Ga0466964_0041586 | 3300044706 | Bacteria | 1860 |
| 429 | Ga0466971_0008935 | 3300044719 | Bacteria | 4379 |
| 430 | Ga0466957_0008381 | 3300044842 | Bacteria | 5877 |
| 431 | Ga0466957_0029107 | 3300044842 | Bacteria | 3292 |
| 432 | Ga0466957_0056010 | 3300044842 | Bacteria | 2410 |
| 433 | Ga0466960_0014989 | 3300044901 | Bacteria | 3333 |
| 434 | Ga0466959_0017268 | 3300045049 | Bacteria | 5287 |
| 435 | Ga0466959_0021488 | 3300045049 | Bacteria | 4759 |
| 436 | Ga0451576_0009360 | 3300045051 | Bacteria | 11361 |
| 437 | Ga0466958_0041429 | 3300045836 | Bacteria | 2769 |
| 438 | Ga0466958_0062080 | 3300045836 | Bacteria | 2277 |
| 439 | Ga0466967_0001981 | 3300045976 | Bacteria | 12432 |
| 440 | Ga0466967_0015949 | 3300045976 | Bacteria | 5907 |
| 441 | Ga0466967_0036476 | 3300045976 | Bacteria | 4197 |
| 442 | Ga0466967_0051537 | 3300045976 | Unclassified | 3608 |
| 443 | Ga0466967_0060193 | 3300045976 | Bacteria | 3364 |
| 444 | Ga0466967_0062924 | 3300045976 | Bacteria | 3295 |
| 445 | Ga0466967_0262843 | 3300045976 | Bacteria | 1651 |
| 446 | Ga0466967_0270537 | 3300045976 | Bacteria | 1628 |
| 447 | Ga0466967_0321485 | 3300045976 | Bacteria | 1492 |
| 448 | Ga0466967_0375937 | 3300045976 | Bacteria | 1379 |
| 449 | Ga0466967_0662551 | 3300045976 | Bacteria | 1032 |
| 450 | Ga0466967_0675497 | 3300045976 | Bacteria | 1022 |
| 451 | Ga0466967_0724654 | 3300045976 | Bacteria | 986 |
| 452 | Ga0495592_0000124 | 3300046454 | Bacteria | 68396 |
| 453 | Ga0495592_0031471 | 3300046454 | Bacteria | 4010 |
| 454 | Ga0495603_0025144 | 3300046455 | Bacteria | 3601 |
| 455 | Ga0495603_0052357 | 3300046455 | Bacteria | 2424 |
| 456 | Ga0495603_0062326 | 3300046455 | Bacteria | 2202 |
| 457 | Ga0495603_0083414 | 3300046455 | Bacteria | 1872 |
| 458 | Ga0495629_0000607 | 3300046459 | Bacteria | 29151 |
| 459 | Ga0495629_0037964 | 3300046459 | Bacteria | 3394 |
| 460 | Ga0495629_0051069 | 3300046459 | Bacteria | 2894 |
| 461 | Ga0495629_0143366 | 3300046459 | Bacteria | 1662 |
| 462 | Ga0495629_0212613 | 3300046459 | Bacteria | 1335 |
| 463 | Ga0495641_0001116 | 3300046461 | Bacteria | 23103 |
| 464 | Ga0495641_0001867 | 3300046461 | Bacteria | 17290 |
| 465 | Ga0495641_0018285 | 3300046461 | Bacteria | 3620 |
| 466 | Ga0495641_0202946 | 3300046461 | Bacteria | 889 |
| 467 | Ga0495651_0000310 | 3300046462 | Bacteria | 37941 |
| 468 | Ga0495651_0116756 | 3300046462 | Bacteria | 1965 |
| 469 | Ga0495651_0202618 | 3300046462 | Unclassified | 1388 |
| 470 | Ga0495653_0000599 | 3300046463 | Bacteria | 27664 |
| 471 | Ga0495653_0010560 | 3300046463 | Bacteria | 7562 |
| 472 | Ga0495653_0045594 | 3300046463 | Bacteria | 3399 |
| 473 | Ga0495653_0111486 | 3300046463 | Bacteria | 1965 |
| 474 | Ga0495580_0067956 | 3300046472 | Bacteria | 2493 |
| 475 | Ga0495582_0000372 | 3300046473 | Bacteria | 24529 |
| 476 | Ga0495582_0003449 | 3300046473 | Bacteria | 8913 |
| 477 | Ga0495582_0030273 | 3300046473 | Bacteria | 2971 |
| 478 | Ga0495582_0047726 | 3300046473 | Bacteria | 2358 |
| 479 | Ga0495639_0001653 | 3300046475 | Bacteria | 9926 |
| 480 | Ga0495639_0003719 | 3300046475 | Bacteria | 6565 |
| 481 | Ga0495639_0025472 | 3300046475 | Bacteria | 2609 |
| 482 | Ga0495662_0000207 | 3300046476 | Bacteria | 24452 |
| 483 | Ga0495662_0024263 | 3300046476 | Bacteria | 2926 |
| 484 | Ga0495664_0002089 | 3300046477 | Bacteria | 10680 |
| 485 | Ga0495584_0029002 | 3300046491 | Bacteria | 2805 |
| 486 | Ga0495584_0102129 | 3300046491 | Unclassified | 1450 |
| 487 | Ga0495585_0110035 | 3300046492 | Bacteria | 1466 |
| 488 | Ga0495596_0055569 | 3300046500 | Unclassified | 1547 |
| 489 | Ga0495608_0001941 | 3300046511 | Bacteria | 14842 |
| 490 | Ga0495608_0017681 | 3300046511 | Bacteria | 4930 |
| 491 | Ga0495618_0000808 | 3300046514 | Bacteria | 21809 |
| 492 | Ga0495618_0010550 | 3300046514 | Bacteria | 5590 |
| 493 | Ga0495618_0053581 | 3300046514 | Bacteria | 2550 |
| 494 | Ga0495618_0097505 | 3300046514 | Bacteria | 1881 |
| 495 | Ga0495618_0184505 | 3300046514 | Bacteria | 1325 |
| 496 | Ga0495628_0000436 | 3300046516 | Bacteria | 37941 |
| 497 | Ga0495630_0016685 | 3300046517 | Bacteria | 5369 |
| 498 | Ga0495630_0021670 | 3300046517 | Bacteria | 4745 |
| 499 | Ga0495630_0028379 | 3300046517 | Bacteria | 4158 |
| 500 | Ga0495631_0035371 | 3300046518 | Bacteria | 2235 |
| 501 | Ga0495666_0000776 | 3300046526 | Bacteria | 14751 |
| 502 | Ga0495666_0058000 | 3300046526 | Bacteria | 1853 |
| 503 | Ga0495652_0000050 | 3300046529 | Bacteria | 120480 |
| 504 | Ga0495652_0003053 | 3300046529 | Bacteria | 16782 |
| 505 | Ga0495652_0185407 | 3300046529 | Bacteria | 1593 |
| 506 | Ga0495665_0000111 | 3300046531 | Bacteria | 38528 |
| 507 | Ga0495665_0001978 | 3300046531 | Bacteria | 11079 |
| 508 | Ga0495640_0056190 | 3300046533 | Bacteria | 2689 |
| 509 | Ga0495640_0066933 | 3300046533 | Bacteria | 2421 |
| 510 | Ga0495586_0011125 | 3300046535 | Bacteria | 4781 |
| 511 | Ga0495586_0133924 | 3300046535 | Bacteria | 1388 |
| 512 | Ga0495586_0162129 | 3300046535 | Bacteria | 1261 |
| 513 | Ga0495587_0000084 | 3300046536 | Bacteria | 72926 |
| 514 | Ga0495587_0109444 | 3300046536 | Bacteria | 1588 |
| 515 | Ga0495609_0101100 | 3300046538 | Bacteria | 1249 |
| 516 | Ga0495645_0000067 | 3300046543 | Bacteria | 73037 |
| 517 | Ga0495667_0013519 | 3300046559 | Bacteria | 5523 |
| 518 | Ga0495667_0023888 | 3300046559 | Bacteria | 4117 |
| 519 | Ga0495656_0219887 | 3300046615 | Bacteria | 949 |
| 520 | Ga0495634_0011063 | 3300046642 | Bacteria | 6584 |
| 521 | Ga0495634_0093685 | 3300046642 | Bacteria | 1947 |
| 522 | Ga0495634_0223989 | 3300046642 | Bacteria | 1159 |
| 523 | Ga0495634_0262590 | 3300046642 | Bacteria | 1053 |
| 524 | Ga0495635_0034594 | 3300046663 | Bacteria | 3505 |
| 525 | Ga0495635_0054154 | 3300046663 | Bacteria | 2763 |
| 526 | Ga0495635_0116528 | 3300046663 | Bacteria | 1823 |
| 527 | Ga0495635_0163289 | 3300046663 | Bacteria | 1515 |
| 528 | Ga0495588_0106877 | 3300046674 | Bacteria | 1473 |
| 529 | Ga0495657_0049340 | 3300046675 | Bacteria | 2836 |
| 530 | Ga0495657_0170437 | 3300046675 | Bacteria | 1341 |
| 531 | Ga0495599_0000009 | 3300046678 | Bacteria | 217299 |
| 532 | Ga0495599_0017375 | 3300046678 | Bacteria | 4472 |
| 533 | Ga0495623_0000264 | 3300046679 | Bacteria | 33990 |
| 534 | Ga0495646_0006633 | 3300046680 | Bacteria | 7341 |
| 535 | Ga0495646_0038952 | 3300046680 | Bacteria | 2932 |
| 536 | Ga0495658_0000911 | 3300046683 | Bacteria | 15814 |
| 537 | Ga0495658_0002150 | 3300046683 | Bacteria | 9972 |
| 538 | Ga0495658_0290176 | 3300046683 | Bacteria | 1033 |
| 539 | Ga0495613_0010614 | 3300046689 | Bacteria | 6831 |
| 540 | Ga0495613_0014535 | 3300046689 | Bacteria | 5840 |
| 541 | Ga0495613_0342421 | 3300046689 | Bacteria | 1028 |
| 542 | Ga0495624_0008092 | 3300046690 | Bacteria | 7360 |
| 543 | Ga0495624_0021127 | 3300046690 | Bacteria | 4322 |
| 544 | Ga0495624_0044908 | 3300046690 | Bacteria | 2815 |
| 545 | Ga0495624_0192181 | 3300046690 | Bacteria | 1241 |
| 546 | Ga0495624_0258811 | 3300046690 | Bacteria | 1052 |
| 547 | Ga0495600_0099056 | 3300046809 | Bacteria | 1900 |
| 548 | Ga0495581_0000303 | 3300047315 | Bacteria | 24088 |
| 549 | Ga0495581_0001922 | 3300047315 | Bacteria | 11649 |
| 550 | Ga0495581_0002796 | 3300047315 | Bacteria | 9962 |
| 551 | Ga0495581_0035944 | 3300047315 | Bacteria | 2865 |
| 552 | Ga0495581_0138328 | 3300047315 | Bacteria | 1420 |
| 553 | Ga0495581_0219629 | 3300047315 | Bacteria | 1111 |
| 554 | Ga0495604_0000608 | 3300047317 | Bacteria | 30795 |
| 555 | Ga0495674_0008104 | 3300047319 | Bacteria | 10026 |
| 556 | Ga0495674_0106339 | 3300047319 | Bacteria | 2383 |
| 557 | Ga0495676_0000450 | 3300047321 | Bacteria | 33719 |
| 558 | Ga0495676_0046057 | 3300047321 | Bacteria | 3544 |
| 559 | Ga0495676_0060958 | 3300047321 | Bacteria | 2953 |
| 560 | Ga0495676_0149495 | 3300047321 | Bacteria | 1664 |
| 561 | Ga0495680_0002792 | 3300047322 | Bacteria | 17600 |
| 562 | Ga0495680_0010144 | 3300047322 | Bacteria | 8419 |
| 563 | Ga0495680_0061547 | 3300047322 | Bacteria | 2887 |
| 564 | Ga0495675_0000363 | 3300047444 | Bacteria | 31622 |
| 565 | Ga0495684_0028355 | 3300047471 | Bacteria | 4298 |
| 566 | Ga0495684_0068354 | 3300047471 | Bacteria | 2701 |
| 567 | Ga0495684_0172704 | 3300047471 | Bacteria | 1606 |
| 568 | Ga0495593_0007244 | 3300047673 | Bacteria | 6498 |
| 569 | Ga0495593_0024859 | 3300047673 | Bacteria | 3315 |
| 570 | Ga0495602_0000234 | 3300048088 | Bacteria | 51947 |
| 571 | Ga0495614_0003528 | 3300048089 | Bacteria | 7008 |
| 572 | Ga0495614_0012807 | 3300048089 | Bacteria | 3680 |
| 573 | Ga0496100_0057462 | 3300048903 | Bacteria | 2548 |
| 574 | Ga0496100_0074261 | 3300048903 | Bacteria | 2278 |
| 575 | Ga0496101_0189236 | 3300048904 | Bacteria | 1588 |
| 576 | Ga0496101_0502574 | 3300048904 | Bacteria | 958 |
| 577 | Ga0496102_0026710 | 3300048905 | Bacteria | 5152 |
| 578 | Ga0496102_0301831 | 3300048905 | Bacteria | 1509 |
| 579 | Ga0496103_0224181 | 3300048906 | Bacteria | 1209 |
| 580 | Ga0496103_0248859 | 3300048906 | Bacteria | 1144 |
| 581 | Ga0496104_0028498 | 3300048907 | Bacteria | 5176 |
| 582 | Ga0496104_0087849 | 3300048907 | Bacteria | 2969 |
| 583 | Ga0496104_0175487 | 3300048907 | Bacteria | 2053 |
| 584 | Ga0496104_0241696 | 3300048907 | Bacteria | 1718 |
| 585 | Ga0496104_0510892 | 3300048907 | Bacteria | 1113 |
| 586 | Ga0496105_0027795 | 3300048908 | Bacteria | 4624 |
| 587 | Ga0496105_0212725 | 3300048908 | Bacteria | 1575 |
| 588 | Ga0496106_0033197 | 3300048909 | Bacteria | 3850 |
| 589 | Ga0496106_0170550 | 3300048909 | Bacteria | 1725 |
| 590 | Ga0496107_0024982 | 3300048910 | Bacteria | 4229 |
| 591 | Ga0496107_0237561 | 3300048910 | Bacteria | 1356 |
| 592 | Ga0496108_0013326 | 3300048911 | Bacteria | 6703 |
| 593 | Ga0496108_0037726 | 3300048911 | Bacteria | 4026 |
| 594 | Ga0496108_0039971 | 3300048911 | Bacteria | 3909 |
| 595 | Ga0496108_0040521 | 3300048911 | Bacteria | 3883 |
| 596 | Ga0496108_0177278 | 3300048911 | Bacteria | 1845 |
| 597 | Ga0496109_0001117 | 3300048912 | Bacteria | 22290 |
| 598 | Ga0496109_0002561 | 3300048912 | Bacteria | 15221 |
| 599 | Ga0496109_0039991 | 3300048912 | Bacteria | 4246 |
| 600 | Ga0496109_0078000 | 3300048912 | Bacteria | 3049 |
| 601 | Ga0496109_0164031 | 3300048912 | Bacteria | 2082 |
| 602 | Ga0496109_0229821 | 3300048912 | Bacteria | 1745 |
| 603 | Ga0496109_0379567 | 3300048912 | Bacteria | 1335 |
| 604 | Ga0496110_0013018 | 3300048913 | Bacteria | 6862 |
| 605 | Ga0496110_0017413 | 3300048913 | Bacteria | 6011 |
| 606 | Ga0496110_0046569 | 3300048913 | Bacteria | 3794 |
| 607 | Ga0496110_0089399 | 3300048913 | Bacteria | 2753 |
| 608 | Ga0496110_0113120 | 3300048913 | Bacteria | 2441 |
| 609 | Ga0496111_0002962 | 3300048914 | Bacteria | 10398 |
| 610 | Ga0496111_0016341 | 3300048914 | Bacteria | 5112 |
| 611 | Ga0496111_0322158 | 3300048914 | Bacteria | 1145 |
| 612 | Ga0496112_0000390 | 3300048915 | Bacteria | 28702 |
| 613 | Ga0496112_0029858 | 3300048915 | Bacteria | 5274 |
| 614 | Ga0496112_0031640 | 3300048915 | Bacteria | 5133 |
| 615 | Ga0496112_0040279 | 3300048915 | Bacteria | 4568 |
| 616 | Ga0496112_0114224 | 3300048915 | Bacteria | 2671 |
| 617 | Ga0496112_0122869 | 3300048915 | Bacteria | 2567 |
| 618 | Ga0496112_0187721 | 3300048915 | Bacteria | 2030 |
| 619 | Ga0496112_0228956 | 3300048915 | Bacteria | 1813 |
| 620 | Ga0496112_0284890 | 3300048915 | Bacteria | 1599 |
| 621 | Ga0496112_0505137 | 3300048915 | Bacteria | 1144 |
| 622 | Ga0496113_0079470 | 3300048916 | Bacteria | 2511 |
| 623 | Ga0496113_0090555 | 3300048916 | Bacteria | 2356 |
| 624 | Ga0496113_0157474 | 3300048916 | Bacteria | 1794 |
| 625 | Ga0496113_0204360 | 3300048916 | Unclassified | 1571 |
| 626 | Ga0496113_0210571 | 3300048916 | Bacteria | 1547 |
| 627 | Ga0496113_0605083 | 3300048916 | Bacteria | 878 |
| 628 | Ga0496114_0015424 | 3300048917 | Bacteria | 6146 |
| 629 | Ga0496114_0053541 | 3300048917 | Bacteria | 3364 |
| 630 | Ga0496114_0338679 | 3300048917 | Bacteria | 1330 |
| 631 | Ga0496114_0490626 | 3300048917 | Bacteria | 1087 |
| 632 | Ga0496114_0664647 | 3300048917 | Bacteria | 916 |
| 633 | Ga0496115_0008579 | 3300048918 | Bacteria | 7565 |
| 634 | Ga0496115_0137849 | 3300048918 | Bacteria | 2012 |
| 635 | Ga0496115_0250362 | 3300048918 | Bacteria | 1459 |
| 636 | Ga0501031_0000671 | 3300049568 | Bacteria | 20378 |
| 637 | Ga0501032_0000289 | 3300049569 | Bacteria | 42315 |
| 638 | Ga0501033_0001004 | 3300049570 | Bacteria | 25689 |
| 639 | Ga0501033_0135585 | 3300049570 | Bacteria | 1781 |
| 640 | Ga0501034_0151908 | 3300049571 | Bacteria | 2291 |
| 641 | Ga0501034_0326114 | 3300049571 | Unclassified | 1467 |
| 642 | Ga0501036_0001436 | 3300049572 | Bacteria | 18313 |
| 643 | Ga0501036_0118835 | 3300049572 | Bacteria | 2232 |
| 644 | Ga0501037_0000205 | 3300049573 | Bacteria | 53176 |
| 645 | Ga0501038_0001405 | 3300049574 | Bacteria | 22037 |
| 646 | Ga0501039_0000149 | 3300049575 | Bacteria | 47666 |
| 647 | Ga0501040_0000317 | 3300049576 | Bacteria | 28397 |
| 648 | Ga0501040_0036968 | 3300049576 | Bacteria | 3315 |
| 649 | Ga0501040_0152320 | 3300049576 | Bacteria | 1632 |
| 650 | Ga0501041_0004443 | 3300049577 | Bacteria | 8117 |
| 651 | Ga0501041_0021657 | 3300049577 | Bacteria | 3851 |
| 652 | Ga0501041_0203285 | 3300049577 | Bacteria | 1242 |
| 653 | Ga0501042_0000079 | 3300049578 | Bacteria | 36581 |
| 654 | Ga0501042_0031749 | 3300049578 | Bacteria | 3737 |
| 655 | Ga0501043_0000217 | 3300049579 | Bacteria | 52111 |
| 656 | Ga0501046_0000689 | 3300049580 | Bacteria | 32787 |
| 657 | Ga0501046_0035310 | 3300049580 | Bacteria | 4030 |
| 658 | Ga0501047_0030191 | 3300049581 | Bacteria | 5226 |
| 659 | Ga0501048_0000664 | 3300049582 | Bacteria | 24852 |
| 660 | Ga0501048_0021537 | 3300049582 | Bacteria | 4720 |
| 661 | Ga0501067_0043147 | 3300049583 | Bacteria | 2505 |
| 662 | Ga0501068_0003163 | 3300049584 | Bacteria | 8811 |
| 663 | Ga0501069_0002161 | 3300049585 | Bacteria | 9894 |
| 664 | Ga0501069_0065343 | 3300049585 | Bacteria | 2034 |
| 665 | Ga0501070_0003257 | 3300049586 | Bacteria | 14098 |
| 666 | Ga0501070_0105251 | 3300049586 | Bacteria | 2332 |
| 667 | Ga0501071_0000107 | 3300049587 | Bacteria | 32264 |
| 668 | Ga0501071_0152163 | 3300049587 | Bacteria | 1726 |
| 669 | Ga0501072_0005662 | 3300049588 | Bacteria | 9513 |
| 670 | Ga0501073_0001108 | 3300049589 | Bacteria | 19540 |
| 671 | Ga0501073_0270535 | 3300049589 | Bacteria | 1172 |
| 672 | Ga0501074_0003869 | 3300049590 | Bacteria | 10663 |
| 673 | Ga0501074_0020086 | 3300049590 | Bacteria | 4855 |
| 674 | Ga0501075_0000070 | 3300049591 | Bacteria | 45029 |
| 675 | Ga0501075_0119924 | 3300049591 | Bacteria | 2001 |
| 676 | Ga0501075_0206399 | 3300049591 | Bacteria | 1499 |
| 677 | Ga0501076_0000331 | 3300049592 | Bacteria | 29298 |
| 678 | Ga0501077_0003683 | 3300049593 | Bacteria | 9225 |
| 679 | Ga0501079_0000822 | 3300049741 | Bacteria | 21077 |
| 680 | Ga0501079_0091537 | 3300049741 | Bacteria | 2356 |
| 681 | Ga0501079_0100398 | 3300049741 | Bacteria | 2244 |
| 682 | Ga0501079_0477847 | 3300049741 | Bacteria | 979 |
| 683 | Ga0501080_0006430 | 3300049742 | Bacteria | 10544 |
| 684 | Ga0501080_0007960 | 3300049742 | Bacteria | 9604 |
| 685 | Ga0501081_0000820 | 3300049743 | Bacteria | 18365 |
| 686 | Ga0501081_0295328 | 3300049743 | Bacteria | 1188 |
| 687 | Ga0501083_0000086 | 3300049744 | Bacteria | 63536 |
| 688 | Ga0501035_0044330 | 3300049822 | Bacteria | 4006 |
| 689 | Ga0501044_0012086 | 3300049823 | Bacteria | 9352 |
| 690 | Ga0501045_0003841 | 3300049824 | Bacteria | 10336 |
| 691 | nmdc:mga00v17_116709_c1 | 3300050491 | Bacteria | 1697 |
| 692 | nmdc:mga05p37_379487_c1 | 3300050507 | Bacteria | 1657 |
| 693 | nmdc:mga05p37_81498_c1 | 3300050507 | Bacteria | 3986 |
| 694 | nmdc:mga09592_331721_c1 | 3300050508 | Bacteria | 1317 |
| 695 | nmdc:mga06r32_368682_c1 | 3300050510 | Bacteria | 1419 |
| 696 | nmdc:mga06r32_42646_c1 | 3300050510 | Bacteria | 4315 |
| 697 | nmdc:mga08y16_290301_c1 | 3300050511 | Bacteria | 1686 |
| 698 | nmdc:mga08y16_325245_c1 | 3300050511 | Bacteria | 1582 |
| 699 | nmdc:mga0n895_65577_c1 | 3300050512 | Bacteria | 3595 |
| 700 | nmdc:mga0rr50_6077_c1 | 3300050513 | Bacteria | 7297 |
| 701 | nmdc:mga0rr50_6103_c1 | 3300050513 | Bacteria | 7287 |
| 702 | nmdc:mga08x19_23434_c1 | 3300050514 | Bacteria | 3830 |
| 703 | nmdc:mga08x19_44008_c1 | 3300050514 | Bacteria | 2849 |
| 704 | nmdc:mga0a205_35909_c1 | 3300050515 | Bacteria | 4761 |
| 705 | Ga0495601_0009701 | 3300053077 | Bacteria | 5696 |
| 706 | Ga0495601_0020160 | 3300053077 | Bacteria | 4070 |
| 707 | Ga0495601_0042472 | 3300053077 | Bacteria | 2852 |
| 708 | Ga0495601_0120269 | 3300053077 | Bacteria | 1705 |
| 709 | Ga0495595_0152317 | 3300053084 | Bacteria | 1138 |
| 710 | Ga0495619_0003374 | 3300053085 | Bacteria | 10327 |
| 711 | Ga0495619_0020014 | 3300053085 | Bacteria | 4258 |
| 712 | Ga0495619_0115145 | 3300053085 | Bacteria | 1840 |
| 713 | Ga0495619_0265816 | 3300053085 | Bacteria | 1189 |
| 714 | Ga0501084_0008450 | 3300054114 | Bacteria | 8510 |
| 715 | Ga0501084_0162123 | 3300054114 | Bacteria | 1886 |
| 716 | Ga0590075_036243 | 3300059424 | Bacteria | 1257 |
| 717 | Ga0501082_0001195 | 3300060353 | Bacteria | 22857 |
| 718 | Ga0466962_0004082 | 3300061719 | Bacteria | 6993 |
| 719 | Ga0530510_0002191 | 3300061734 | Bacteria | 13395 |
| 720 | Ga0530510_0031417 | 3300061734 | Bacteria | 3818 |
| 721 | Ga0466963_0254649 | |||
| 722 | JGI25407J50210_10037201 | |||
| 723 | Ga0070658_10005067 | |||
| 724 | Ga0070658_10009665 | |||
| 725 | Ga0070658_10009919 | |||
| 726 | Ga0070658_10070161 | |||
| 727 | Ga0070658_10147864 | |||
| 728 | Ga0070683_100105842 | |||
| 729 | Ga0070683_100526989 | |||
| 730 | Ga0070690_100084102 | |||
| 731 | Ga0070690_100157982 | |||
| 732 | Ga0070670_100005965 | |||
| 733 | Ga0070680_100019068 | |||
| 734 | Ga0070680_100051865 | |||
| 735 | Ga0070680_100182113 | |||
| 736 | Ga0070682_100012208 | |||
| 737 | Ga0070660_100002084 | |||
| 738 | Ga0070660_100010360 | |||
| 739 | Ga0070660_100048195 | |||
| 740 | Ga0070660_100152987 | |||
| 741 | Ga0070660_100182903 | |||
| 742 | Ga0070691_10030649 | |||
| 743 | Ga0070691_10084725 | |||
| 744 | Ga0070687_100022052 | |||
| 745 | Ga0070661_100043113 | |||
| 746 | Ga0070661_100201216 | |||
| 747 | Ga0070692_10138913 | |||
| 748 | Ga0070668_100103455 | |||
| 749 | Ga0070669_100091266 | |||
| 750 | Ga0070675_100102959 | |||
| 751 | Ga0070674_100075814 | |||
| 752 | Ga0070674_100098402 | |||
| 753 | Ga0070673_100027107 | |||
| 754 | Ga0070688_100001335 | |||
| 755 | Ga0070659_100021168 | |||
| 756 | Ga0070659_100056044 | |||
| 757 | Ga0070659_100145364 | |||
| 758 | Ga0070667_100200917 | |||
| 759 | Ga0070709_10049886 | |||
| 760 | Ga0070709_10053605 | |||
| 761 | Ga0070709_10144083 | |||
| 762 | Ga0070714_100006363 | |||
| 763 | Ga0070714_100074192 | |||
| 764 | Ga0070714_100075914 | |||
| 765 | Ga0070714_100159092 | |||
| 766 | Ga0070714_100563244 | |||
| 767 | Ga0070713_100840974 | |||
| 768 | Ga0070710_10037317 | |||
| 769 | Ga0070710_10067735 | |||
| 770 | Ga0070701_10003191 | |||
| 771 | Ga0070701_10207469 | |||
| 772 | Ga0070711_100350104 | |||
| 773 | Ga0070705_100029659 | |||
| 774 | Ga0070705_100469145 | |||
| 775 | Ga0070700_100097775 | |||
| 776 | Ga0070700_100138578 | |||
| 777 | Ga0070700_100244197 | |||
| 778 | Ga0070694_100217499 | |||
| 779 | Ga0070694_100293979 | |||
| 780 | Ga0070708_100030482 | |||
| 781 | Ga0070708_100115088 | |||
| 782 | Ga0070708_100224126 | |||
| 783 | Ga0070663_100008657 | |||
| 784 | Ga0070678_100173500 | |||
| 785 | Ga0070678_100204323 | |||
| 786 | Ga0070681_10000870 | |||
| 787 | Ga0070681_10011999 | |||
| 788 | Ga0070681_10026180 | |||
| 789 | Ga0070681_10145933 | |||
| 790 | Ga0070681_10350767 | |||
| 791 | Ga0068867_100002315 | |||
| 792 | Ga0068867_100112829 | |||
| 793 | Ga0070685_10319166 | |||
| 794 | Ga0070706_100009221 | |||
| 795 | Ga0070706_100025664 | |||
| 796 | Ga0070706_100104135 | |||
| 797 | Ga0070706_100157001 | |||
| 798 | Ga0070707_100000499 | |||
| 799 | Ga0070707_100102187 | |||
| 800 | Ga0070698_100007169 | |||
| 801 | Ga0070698_100169895 | |||
| 802 | Ga0070698_100366559 | |||
| 803 | Ga0070699_100086802 | |||
| 804 | Ga0070699_100395669 | |||
| 805 | Ga0070679_100115648 | |||
| 806 | Ga0070679_100199946 | |||
| 807 | Ga0070679_100256105 | |||
| 808 | Ga0070679_100299398 | |||
| 809 | Ga0070679_100308169 | |||
| 810 | Ga0070684_100082322 | |||
| 811 | Ga0070684_100207147 | |||
| 812 | Ga0070684_100360737 | |||
| 813 | Ga0070697_100128269 | |||
| 814 | Ga0068853_100080154 | |||
| 815 | Ga0068853_100479422 | |||
| 816 | Ga0070686_100005644 | |||
| 817 | Ga0070686_100024086 | |||
| 818 | Ga0070695_100000005 | |||
| 819 | Ga0070695_100046805 | |||
| 820 | Ga0070695_100133470 | |||
| 821 | Ga0070696_100027543 | |||
| 822 | Ga0070696_100036365 | |||
| 823 | Ga0070665_100038717 | |||
| 824 | Ga0070704_100010268 | |||
| 825 | Ga0070704_100091223 | |||
| 826 | Ga0070704_100108666 | |||
| 827 | Ga0070704_100294556 | |||
| 828 | Ga0068855_100213971 | |||
| 829 | Ga0068855_100679432 | |||
| 830 | Ga0070664_100142699 | |||
| 831 | Ga0070664_100164740 | |||
| 832 | Ga0070664_100343299 | |||
| 833 | Ga0068857_100007868 | |||
| 834 | Ga0068857_100038703 | |||
| 835 | Ga0068857_100232741 | |||
| 836 | Ga0068857_100375824 | |||
| 837 | Ga0068854_100048671 | |||
| 838 | Ga0068856_100141424 | |||
| 839 | Ga0068856_100174252 | |||
| 840 | Ga0068856_100567044 | |||
| 841 | Ga0068856_100750185 | |||
| 842 | Ga0070702_100012206 | |||
| 843 | Ga0070702_100076447 | |||
| 844 | Ga0068852_100127396 | |||
| 845 | Ga0068852_100392871 | |||
| 846 | Ga0068866_10005257 | |||
| 847 | Ga0068866_10096757 | |||
| 848 | Ga0068870_10001681 | |||
| 849 | Ga0068863_100220564 | |||
| 850 | Ga0068860_100100032 | |||
| 851 | Ga0068860_100176733 | |||
| 852 | Ga0081455_10010902 | |||
| 853 | Ga0081455_10127859 | |||
| 854 | Ga0081538_10000531 | |||
| 855 | Ga0081538_10006735 | |||
| 856 | Ga0081538_10126919 | |||
| 857 | Ga0081539_10001582 | |||
| 858 | Ga0070717_10010897 | |||
| 859 | Ga0070717_10011613 | |||
| 860 | Ga0070717_10012034 | |||
| 861 | Ga0070717_10053273 | |||
| 862 | Ga0070717_10106177 | |||
| 863 | Ga0070717_10248596 | |||
| 864 | Ga0075365_10175590 | |||
| 865 | Ga0075364_10015843 | |||
| 866 | Ga0075432_10016731 | |||
| 867 | Ga0070716_100136889 | |||
| 868 | Ga0070712_100083999 | |||
| 869 | Ga0068871_100059434 | |||
| 870 | Ga0068871_100288602 | |||
| 871 | Ga0075428_100359776 | |||
| 872 | Ga0075431_100049253 | |||
| 873 | Ga0075431_100343762 | |||
| 874 | Ga0075433_10061216 | |||
| 875 | Ga0075433_10062999 | |||
| 876 | Ga0068865_100008726 | |||
| 877 | Ga0068865_100213549 | |||
| 878 | Ga0075436_100009010 | |||
| 879 | Ga0075435_100020369 | |||
| 880 | Ga0075435_100021671 | |||
| 881 | Ga0105240_10010278 | |||
| 882 | Ga0105240_10290427 | |||
| 883 | Ga0111539_10026631 | |||
| 884 | Ga0111539_10070886 | |||
| 885 | Ga0111539_10250925 | |||
| 886 | Ga0111539_10362946 | |||
| 887 | Ga0111539_10840104 | |||
| 888 | Ga0105245_10097836 | |||
| 889 | Ga0105245_10121059 | |||
| 890 | Ga0105247_10287186 | |||
| 891 | Ga0114129_10073321 | |||
| 892 | Ga0114129_10113350 | |||
| 893 | Ga0105243_10020894 | |||
| 894 | Ga0105243_10336224 | |||
| 895 | Ga0105242_10011334 | |||
| 896 | Ga0105248_10170911 | |||
| 897 | Ga0105248_10604925 | |||
| 898 | Ga0105237_10113772 | |||
| 899 | Ga0105237_10265665 | |||
| 900 | Ga0105238_10243998 | |||
| 901 | Ga0105249_10036376 | |||
| 902 | Ga0105249_10115126 | |||
| 903 | Ga0105239_10089971 | |||
| 904 | Ga0105239_10122930 | |||
| 905 | Ga0105239_10509577 | |||
| 906 | Ga0157371_10012788 | |||
| 907 | Ga0157370_10007418 | |||
| 908 | Ga0157370_10073012 | |||
| 909 | Ga0157370_10212724 | |||
| 910 | Ga0157370_10243339 | |||
| 911 | Ga0157369_10003200 | |||
| 912 | Ga0157369_10048500 | |||
| 913 | Ga0157369_10108289 | |||
| 914 | Ga0157369_10401179 | |||
| 915 | Ga0157374_10001910 | |||
| 916 | Ga0157378_10068324 | |||
| 917 | Ga0163162_10022800 | |||
| 918 | Ga0163162_10333502 | |||
| 919 | Ga0157375_10014891 | |||
| 920 | Ga0157375_10071713 | |||
| 921 | Ga0157375_10147870 | |||
| 922 | Ga0157375_10223878 | |||
| 923 | Ga0157375_10224644 | |||
| 924 | Ga0157380_10087954 | |||
| 925 | Ga0182008_10026919 | |||
| 926 | Ga0182008_10067478 | |||
| 927 | Ga0157377_10002074 | |||
| 928 | Ga0157376_10008931 | |||
| 929 | Ga0157376_10021984 | |||
| 930 | Ga0157376_10220874 | |||
| 931 | Ga0163161_10119548 | |||
| 932 | Ga0197907_11168973 | |||
| 933 | Ga0206356_10015860 | |||
| 934 | Ga0206356_11892464 | |||
| 935 | Ga0206354_11647680 | |||
| 936 | Ga0206353_10474326 | |||
| 937 | Ga0206353_11246867 | |||
| 938 | Ga0207692_10041910 | |||
| 939 | Ga0207688_10115413 | |||
| 940 | Ga0207643_10001454 | |||
| 941 | Ga0207643_10319711 | |||
| 942 | Ga0207705_10006869 | |||
| 943 | Ga0207684_10066919 | |||
| 944 | Ga0207684_10123935 | |||
| 945 | Ga0207684_10149007 | |||
| 946 | Ga0207707_10003093 | |||
| 947 | Ga0207707_10145049 | |||
| 948 | Ga0207707_10148092 | |||
| 949 | Ga0207707_10188350 | |||
| 950 | Ga0207707_10695881 | |||
| 951 | Ga0207695_10024627 | |||
| 952 | Ga0207695_10041943 | |||
| 953 | Ga0207695_10228239 | |||
| 954 | Ga0207693_10000175 | |||
| 955 | Ga0207693_10005241 | |||
| 956 | Ga0207693_10124745 | |||
| 957 | Ga0207660_10016180 | |||
| 958 | Ga0207660_10169774 | |||
| 959 | Ga0207657_10002919 | |||
| 960 | Ga0207657_10007326 | |||
| 961 | Ga0207657_10009371 | |||
| 962 | Ga0207657_10027664 | |||
| 963 | Ga0207657_10045707 | |||
| 964 | Ga0207657_10046866 | |||
| 965 | Ga0207657_10053684 | |||
| 966 | Ga0207652_10045947 | |||
| 967 | Ga0207652_10224814 | |||
| 968 | Ga0207652_10236495 | |||
| 969 | Ga0207646_10000903 | |||
| 970 | Ga0207646_10013338 | |||
| 971 | Ga0207646_10265206 | |||
| 972 | Ga0207694_10102242 | |||
| 973 | Ga0207694_10235330 | |||
| 974 | Ga0207650_10018208 | |||
| 975 | Ga0207659_10156237 | |||
| 976 | Ga0207687_10259134 | |||
| 977 | Ga0207700_10680183 | |||
| 978 | Ga0207664_10014135 | |||
| 979 | Ga0207664_10056229 | |||
| 980 | Ga0207664_10066412 | |||
| 981 | Ga0207664_10169161 | |||
| 982 | Ga0207664_10224073 | |||
| 983 | Ga0207664_10230705 | |||
| 984 | Ga0207664_10377730 | |||
| 985 | Ga0207664_10536220 | |||
| 986 | Ga0207644_10125205 | |||
| 987 | Ga0207690_10143537 | |||
| 988 | Ga0207690_10166348 | |||
| 989 | Ga0207690_10254007 | |||
| 990 | Ga0207706_10007998 | |||
| 991 | Ga0207706_10142098 | |||
| 992 | Ga0207669_10002491 | |||
| 993 | Ga0207669_10074594 | |||
| 994 | Ga0207669_10098358 | |||
| 995 | Ga0207665_10010583 | |||
| 996 | Ga0207691_10004674 | |||
| 997 | Ga0207711_10312537 | |||
| 998 | Ga0207689_10174339 | |||
| 999 | Ga0207661_10040413 | |||
| 1000 | Ga0207661_10161114 | |||
| 1001 | Ga0207661_10325895 | |||
| 1002 | Ga0207661_10547560 | |||
| 1003 | Ga0207679_10076890 | |||
| 1004 | Ga0207679_10425207 | |||
| 1005 | Ga0207667_10675803 | |||
| 1006 | Ga0207667_10763371 | |||
| 1007 | Ga0207651_10216597 | |||
| 1008 | Ga0207712_10101840 | |||
| 1009 | Ga0207712_10319867 | |||
| 1010 | Ga0207668_10170096 | |||
| 1011 | Ga0207668_10421504 | |||
| 1012 | Ga0207640_10395281 | |||
| 1013 | Ga0207658_10435372 | |||
| 1014 | Ga0207677_10337042 | |||
| 1015 | Ga0207703_10148456 | |||
| 1016 | Ga0207639_10365298 | |||
| 1017 | Ga0207639_10403310 | |||
| 1018 | Ga0207708_10006150 | |||
| 1019 | Ga0207708_10022931 | |||
| 1020 | Ga0207708_10053844 | |||
| 1021 | Ga0207702_10020325 | |||
| 1022 | Ga0207702_10084955 | |||
| 1023 | Ga0207641_10116902 | |||
| 1024 | Ga0207648_10000150 | |||
| 1025 | Ga0207648_10001463 | |||
| 1026 | Ga0207674_10012665 | |||
| 1027 | Ga0207674_10047390 | |||
| 1028 | Ga0207675_100017001 | |||
| 1029 | Ga0207675_100020233 | |||
| 1030 | Ga0207683_10000131 | |||
| 1031 | Ga0207683_10066955 | |||
| 1032 | Ga0207683_10290332 | |||
| 1033 | Ga0209966_1020534 | |||
| 1034 | Ga0207428_10012901 | |||
| 1035 | Ga0268266_10081625 | |||
| 1036 | Ga0265319_1005673 | |||
| 1037 | Ga0265319_1005744 | |||
| 1038 | Ga0265334_10046396 | |||
| 1039 | Ga0265318_10000834 | |||
| 1040 | Ga0265318_10011876 | |||
| 1041 | Ga0265323_10028518 | |||
| 1042 | Ga0265322_10016600 | |||
| 1043 | Ga0265322_10018877 | |||
| 1044 | Ga0265336_10035669 | |||
| 1045 | Ga0265338_10016043 | |||
| 1046 | Ga0265338_10036385 | |||
| 1047 | Ga0265338_10063620 | |||
| 1048 | Ga0265338_10349495 | |||
| 1049 | Ga0265324_10096230 | |||
| 1050 | Ga0265330_10006324 | |||
| 1051 | Ga0265332_10002374 | |||
| 1052 | Ga0265332_10028478 | |||
| 1053 | Ga0265328_10011998 | |||
| 1054 | Ga0265320_10081349 | |||
| 1055 | Ga0265325_10052766 | |||
| 1056 | Ga0265325_10058447 | |||
| 1057 | Ga0265329_10002938 | |||
| 1058 | Ga0265340_10006769 | |||
| 1059 | Ga0265339_10003289 | |||
| 1060 | Ga0265331_10031227 | |||
| 1061 | Ga0265331_10100154 | |||
| 1062 | Ga0265327_10038720 | |||
| 1063 | Ga0265327_10077245 | |||
| 1064 | Ga0265316_10078049 | |||
| 1065 | Ga0265313_10009032 | |||
| 1066 | Ga0265313_10014012 | |||
| 1067 | Ga0265313_10034822 | |||
| 1068 | Ga0265314_10050996 | |||
| 1069 | Ga0265314_10161043 | |||
| 1070 | Ga0265314_10168361 | |||
| 1071 | Ga0265314_10230285 | |||
| 1072 | Ga0265342_10015437 | |||
| 1073 | Ga0307406_10462169 | |||
| 1074 | Ga0307416_100043566 | |||
| 1075 | Ga0373926_0008664 | |||
| 1076 | Ga0373926_0015810 | |||
| 1077 | Ga0373926_0023801 | |||
| 1078 | Ga0373936_0066756 | |||
| 1079 | Ga0373945_0004925 | |||
| 1080 | Ga0373945_0014403 | |||
| 1081 | Ga0373960_0064192 | |||
| 1082 | Ga0373943_0001000 | |||
| 1083 | Ga0373943_0002001 | |||
| 1084 | Ga0373943_0046038 | |||
| 1085 | Ga0373943_0115303 | |||
| 1086 | Ga0373946_0003724 | |||
| 1087 | Ga0373946_0029677 | |||
| 1088 | Ga0373931_0127783 | |||
| 1089 | Ga0373935_0019335 | |||
| 1090 | Ga0373935_0106225 | |||
| 1091 | Ga0373935_0133157 | |||
| 1092 | Ga0373927_0007065 | |||
| 1093 | Ga0373947_0002467 | |||
| 1094 | Ga0373947_0003941 | |||
| 1095 | Ga0373947_0126504 | |||
| 1096 | Ga0373925_0001527 | |||
| 1097 | Ga0373925_0002820 | |||
| 1098 | Ga0373925_0353973 | |||
| 1099 | Ga0373925_0502926 | |||
| 1100 | Ga0395899_0008878 | |||
| 1101 | Ga0395899_0044967 | |||
| 1102 | Ga0395899_0083996 | |||
| 1103 | Ga0395899_0148286 | |||
| 1104 | Ga0395900_0016257 | |||
| 1105 | Ga0395900_0019099 | |||
| 1106 | Ga0395900_0026336 | |||
| 1107 | Ga0395900_0028374 | |||
| 1108 | Ga0395900_0140280 | |||
| 1109 | Ga0395900_0171796 | |||
| 1110 | Ga0395900_0735882 | |||
| 1111 | Ga0395898_0016502 | |||
| 1112 | Ga0395898_0020075 | |||
| 1113 | Ga0395898_0054427 | |||
| 1114 | Ga0395898_0058561 | |||
| 1115 | Ga0395898_0072804 | |||
| 1116 | Ga0395898_0117585 | |||
| 1117 | Ga0395898_0154098 | |||
| 1118 | Ga0395898_0430893 | |||
| 1119 | Ga0395898_0495078 | |||
| 1120 | Ga0395905_0022721 | |||
| 1121 | Ga0395905_0035769 | |||
| 1122 | Ga0395905_0059823 | |||
| 1123 | Ga0395905_0142481 | |||
| 1124 | Ga0395901_0018485 | |||
| 1125 | Ga0395901_0035704 | |||
| 1126 | Ga0395901_0053799 | |||
| 1127 | Ga0395901_0057906 | |||
| 1128 | Ga0395901_0139848 | |||
| 1129 | Ga0395901_0159848 | |||
| 1130 | Ga0395901_0244881 | |||
| 1131 | Ga0395901_0697920 | |||
| 1132 | Ga0439439_0004018 | |||
| 1133 | Ga0439461_0039326 | |||
| 1134 | Ga0451853_2920526 | |||
| 1135 | Ga0439431_0029845 | |||
| 1136 | Ga0450920_001273 | |||
| 1137 | Ga0439446_0001447 | |||
| 1138 | Ga0439434_0004304 | |||
| 1139 | Ga0466961_0036487 | |||
| 1140 | Ga0466963_0007240 | |||
| 1141 | Ga0466963_0009165 | |||
| 1142 | Ga0466963_0015568 | |||
| 1143 | Ga0466963_0074598 | |||
| 1144 | Ga0466963_0184361 | |||
| 1145 | Ga0466963_0321593 | |||
| 1146 | Ga0466963_0468949 | |||
| 1147 | Ga0466964_0007647 | |||
| 1148 | Ga0466964_0041586 | |||
| 1149 | Ga0466971_0008935 | |||
| 1150 | Ga0466957_0008381 | |||
| 1151 | Ga0466957_0029107 | |||
| 1152 | Ga0466957_0056010 | |||
| 1153 | Ga0466960_0014989 | |||
| 1154 | Ga0466959_0017268 | |||
| 1155 | Ga0466959_0021488 | |||
| 1156 | Ga0451576_0009360 | |||
| 1157 | Ga0466958_0041429 | |||
| 1158 | Ga0466958_0062080 | |||
| 1159 | Ga0466967_0001981 | |||
| 1160 | Ga0466967_0015949 | |||
| 1161 | Ga0466967_0036476 | |||
| 1162 | Ga0466967_0051537 | |||
| 1163 | Ga0466967_0060193 | |||
| 1164 | Ga0466967_0062924 | |||
| 1165 | Ga0466967_0262843 | |||
| 1166 | Ga0466967_0270537 | |||
| 1167 | Ga0466967_0321485 | |||
| 1168 | Ga0466967_0375937 | |||
| 1169 | Ga0466967_0662551 | |||
| 1170 | Ga0466967_0675497 | |||
| 1171 | Ga0466967_0724654 | |||
| 1172 | Ga0495592_0000124 | |||
| 1173 | Ga0495592_0031471 | |||
| 1174 | Ga0495603_0025144 | |||
| 1175 | Ga0495603_0052357 | |||
| 1176 | Ga0495603_0062326 | |||
| 1177 | Ga0495603_0083414 | |||
| 1178 | Ga0495629_0000607 | |||
| 1179 | Ga0495629_0037964 | |||
| 1180 | Ga0495629_0051069 | |||
| 1181 | Ga0495629_0143366 | |||
| 1182 | Ga0495629_0212613 | |||
| 1183 | Ga0495641_0001116 | |||
| 1184 | Ga0495641_0001867 | |||
| 1185 | Ga0495641_0018285 | |||
| 1186 | Ga0495641_0202946 | |||
| 1187 | Ga0495651_0000310 | |||
| 1188 | Ga0495651_0116756 | |||
| 1189 | Ga0495651_0202618 | |||
| 1190 | Ga0495653_0000599 | |||
| 1191 | Ga0495653_0010560 | |||
| 1192 | Ga0495653_0045594 | |||
| 1193 | Ga0495653_0111486 | |||
| 1194 | Ga0495580_0067956 | |||
| 1195 | Ga0495582_0000372 | |||
| 1196 | Ga0495582_0003449 | |||
| 1197 | Ga0495582_0030273 | |||
| 1198 | Ga0495582_0047726 | |||
| 1199 | Ga0495639_0001653 | |||
| 1200 | Ga0495639_0003719 | |||
| 1201 | Ga0495639_0025472 | |||
| 1202 | Ga0495662_0000207 | |||
| 1203 | Ga0495662_0024263 | |||
| 1204 | Ga0495664_0002089 | |||
| 1205 | Ga0495584_0029002 | |||
| 1206 | Ga0495584_0102129 | |||
| 1207 | Ga0495585_0110035 | |||
| 1208 | Ga0495596_0055569 | |||
| 1209 | Ga0495608_0001941 | |||
| 1210 | Ga0495608_0017681 | |||
| 1211 | Ga0495618_0000808 | |||
| 1212 | Ga0495618_0010550 | |||
| 1213 | Ga0495618_0053581 | |||
| 1214 | Ga0495618_0097505 | |||
| 1215 | Ga0495618_0184505 | |||
| 1216 | Ga0495628_0000436 | |||
| 1217 | Ga0495630_0016685 | |||
| 1218 | Ga0495630_0021670 | |||
| 1219 | Ga0495630_0028379 | |||
| 1220 | Ga0495631_0035371 | |||
| 1221 | Ga0495666_0000776 | |||
| 1222 | Ga0495666_0058000 | |||
| 1223 | Ga0495652_0000050 | |||
| 1224 | Ga0495652_0003053 | |||
| 1225 | Ga0495652_0185407 | |||
| 1226 | Ga0495665_0000111 | |||
| 1227 | Ga0495665_0001978 | |||
| 1228 | Ga0495640_0056190 | |||
| 1229 | Ga0495640_0066933 | |||
| 1230 | Ga0495586_0011125 | |||
| 1231 | Ga0495586_0133924 | |||
| 1232 | Ga0495586_0162129 | |||
| 1233 | Ga0495587_0000084 | |||
| 1234 | Ga0495587_0109444 | |||
| 1235 | Ga0495609_0101100 | |||
| 1236 | Ga0495645_0000067 | |||
| 1237 | Ga0495667_0013519 | |||
| 1238 | Ga0495667_0023888 | |||
| 1239 | Ga0495656_0219887 | |||
| 1240 | Ga0495634_0011063 | |||
| 1241 | Ga0495634_0093685 | |||
| 1242 | Ga0495634_0223989 | |||
| 1243 | Ga0495634_0262590 | |||
| 1244 | Ga0495635_0034594 | |||
| 1245 | Ga0495635_0054154 | |||
| 1246 | Ga0495635_0116528 | |||
| 1247 | Ga0495635_0163289 | |||
| 1248 | Ga0495588_0106877 | |||
| 1249 | Ga0495657_0049340 | |||
| 1250 | Ga0495657_0170437 | |||
| 1251 | Ga0495599_0000009 | |||
| 1252 | Ga0495599_0017375 | |||
| 1253 | Ga0495623_0000264 | |||
| 1254 | Ga0495646_0006633 | |||
| 1255 | Ga0495646_0038952 | |||
| 1256 | Ga0495658_0000911 | |||
| 1257 | Ga0495658_0002150 | |||
| 1258 | Ga0495658_0290176 | |||
| 1259 | Ga0495613_0010614 | |||
| 1260 | Ga0495613_0014535 | |||
| 1261 | Ga0495613_0342421 | |||
| 1262 | Ga0495624_0008092 | |||
| 1263 | Ga0495624_0021127 | |||
| 1264 | Ga0495624_0044908 | |||
| 1265 | Ga0495624_0192181 | |||
| 1266 | Ga0495624_0258811 | |||
| 1267 | Ga0495600_0099056 | |||
| 1268 | Ga0495581_0000303 | |||
| 1269 | Ga0495581_0001922 | |||
| 1270 | Ga0495581_0002796 | |||
| 1271 | Ga0495581_0035944 | |||
| 1272 | Ga0495581_0138328 | |||
| 1273 | Ga0495581_0219629 | |||
| 1274 | Ga0495604_0000608 | |||
| 1275 | Ga0495674_0008104 | |||
| 1276 | Ga0495674_0106339 | |||
| 1277 | Ga0495676_0000450 | |||
| 1278 | Ga0495676_0046057 | |||
| 1279 | Ga0495676_0060958 | |||
| 1280 | Ga0495676_0149495 | |||
| 1281 | Ga0495680_0002792 | |||
| 1282 | Ga0495680_0010144 | |||
| 1283 | Ga0495680_0061547 | |||
| 1284 | Ga0495675_0000363 | |||
| 1285 | Ga0495684_0028355 | |||
| 1286 | Ga0495684_0068354 | |||
| 1287 | Ga0495684_0172704 | |||
| 1288 | Ga0495593_0007244 | |||
| 1289 | Ga0495593_0024859 | |||
| 1290 | Ga0495602_0000234 | |||
| 1291 | Ga0495614_0003528 | |||
| 1292 | Ga0495614_0012807 | |||
| 1293 | Ga0496100_0057462 | |||
| 1294 | Ga0496100_0074261 | |||
| 1295 | Ga0496101_0189236 | |||
| 1296 | Ga0496101_0502574 | |||
| 1297 | Ga0496102_0026710 | |||
| 1298 | Ga0496102_0301831 | |||
| 1299 | Ga0496103_0224181 | |||
| 1300 | Ga0496103_0248859 | |||
| 1301 | Ga0496104_0028498 | |||
| 1302 | Ga0496104_0087849 | |||
| 1303 | Ga0496104_0175487 | |||
| 1304 | Ga0496104_0241696 | |||
| 1305 | Ga0496104_0510892 | |||
| 1306 | Ga0496105_0027795 | |||
| 1307 | Ga0496105_0212725 | |||
| 1308 | Ga0496106_0033197 | |||
| 1309 | Ga0496106_0170550 | |||
| 1310 | Ga0496107_0024982 | |||
| 1311 | Ga0496107_0237561 | |||
| 1312 | Ga0496108_0013326 | |||
| 1313 | Ga0496108_0037726 | |||
| 1314 | Ga0496108_0039971 | |||
| 1315 | Ga0496108_0040521 | |||
| 1316 | Ga0496108_0177278 | |||
| 1317 | Ga0496109_0001117 | |||
| 1318 | Ga0496109_0002561 | |||
| 1319 | Ga0496109_0039991 | |||
| 1320 | Ga0496109_0078000 | |||
| 1321 | Ga0496109_0164031 | |||
| 1322 | Ga0496109_0229821 | |||
| 1323 | Ga0496109_0379567 | |||
| 1324 | Ga0496110_0013018 | |||
| 1325 | Ga0496110_0017413 | |||
| 1326 | Ga0496110_0046569 | |||
| 1327 | Ga0496110_0089399 | |||
| 1328 | Ga0496110_0113120 | |||
| 1329 | Ga0496111_0002962 | |||
| 1330 | Ga0496111_0016341 | |||
| 1331 | Ga0496111_0322158 | |||
| 1332 | Ga0496112_0000390 | |||
| 1333 | Ga0496112_0029858 | |||
| 1334 | Ga0496112_0031640 | |||
| 1335 | Ga0496112_0040279 | |||
| 1336 | Ga0496112_0114224 | |||
| 1337 | Ga0496112_0122869 | |||
| 1338 | Ga0496112_0187721 | |||
| 1339 | Ga0496112_0228956 | |||
| 1340 | Ga0496112_0284890 | |||
| 1341 | Ga0496112_0505137 | |||
| 1342 | Ga0496113_0079470 | |||
| 1343 | Ga0496113_0090555 | |||
| 1344 | Ga0496113_0157474 | |||
| 1345 | Ga0496113_0204360 | |||
| 1346 | Ga0496113_0210571 | |||
| 1347 | Ga0496113_0605083 | |||
| 1348 | Ga0496114_0015424 | |||
| 1349 | Ga0496114_0053541 | |||
| 1350 | Ga0496114_0338679 | |||
| 1351 | Ga0496114_0490626 | |||
| 1352 | Ga0496114_0664647 | |||
| 1353 | Ga0496115_0008579 | |||
| 1354 | Ga0496115_0137849 | |||
| 1355 | Ga0496115_0250362 | |||
| 1356 | Ga0501031_0000671 | |||
| 1357 | Ga0501032_0000289 | |||
| 1358 | Ga0501033_0001004 | |||
| 1359 | Ga0501033_0135585 | |||
| 1360 | Ga0501034_0151908 | |||
| 1361 | Ga0501034_0326114 | |||
| 1362 | Ga0501036_0001436 | |||
| 1363 | Ga0501036_0118835 | |||
| 1364 | Ga0501037_0000205 | |||
| 1365 | Ga0501038_0001405 | |||
| 1366 | Ga0501039_0000149 | |||
| 1367 | Ga0501040_0000317 | |||
| 1368 | Ga0501040_0036968 | |||
| 1369 | Ga0501040_0152320 | |||
| 1370 | Ga0501041_0004443 | |||
| 1371 | Ga0501041_0021657 | |||
| 1372 | Ga0501041_0203285 | |||
| 1373 | Ga0501042_0000079 | |||
| 1374 | Ga0501042_0031749 | |||
| 1375 | Ga0501043_0000217 | |||
| 1376 | Ga0501046_0000689 | |||
| 1377 | Ga0501046_0035310 | |||
| 1378 | Ga0501047_0030191 | |||
| 1379 | Ga0501048_0000664 | |||
| 1380 | Ga0501048_0021537 | |||
| 1381 | Ga0501067_0043147 | |||
| 1382 | Ga0501068_0003163 | |||
| 1383 | Ga0501069_0002161 | |||
| 1384 | Ga0501069_0065343 | |||
| 1385 | Ga0501070_0003257 | |||
| 1386 | Ga0501070_0105251 | |||
| 1387 | Ga0501071_0000107 | |||
| 1388 | Ga0501071_0152163 | |||
| 1389 | Ga0501072_0005662 | |||
| 1390 | Ga0501073_0001108 | |||
| 1391 | Ga0501073_0270535 | |||
| 1392 | Ga0501074_0003869 | |||
| 1393 | Ga0501074_0020086 | |||
| 1394 | Ga0501075_0000070 | |||
| 1395 | Ga0501075_0119924 | |||
| 1396 | Ga0501075_0206399 | |||
| 1397 | Ga0501076_0000331 | |||
| 1398 | Ga0501077_0003683 | |||
| 1399 | Ga0501079_0000822 | |||
| 1400 | Ga0501079_0091537 | |||
| 1401 | Ga0501079_0100398 | |||
| 1402 | Ga0501079_0477847 | |||
| 1403 | Ga0501080_0006430 | |||
| 1404 | Ga0501080_0007960 | |||
| 1405 | Ga0501081_0000820 | |||
| 1406 | Ga0501081_0295328 | |||
| 1407 | Ga0501083_0000086 | |||
| 1408 | Ga0501035_0044330 | |||
| 1409 | Ga0501044_0012086 | |||
| 1410 | Ga0501045_0003841 | |||
| 1411 | nmdc:mga00v17_116709_c1 | |||
| 1412 | nmdc:mga05p37_379487_c1 | |||
| 1413 | nmdc:mga05p37_81498_c1 | |||
| 1414 | nmdc:mga09592_331721_c1 | |||
| 1415 | nmdc:mga06r32_368682_c1 | |||
| 1416 | nmdc:mga06r32_42646_c1 | |||
| 1417 | nmdc:mga08y16_290301_c1 | |||
| 1418 | nmdc:mga08y16_325245_c1 | |||
| 1419 | nmdc:mga0n895_65577_c1 | |||
| 1420 | nmdc:mga0rr50_6077_c1 | |||
| 1421 | nmdc:mga0rr50_6103_c1 | |||
| 1422 | nmdc:mga08x19_23434_c1 | |||
| 1423 | nmdc:mga08x19_44008_c1 | |||
| 1424 | nmdc:mga0a205_35909_c1 | |||
| 1425 | Ga0495601_0009701 | |||
| 1426 | Ga0495601_0020160 | |||
| 1427 | Ga0495601_0042472 | |||
| 1428 | Ga0495601_0120269 | |||
| 1429 | Ga0495595_0152317 | |||
| 1430 | Ga0495619_0003374 | |||
| 1431 | Ga0495619_0020014 | |||
| 1432 | Ga0495619_0115145 | |||
| 1433 | Ga0495619_0265816 | |||
| 1434 | Ga0501084_0008450 | |||
| 1435 | Ga0501084_0162123 | |||
| 1436 | Ga0590075_036243 | |||
| 1437 | Ga0501082_0001195 | |||
| 1438 | Ga0466962_0004082 | |||
| 1439 | Ga0530510_0002191 | |||
| 1440 | Ga0530510_0031417 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3kwp-assembly1.cif.gz_A-2 | crystal structure of putative methyltransferase from lactobacillus brevis | 0.9294 | 3 | 221 |
| 5hw4-assembly1.cif.gz_B | crystal structure of escherichia coli 16s rrna methyltransferase rsmi in complex with adomet | 0.9054 | 2 | 221 |
| 5hw4-assembly2.cif.gz_C-2 | crystal structure of escherichia coli 16s rrna methyltransferase rsmi in complex with adomet | 0.9024 | 2 | 219 |
| 5hw4-assembly1.cif.gz_A | crystal structure of escherichia coli 16s rrna methyltransferase rsmi in complex with adomet | 0.8961 | 2 | 224 |
| 3kwp-assembly1.cif.gz_A-2 | crystal structure of putative methyltransferase from lactobacillus brevis | 0.8906 | 3 | 221 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WGW7_115_230_3.30.950.10 | Alpha Beta;2-Layer Sandwich;Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2;Tetrapyrrole methylase, C-terminal domain | 0.9404 | 110 | 224 | 3.30.950.10 |
| af_P9WGW7_115_230_3.30.950.10 | Alpha Beta;2-Layer Sandwich;Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2;Tetrapyrrole methylase, C-terminal domain | 0.9249 | 110 | 224 | 3.30.950.10 |
| af_P9WGW7_1_114_3.40.1010.10 | Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain | 0.9187 | 2 | 109 | 3.40.1010.10 |
| 5hw4C01 | Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain | 0.9171 | 2 | 109 | 3.40.1010.10 |
| af_Q338C6_169_282_3.30.950.10 | Alpha Beta;2-Layer Sandwich;Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2;Tetrapyrrole methylase, C-terminal domain | 0.913 | 111 | 220 | 3.30.950.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Y5XXZ1-F1-model_v4 | 16S rRNA (Cytidine(1402)-2'-O)-methyltransferase (EC 2.1.1.198) | 0.9612 | 1 | 174 |
GO:0005737
GO:0006364 GO:0008168 GO:0032259 |
| AF-A0A7V5SGA9-F1-model_v4 | 16S rRNA (Cytidine(1402)-2'-O)-methyltransferase (EC 2.1.1.198) | 0.9572 | 2 | 219 |
GO:0005737
GO:0006364 GO:0008168 GO:0032259 |
| AF-A0A538NHE9-F1-model_v4 | Ribosomal RNA small subunit methyltransferase I (EC 2.1.1.198) (16S rRNA 2'-O-ribose C1402 methyltransferase) (rRNA (cytidine-2'-O-)-methyltransferase RsmI) | 0.9565 | 3 | 219 |
GO:0005737
GO:0070677 |
| AF-A0A535RT32-F1-model_v4 | Ribosomal RNA small subunit methyltransferase I (EC 2.1.1.198) (16S rRNA 2'-O-ribose C1402 methyltransferase) (rRNA (cytidine-2'-O-)-methyltransferase RsmI) | 0.9536 | 2 | 223 |
GO:0005737
GO:0070677 |
| AF-A0A1G0YZE8-F1-model_v4 | Ribosomal RNA small subunit methyltransferase I (EC 2.1.1.198) (16S rRNA 2'-O-ribose C1402 methyltransferase) (rRNA (cytidine-2'-O-)-methyltransferase RsmI) | 0.9515 | 2 | 223 |
GO:0005737
GO:0070677 |