F477321

General Info

Members Datasets Scaffolds Average Seq Length
720 323 1440 252

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0254649|Ga0466963_0254649_21_863
Length 280
Sequence VGSPSAVPVRGGLALPLAVCATPIGNLEDITLRVLCELRAADVVLCEDTRHTRVLLDRHGIDRPLLSYHEHNEASRTKELLPRLEAGERIALVSDAGMPGINDPGARIVRAALAAGVPVTVLPGPSAVETALVASGLVGERYQFVGFLPRKQGELAALWEELSRSPWPAVAFESPQRLPASLASLAATTPEREVAVCRELTKRFEEVVRGTATDLAARFATSPKGEITLVVGPGRGDGDDAPALAAVAELVAEGLPRRRAADVVARLTGSSKNRLYRGSL

Samples

Sample ID Description Type Environment
1 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
153 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
154 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
155 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
156 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
157 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
158 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
159 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
160 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
161 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
162 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
163 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
164 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
165 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
166 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
167 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
168 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
169 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
170 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
171 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
172 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
173 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
174 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
175 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
176 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
177 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
178 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
179 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
180 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
181 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
182 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
183 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
184 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
185 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
186 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
187 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
188 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
189 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
190 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
191 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
192 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
193 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
194 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
195 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
196 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
197 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
198 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
199 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
200 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
201 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
202 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
203 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
204 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
205 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
206 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
207 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
208 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
209 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
210 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
211 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
212 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
213 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
214 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
215 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
216 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
217 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
218 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
219 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
220 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
221 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
222 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
223 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
224 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
225 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
226 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
227 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
228 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
229 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
230 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
231 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
232 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
233 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
234 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
235 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
236 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
237 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
238 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
239 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
240 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
241 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
242 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
243 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
244 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
245 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
246 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
247 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
248 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
249 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
250 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
251 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
252 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
253 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
254 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
255 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
256 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
257 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
258 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
259 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
260 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
261 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
262 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
263 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
264 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
265 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
266 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
267 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
268 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
269 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
270 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
271 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
272 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
273 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
274 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
290 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
291 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
292 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
293 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
294 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
295 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
296 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
297 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
298 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
299 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
300 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
301 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
302 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
303 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
304 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
307 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
308 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
309 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
310 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
311 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
312 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
313 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
314 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
315 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
316 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
317 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
318 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
319 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
320 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
321 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
322 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
323 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.17
Metatranscriptomes 0.83
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.42
Nodule 0
Rhizoplane 8.75
Rhizosphere 90.69
Stem 0
Stem Tuber 0
Unclassified 2.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466963_0254649 3300044694 Bacteria 1232
2 JGI25407J50210_10037201 3300003373 Bacteria 1251
3 Ga0070658_10005067 3300005327 Bacteria 10725
4 Ga0070658_10009665 3300005327 Bacteria 7745
5 Ga0070658_10009919 3300005327 Bacteria 7652
6 Ga0070658_10070161 3300005327 Bacteria 2868
7 Ga0070658_10147864 3300005327 Bacteria 1966
8 Ga0070683_100105842 3300005329 Bacteria 2652
9 Ga0070683_100526989 3300005329 Bacteria 1129
10 Ga0070690_100084102 3300005330 Bacteria 2085
11 Ga0070690_100157982 3300005330 Bacteria 1551
12 Ga0070670_100005965 3300005331 Bacteria 10307
13 Ga0070680_100019068 3300005336 Bacteria 5431
14 Ga0070680_100051865 3300005336 Bacteria 3348
15 Ga0070680_100182113 3300005336 Bacteria 1769
16 Ga0070682_100012208 3300005337 Bacteria 4919
17 Ga0070660_100002084 3300005339 Bacteria 13803
18 Ga0070660_100010360 3300005339 Bacteria 6587
19 Ga0070660_100048195 3300005339 Bacteria 3272
20 Ga0070660_100152987 3300005339 Bacteria 1855
21 Ga0070660_100182903 3300005339 Bacteria 1696
22 Ga0070691_10030649 3300005341 Bacteria 2520
23 Ga0070691_10084725 3300005341 Bacteria 1556
24 Ga0070687_100022052 3300005343 Bacteria 3005
25 Ga0070661_100043113 3300005344 Bacteria 3295
26 Ga0070661_100201216 3300005344 Bacteria 1522
27 Ga0070692_10138913 3300005345 Bacteria 1373
28 Ga0070668_100103455 3300005347 Bacteria 2259
29 Ga0070669_100091266 3300005353 Bacteria 2284
30 Ga0070675_100102959 3300005354 Bacteria 2406
31 Ga0070674_100075814 3300005356 Bacteria 2390
32 Ga0070674_100098402 3300005356 Bacteria 2126
33 Ga0070673_100027107 3300005364 Bacteria 4243
34 Ga0070688_100001335 3300005365 Bacteria 12235
35 Ga0070659_100021168 3300005366 Bacteria 4948
36 Ga0070659_100056044 3300005366 Bacteria 3107
37 Ga0070659_100145364 3300005366 Bacteria 1932
38 Ga0070667_100200917 3300005367 Bacteria 1769
39 Ga0070709_10049886 3300005434 Bacteria 2619
40 Ga0070709_10053605 3300005434 Bacteria 2540
41 Ga0070709_10144083 3300005434 Bacteria 1640
42 Ga0070714_100006363 3300005435 Bacteria 9109
43 Ga0070714_100074192 3300005435 Bacteria 2949
44 Ga0070714_100075914 3300005435 Bacteria 2916
45 Ga0070714_100159092 3300005435 Bacteria 2042
46 Ga0070714_100563244 3300005435 Bacteria 1092
47 Ga0070713_100840974 3300005436 Bacteria 881
48 Ga0070710_10037317 3300005437 Bacteria 2662
49 Ga0070710_10067735 3300005437 Bacteria 2049
50 Ga0070701_10003191 3300005438 Bacteria 6449
51 Ga0070701_10207469 3300005438 Bacteria 1162
52 Ga0070711_100350104 3300005439 Bacteria 1187
53 Ga0070705_100029659 3300005440 Bacteria 3012
54 Ga0070705_100469145 3300005440 Bacteria 948
55 Ga0070700_100097775 3300005441 Bacteria 1929
56 Ga0070700_100138578 3300005441 Bacteria 1651
57 Ga0070700_100244197 3300005441 Bacteria 1285
58 Ga0070694_100217499 3300005444 Bacteria 1431
59 Ga0070694_100293979 3300005444 Bacteria 1243
60 Ga0070708_100030482 3300005445 Bacteria 4662
61 Ga0070708_100115088 3300005445 Bacteria 2475
62 Ga0070708_100224126 3300005445 Bacteria 1764
63 Ga0070663_100008657 3300005455 Bacteria 6273
64 Ga0070678_100173500 3300005456 Bacteria 1758
65 Ga0070678_100204323 3300005456 Bacteria 1633
66 Ga0070681_10000870 3300005458 Bacteria 25432
67 Ga0070681_10011999 3300005458 Bacteria 8590
68 Ga0070681_10026180 3300005458 Bacteria 5864
69 Ga0070681_10145933 3300005458 Bacteria 2295
70 Ga0070681_10350767 3300005458 Bacteria 1386
71 Ga0068867_100002315 3300005459 Bacteria 13405
72 Ga0068867_100112829 3300005459 Bacteria 2090
73 Ga0070685_10319166 3300005466 Bacteria 1052
74 Ga0070706_100009221 3300005467 Bacteria 9192
75 Ga0070706_100025664 3300005467 Bacteria 5423
76 Ga0070706_100104135 3300005467 Bacteria 2639
77 Ga0070706_100157001 3300005467 Bacteria 2123
78 Ga0070707_100000499 3300005468 Bacteria 39000
79 Ga0070707_100102187 3300005468 Bacteria 2777
80 Ga0070698_100007169 3300005471 Bacteria 12078
81 Ga0070698_100169895 3300005471 Bacteria 2122
82 Ga0070698_100366559 3300005471 Bacteria 1373
83 Ga0070699_100086802 3300005518 Bacteria 2731
84 Ga0070699_100395669 3300005518 Bacteria 1249
85 Ga0070679_100115648 3300005530 Bacteria 2668
86 Ga0070679_100199946 3300005530 Bacteria 1965
87 Ga0070679_100256105 3300005530 Bacteria 1705
88 Ga0070679_100299398 3300005530 Bacteria 1559
89 Ga0070679_100308169 3300005530 Bacteria 1533
90 Ga0070684_100082322 3300005535 Bacteria 2850
91 Ga0070684_100207147 3300005535 Bacteria 1787
92 Ga0070684_100360737 3300005535 Unclassified 1337
93 Ga0070697_100128269 3300005536 Bacteria 2125
94 Ga0068853_100080154 3300005539 Bacteria 2856
95 Ga0068853_100479422 3300005539 Bacteria 1172
96 Ga0070686_100005644 3300005544 Bacteria 6932
97 Ga0070686_100024086 3300005544 Bacteria 3646
98 Ga0070695_100000005 3300005545 Bacteria 97484
99 Ga0070695_100046805 3300005545 Bacteria 2760
100 Ga0070695_100133470 3300005545 Bacteria 1713
101 Ga0070696_100027543 3300005546 Bacteria 3873
102 Ga0070696_100036365 3300005546 Bacteria 3395
103 Ga0070665_100038717 3300005548 Bacteria 4793
104 Ga0070704_100010268 3300005549 Bacteria 5693
105 Ga0070704_100091223 3300005549 Bacteria 2271
106 Ga0070704_100108666 3300005549 Bacteria 2106
107 Ga0070704_100294556 3300005549 Bacteria 1349
108 Ga0068855_100213971 3300005563 Bacteria 2164
109 Ga0068855_100679432 3300005563 Bacteria 1103
110 Ga0070664_100142699 3300005564 Bacteria 2110
111 Ga0070664_100164740 3300005564 Bacteria 1963
112 Ga0070664_100343299 3300005564 Bacteria 1357
113 Ga0068857_100007868 3300005577 Bacteria 9195
114 Ga0068857_100038703 3300005577 Bacteria 4222
115 Ga0068857_100232741 3300005577 Bacteria 1685
116 Ga0068857_100375824 3300005577 Unclassified 1319
117 Ga0068854_100048671 3300005578 Bacteria 3025
118 Ga0068856_100141424 3300005614 Bacteria 2414
119 Ga0068856_100174252 3300005614 Bacteria 2164
120 Ga0068856_100567044 3300005614 Bacteria 1157
121 Ga0068856_100750185 3300005614 Bacteria 996
122 Ga0070702_100012206 3300005615 Bacteria 4298
123 Ga0070702_100076447 3300005615 Bacteria 1993
124 Ga0068852_100127396 3300005616 Bacteria 2340
125 Ga0068852_100392871 3300005616 Bacteria 1363
126 Ga0068866_10005257 3300005718 Bacteria 5335
127 Ga0068866_10096757 3300005718 Bacteria 1620
128 Ga0068870_10001681 3300005840 Bacteria 9039
129 Ga0068863_100220564 3300005841 Bacteria 1827
130 Ga0068860_100100032 3300005843 Bacteria 2766
131 Ga0068860_100176733 3300005843 Bacteria 2063
132 Ga0081455_10010902 3300005937 Bacteria 9170
133 Ga0081455_10127859 3300005937 Bacteria 1991
134 Ga0081538_10000531 3300005981 Bacteria 42080
135 Ga0081538_10006735 3300005981 Bacteria 10049
136 Ga0081538_10126919 3300005981 Bacteria 1210
137 Ga0081539_10001582 3300005985 Bacteria 37628
138 Ga0070717_10010897 3300006028 Bacteria 6882
139 Ga0070717_10011613 3300006028 Bacteria 6696
140 Ga0070717_10012034 3300006028 Bacteria 6590
141 Ga0070717_10053273 3300006028 Bacteria 3334
142 Ga0070717_10106177 3300006028 Bacteria 2391
143 Ga0070717_10248596 3300006028 Bacteria 1570
144 Ga0075365_10175590 3300006038 Unclassified 1496
145 Ga0075364_10015843 3300006051 Bacteria 4679
146 Ga0075432_10016731 3300006058 Bacteria 2502
147 Ga0070716_100136889 3300006173 Bacteria 1556
148 Ga0070712_100083999 3300006175 Bacteria 2314
149 Ga0068871_100059434 3300006358 Bacteria 3114
150 Ga0068871_100288602 3300006358 Bacteria 1437
151 Ga0075428_100359776 3300006844 Bacteria 1561
152 Ga0075431_100049253 3300006847 Bacteria 4344
153 Ga0075431_100343762 3300006847 Bacteria 1501
154 Ga0075433_10061216 3300006852 Bacteria 3297
155 Ga0075433_10062999 3300006852 Bacteria 3248
156 Ga0068865_100008726 3300006881 Bacteria 6270
157 Ga0068865_100213549 3300006881 Bacteria 1505
158 Ga0075436_100009010 3300006914 Bacteria 6827
159 Ga0075435_100020369 3300007076 Bacteria 5081
160 Ga0075435_100021671 3300007076 Bacteria 4946
161 Ga0105240_10010278 3300009093 Bacteria 13176
162 Ga0105240_10290427 3300009093 Bacteria 1875
163 Ga0111539_10026631 3300009094 Bacteria 7068
164 Ga0111539_10070886 3300009094 Bacteria 4113
165 Ga0111539_10250925 3300009094 Bacteria 2060
166 Ga0111539_10362946 3300009094 Bacteria 1686
167 Ga0111539_10840104 3300009094 Unclassified 1068
168 Ga0105245_10097836 3300009098 Bacteria 2710
169 Ga0105245_10121059 3300009098 Bacteria 2445
170 Ga0105247_10287186 3300009101 Bacteria 1137
171 Ga0114129_10073321 3300009147 Bacteria 4769
172 Ga0114129_10113350 3300009147 Bacteria 3739
173 Ga0105243_10020894 3300009148 Bacteria 4968
174 Ga0105243_10336224 3300009148 Bacteria 1381
175 Ga0105242_10011334 3300009176 Bacteria 6853
176 Ga0105248_10170911 3300009177 Bacteria 2450
177 Ga0105248_10604925 3300009177 Bacteria 1237
178 Ga0105237_10113772 3300009545 Bacteria 2698
179 Ga0105237_10265665 3300009545 Bacteria 1719
180 Ga0105238_10243998 3300009551 Bacteria 1774
181 Ga0105249_10036376 3300009553 Bacteria 4465
182 Ga0105249_10115126 3300009553 Bacteria 2547
183 Ga0105239_10089971 3300010375 Bacteria 3386
184 Ga0105239_10122930 3300010375 Bacteria 2884
185 Ga0105239_10509577 3300010375 Bacteria 1368
186 Ga0157371_10012788 3300013102 Bacteria 6398
187 Ga0157370_10007418 3300013104 Bacteria 11939
188 Ga0157370_10073012 3300013104 Bacteria 3237
189 Ga0157370_10212724 3300013104 Bacteria 1792
190 Ga0157370_10243339 3300013104 Bacteria 1664
191 Ga0157369_10003200 3300013105 Bacteria 19524
192 Ga0157369_10048500 3300013105 Bacteria 4608
193 Ga0157369_10108289 3300013105 Bacteria 2956
194 Ga0157369_10401179 3300013105 Bacteria 1422
195 Ga0157374_10001910 3300013296 Bacteria 17466
196 Ga0157378_10068324 3300013297 Bacteria 3187
197 Ga0163162_10022800 3300013306 Bacteria 6173
198 Ga0163162_10333502 3300013306 Bacteria 1649
199 Ga0157375_10014891 3300013308 Bacteria 6951
200 Ga0157375_10071713 3300013308 Bacteria 3478
201 Ga0157375_10147870 3300013308 Bacteria 2482
202 Ga0157375_10223878 3300013308 Unclassified 2040
203 Ga0157375_10224644 3300013308 Bacteria 2037
204 Ga0157380_10087954 3300014326 Bacteria 2555
205 Ga0182008_10026919 3300014497 Bacteria 2915
206 Ga0182008_10067478 3300014497 Bacteria 1760
207 Ga0157377_10002074 3300014745 Bacteria 8800
208 Ga0157376_10008931 3300014969 Bacteria 7256
209 Ga0157376_10021984 3300014969 Bacteria 4962
210 Ga0157376_10220874 3300014969 Bacteria 1755
211 Ga0163161_10119548 3300017792 Bacteria 1978
212 Ga0197907_11168973 3300020069 Bacteria 1927
213 Ga0206356_10015860 3300020070 Bacteria 989
214 Ga0206356_11892464 3300020070 Bacteria 3877
215 Ga0206354_11647680 3300020081 Bacteria 1813
216 Ga0206353_10474326 3300020082 Bacteria 4558
217 Ga0206353_11246867 3300020082 Bacteria 1362
218 Ga0207692_10041910 3300025898 Bacteria 2269
219 Ga0207688_10115413 3300025901 Bacteria 1563
220 Ga0207643_10001454 3300025908 Bacteria 13592
221 Ga0207643_10319711 3300025908 Unclassified 969
222 Ga0207705_10006869 3300025909 Bacteria 8412
223 Ga0207684_10066919 3300025910 Bacteria 3052
224 Ga0207684_10123935 3300025910 Bacteria 2216
225 Ga0207684_10149007 3300025910 Bacteria 2013
226 Ga0207707_10003093 3300025912 Bacteria 14761
227 Ga0207707_10145049 3300025912 Bacteria 2075
228 Ga0207707_10148092 3300025912 Bacteria 2052
229 Ga0207707_10188350 3300025912 Bacteria 1800
230 Ga0207707_10695881 3300025912 Bacteria 854
231 Ga0207695_10024627 3300025913 Bacteria 6763
232 Ga0207695_10041943 3300025913 Bacteria 4893
233 Ga0207695_10228239 3300025913 Bacteria 1767
234 Ga0207693_10000175 3300025915 Bacteria 58611
235 Ga0207693_10005241 3300025915 Bacteria 10848
236 Ga0207693_10124745 3300025915 Bacteria 2023
237 Ga0207660_10016180 3300025917 Bacteria 4934
238 Ga0207660_10169774 3300025917 Bacteria 1688
239 Ga0207657_10002919 3300025919 Bacteria 18353
240 Ga0207657_10007326 3300025919 Bacteria 11318
241 Ga0207657_10009371 3300025919 Bacteria 9848
242 Ga0207657_10027664 3300025919 Bacteria 5189
243 Ga0207657_10045707 3300025919 Bacteria 3840
244 Ga0207657_10046866 3300025919 Bacteria 3784
245 Ga0207657_10053684 3300025919 Bacteria 3490
246 Ga0207652_10045947 3300025921 Bacteria 3724
247 Ga0207652_10224814 3300025921 Bacteria 1691
248 Ga0207652_10236495 3300025921 Bacteria 1646
249 Ga0207646_10000903 3300025922 Bacteria 38217
250 Ga0207646_10013338 3300025922 Bacteria 7862
251 Ga0207646_10265206 3300025922 Bacteria 1552
252 Ga0207694_10102242 3300025924 Bacteria 2272
253 Ga0207694_10235330 3300025924 Bacteria 1496
254 Ga0207650_10018208 3300025925 Bacteria 4926
255 Ga0207659_10156237 3300025926 Bacteria 1786
256 Ga0207687_10259134 3300025927 Bacteria 1386
257 Ga0207700_10680183 3300025928 Bacteria 918
258 Ga0207664_10014135 3300025929 Bacteria 5756
259 Ga0207664_10056229 3300025929 Bacteria 3125
260 Ga0207664_10066412 3300025929 Bacteria 2891
261 Ga0207664_10169161 3300025929 Bacteria 1869
262 Ga0207664_10224073 3300025929 Bacteria 1632
263 Ga0207664_10230705 3300025929 Bacteria 1609
264 Ga0207664_10377730 3300025929 Bacteria 1258
265 Ga0207664_10536220 3300025929 Bacteria 1049
266 Ga0207644_10125205 3300025931 Bacteria 1961
267 Ga0207690_10143537 3300025932 Bacteria 1762
268 Ga0207690_10166348 3300025932 Bacteria 1648
269 Ga0207690_10254007 3300025932 Bacteria 1359
270 Ga0207706_10007998 3300025933 Bacteria 9761
271 Ga0207706_10142098 3300025933 Bacteria 2112
272 Ga0207669_10002491 3300025937 Bacteria 7855
273 Ga0207669_10074594 3300025937 Bacteria 2146
274 Ga0207669_10098358 3300025937 Bacteria 1927
275 Ga0207665_10010583 3300025939 Bacteria 6058
276 Ga0207691_10004674 3300025940 Bacteria 13258
277 Ga0207711_10312537 3300025941 Bacteria 1451
278 Ga0207689_10174339 3300025942 Unclassified 1773
279 Ga0207661_10040413 3300025944 Bacteria 3666
280 Ga0207661_10161114 3300025944 Bacteria 1946
281 Ga0207661_10325895 3300025944 Bacteria 1382
282 Ga0207661_10547560 3300025944 Bacteria 1060
283 Ga0207679_10076890 3300025945 Bacteria 2538
284 Ga0207679_10425207 3300025945 Bacteria 1173
285 Ga0207667_10675803 3300025949 Bacteria 1036
286 Ga0207667_10763371 3300025949 Bacteria 965
287 Ga0207651_10216597 3300025960 Bacteria 1545
288 Ga0207712_10101840 3300025961 Bacteria 2137
289 Ga0207712_10319867 3300025961 Bacteria 1280
290 Ga0207668_10170096 3300025972 Bacteria 1708
291 Ga0207668_10421504 3300025972 Bacteria 1133
292 Ga0207640_10395281 3300025981 Bacteria 1124
293 Ga0207658_10435372 3300025986 Bacteria 1159
294 Ga0207677_10337042 3300026023 Bacteria 1259
295 Ga0207703_10148456 3300026035 Bacteria 2042
296 Ga0207639_10365298 3300026041 Bacteria 1292
297 Ga0207639_10403310 3300026041 Bacteria 1232
298 Ga0207708_10006150 3300026075 Bacteria 8900
299 Ga0207708_10022931 3300026075 Bacteria 4715
300 Ga0207708_10053844 3300026075 Bacteria 3067
301 Ga0207702_10020325 3300026078 Bacteria 5500
302 Ga0207702_10084955 3300026078 Bacteria 2757
303 Ga0207641_10116902 3300026088 Bacteria 2374
304 Ga0207648_10000150 3300026089 Bacteria 70019
305 Ga0207648_10001463 3300026089 Bacteria 25973
306 Ga0207674_10012665 3300026116 Bacteria 9424
307 Ga0207674_10047390 3300026116 Bacteria 4407
308 Ga0207675_100017001 3300026118 Bacteria 6797
309 Ga0207675_100020233 3300026118 Bacteria 6205
310 Ga0207683_10000131 3300026121 Bacteria 61423
311 Ga0207683_10066955 3300026121 Bacteria 3168
312 Ga0207683_10290332 3300026121 Bacteria 1495
313 Ga0209966_1020534 3300027695 Bacteria 1280
314 Ga0207428_10012901 3300027907 Bacteria 7328
315 Ga0268266_10081625 3300028379 Bacteria 2820
316 Ga0265319_1005673 3300028563 Bacteria 5928
317 Ga0265319_1005744 3300028563 Bacteria 5876
318 Ga0265334_10046396 3300028573 Bacteria 1679
319 Ga0265318_10000834 3300028577 Bacteria 20283
320 Ga0265318_10011876 3300028577 Bacteria 3727
321 Ga0265323_10028518 3300028653 Bacteria 2093
322 Ga0265322_10016600 3300028654 Bacteria 2125
323 Ga0265322_10018877 3300028654 Bacteria 1980
324 Ga0265336_10035669 3300028666 Bacteria 1533
325 Ga0265338_10016043 3300028800 Bacteria 8182
326 Ga0265338_10036385 3300028800 Bacteria 4712
327 Ga0265338_10063620 3300028800 Bacteria 3215
328 Ga0265338_10349495 3300028800 Unclassified 1063
329 Ga0265324_10096230 3300029957 Bacteria 1007
330 Ga0265330_10006324 3300031235 Bacteria 5855
331 Ga0265332_10002374 3300031238 Bacteria 9598
332 Ga0265332_10028478 3300031238 Bacteria 2445
333 Ga0265328_10011998 3300031239 Bacteria 3454
334 Ga0265320_10081349 3300031240 Bacteria 1511
335 Ga0265325_10052766 3300031241 Bacteria 2086
336 Ga0265325_10058447 3300031241 Bacteria 1964
337 Ga0265329_10002938 3300031242 Bacteria 7586
338 Ga0265340_10006769 3300031247 Bacteria 6271
339 Ga0265339_10003289 3300031249 Bacteria 11317
340 Ga0265331_10031227 3300031250 Bacteria 2647
341 Ga0265331_10100154 3300031250 Bacteria 1334
342 Ga0265327_10038720 3300031251 Bacteria 2598
343 Ga0265327_10077245 3300031251 Bacteria 1652
344 Ga0265316_10078049 3300031344 Bacteria 2542
345 Ga0265313_10009032 3300031595 Bacteria 6531
346 Ga0265313_10014012 3300031595 Bacteria 4773
347 Ga0265313_10034822 3300031595 Bacteria 2541
348 Ga0265314_10050996 3300031711 Bacteria 2884
349 Ga0265314_10161043 3300031711 Bacteria 1365
350 Ga0265314_10168361 3300031711 Bacteria 1325
351 Ga0265314_10230285 3300031711 Bacteria 1075
352 Ga0265342_10015437 3300031712 Bacteria 5021
353 Ga0307406_10462169 3300031901 Unclassified 1021
354 Ga0307416_100043566 3300032002 Bacteria 3515
355 Ga0373926_0008664 3300035083 Bacteria 3385
356 Ga0373926_0015810 3300035083 Bacteria 2575
357 Ga0373926_0023801 3300035083 Unclassified 2129
358 Ga0373936_0066756 3300035113 Unclassified 1477
359 Ga0373945_0004925 3300035116 Bacteria 4256
360 Ga0373945_0014403 3300035116 Bacteria 2649
361 Ga0373960_0064192 3300035121 Bacteria 1121
362 Ga0373943_0001000 3300035170 Bacteria 12558
363 Ga0373943_0002001 3300035170 Bacteria 9230
364 Ga0373943_0046038 3300035170 Bacteria 2128
365 Ga0373943_0115303 3300035170 Bacteria 1422
366 Ga0373946_0003724 3300035171 Bacteria 5404
367 Ga0373946_0029677 3300035171 Bacteria 2179
368 Ga0373931_0127783 3300035691 Bacteria 1460
369 Ga0373935_0019335 3300035692 Bacteria 4154
370 Ga0373935_0106225 3300035692 Bacteria 1858
371 Ga0373935_0133157 3300035692 Bacteria 1672
372 Ga0373927_0007065 3300035695 Bacteria 7613
373 Ga0373947_0002467 3300035725 Bacteria 11129
374 Ga0373947_0003941 3300035725 Bacteria 8722
375 Ga0373947_0126504 3300035725 Bacteria 1628
376 Ga0373925_0001527 3300037068 Bacteria 19753
377 Ga0373925_0002820 3300037068 Bacteria 13703
378 Ga0373925_0353973 3300037068 Bacteria 1193
379 Ga0373925_0502926 3300037068 Bacteria 995
380 Ga0395899_0008878 3300037312 Bacteria 7738
381 Ga0395899_0044967 3300037312 Bacteria 3289
382 Ga0395899_0083996 3300037312 Bacteria 2315
383 Ga0395899_0148286 3300037312 Bacteria 1664
384 Ga0395900_0016257 3300037418 Bacteria 7583
385 Ga0395900_0019099 3300037418 Bacteria 6989
386 Ga0395900_0026336 3300037418 Bacteria 5955
387 Ga0395900_0028374 3300037418 Bacteria 5732
388 Ga0395900_0140280 3300037418 Bacteria 2475
389 Ga0395900_0171796 3300037418 Bacteria 2206
390 Ga0395900_0735882 3300037418 Bacteria 917
391 Ga0395898_0016502 3300037466 Bacteria 7554
392 Ga0395898_0020075 3300037466 Bacteria 6790
393 Ga0395898_0054427 3300037466 Bacteria 3905
394 Ga0395898_0058561 3300037466 Bacteria 3750
395 Ga0395898_0072804 3300037466 Bacteria 3319
396 Ga0395898_0117585 3300037466 Bacteria 2547
397 Ga0395898_0154098 3300037466 Bacteria 2198
398 Ga0395898_0430893 3300037466 Bacteria 1257
399 Ga0395898_0495078 3300037466 Bacteria 1163
400 Ga0395905_0022721 3300037471 Bacteria 5930
401 Ga0395905_0035769 3300037471 Bacteria 4664
402 Ga0395905_0059823 3300037471 Bacteria 3562
403 Ga0395905_0142481 3300037471 Bacteria 2254
404 Ga0395901_0018485 3300038443 Bacteria 7116
405 Ga0395901_0035704 3300038443 Bacteria 5136
406 Ga0395901_0053799 3300038443 Bacteria 4183
407 Ga0395901_0057906 3300038443 Bacteria 4030
408 Ga0395901_0139848 3300038443 Bacteria 2544
409 Ga0395901_0159848 3300038443 Bacteria 2366
410 Ga0395901_0244881 3300038443 Bacteria 1869
411 Ga0395901_0697920 3300038443 Bacteria 1013
412 Ga0439439_0004018 3300041406 Bacteria 3282
413 Ga0439461_0039326 3300041410 Bacteria 1016
414 Ga0451853_2920526 3300041512 Bacteria 1565
415 Ga0439431_0029845 3300041997 Bacteria 1348
416 Ga0450920_001273 3300042122 Bacteria 4147
417 Ga0439446_0001447 3300042156 Bacteria 5415
418 Ga0439434_0004304 3300042435 Bacteria 4161
419 Ga0466961_0036487 3300044693 Bacteria 3155
420 Ga0466963_0007240 3300044694 Bacteria 6617
421 Ga0466963_0009165 3300044694 Bacteria 5953
422 Ga0466963_0015568 3300044694 Bacteria 4712
423 Ga0466963_0074598 3300044694 Bacteria 2288
424 Ga0466963_0184361 3300044694 Bacteria 1457
425 Ga0466963_0321593 3300044694 Bacteria 1089
426 Ga0466963_0468949 3300044694 Bacteria 888
427 Ga0466964_0007647 3300044706 Bacteria 4044
428 Ga0466964_0041586 3300044706 Bacteria 1860
429 Ga0466971_0008935 3300044719 Bacteria 4379
430 Ga0466957_0008381 3300044842 Bacteria 5877
431 Ga0466957_0029107 3300044842 Bacteria 3292
432 Ga0466957_0056010 3300044842 Bacteria 2410
433 Ga0466960_0014989 3300044901 Bacteria 3333
434 Ga0466959_0017268 3300045049 Bacteria 5287
435 Ga0466959_0021488 3300045049 Bacteria 4759
436 Ga0451576_0009360 3300045051 Bacteria 11361
437 Ga0466958_0041429 3300045836 Bacteria 2769
438 Ga0466958_0062080 3300045836 Bacteria 2277
439 Ga0466967_0001981 3300045976 Bacteria 12432
440 Ga0466967_0015949 3300045976 Bacteria 5907
441 Ga0466967_0036476 3300045976 Bacteria 4197
442 Ga0466967_0051537 3300045976 Unclassified 3608
443 Ga0466967_0060193 3300045976 Bacteria 3364
444 Ga0466967_0062924 3300045976 Bacteria 3295
445 Ga0466967_0262843 3300045976 Bacteria 1651
446 Ga0466967_0270537 3300045976 Bacteria 1628
447 Ga0466967_0321485 3300045976 Bacteria 1492
448 Ga0466967_0375937 3300045976 Bacteria 1379
449 Ga0466967_0662551 3300045976 Bacteria 1032
450 Ga0466967_0675497 3300045976 Bacteria 1022
451 Ga0466967_0724654 3300045976 Bacteria 986
452 Ga0495592_0000124 3300046454 Bacteria 68396
453 Ga0495592_0031471 3300046454 Bacteria 4010
454 Ga0495603_0025144 3300046455 Bacteria 3601
455 Ga0495603_0052357 3300046455 Bacteria 2424
456 Ga0495603_0062326 3300046455 Bacteria 2202
457 Ga0495603_0083414 3300046455 Bacteria 1872
458 Ga0495629_0000607 3300046459 Bacteria 29151
459 Ga0495629_0037964 3300046459 Bacteria 3394
460 Ga0495629_0051069 3300046459 Bacteria 2894
461 Ga0495629_0143366 3300046459 Bacteria 1662
462 Ga0495629_0212613 3300046459 Bacteria 1335
463 Ga0495641_0001116 3300046461 Bacteria 23103
464 Ga0495641_0001867 3300046461 Bacteria 17290
465 Ga0495641_0018285 3300046461 Bacteria 3620
466 Ga0495641_0202946 3300046461 Bacteria 889
467 Ga0495651_0000310 3300046462 Bacteria 37941
468 Ga0495651_0116756 3300046462 Bacteria 1965
469 Ga0495651_0202618 3300046462 Unclassified 1388
470 Ga0495653_0000599 3300046463 Bacteria 27664
471 Ga0495653_0010560 3300046463 Bacteria 7562
472 Ga0495653_0045594 3300046463 Bacteria 3399
473 Ga0495653_0111486 3300046463 Bacteria 1965
474 Ga0495580_0067956 3300046472 Bacteria 2493
475 Ga0495582_0000372 3300046473 Bacteria 24529
476 Ga0495582_0003449 3300046473 Bacteria 8913
477 Ga0495582_0030273 3300046473 Bacteria 2971
478 Ga0495582_0047726 3300046473 Bacteria 2358
479 Ga0495639_0001653 3300046475 Bacteria 9926
480 Ga0495639_0003719 3300046475 Bacteria 6565
481 Ga0495639_0025472 3300046475 Bacteria 2609
482 Ga0495662_0000207 3300046476 Bacteria 24452
483 Ga0495662_0024263 3300046476 Bacteria 2926
484 Ga0495664_0002089 3300046477 Bacteria 10680
485 Ga0495584_0029002 3300046491 Bacteria 2805
486 Ga0495584_0102129 3300046491 Unclassified 1450
487 Ga0495585_0110035 3300046492 Bacteria 1466
488 Ga0495596_0055569 3300046500 Unclassified 1547
489 Ga0495608_0001941 3300046511 Bacteria 14842
490 Ga0495608_0017681 3300046511 Bacteria 4930
491 Ga0495618_0000808 3300046514 Bacteria 21809
492 Ga0495618_0010550 3300046514 Bacteria 5590
493 Ga0495618_0053581 3300046514 Bacteria 2550
494 Ga0495618_0097505 3300046514 Bacteria 1881
495 Ga0495618_0184505 3300046514 Bacteria 1325
496 Ga0495628_0000436 3300046516 Bacteria 37941
497 Ga0495630_0016685 3300046517 Bacteria 5369
498 Ga0495630_0021670 3300046517 Bacteria 4745
499 Ga0495630_0028379 3300046517 Bacteria 4158
500 Ga0495631_0035371 3300046518 Bacteria 2235
501 Ga0495666_0000776 3300046526 Bacteria 14751
502 Ga0495666_0058000 3300046526 Bacteria 1853
503 Ga0495652_0000050 3300046529 Bacteria 120480
504 Ga0495652_0003053 3300046529 Bacteria 16782
505 Ga0495652_0185407 3300046529 Bacteria 1593
506 Ga0495665_0000111 3300046531 Bacteria 38528
507 Ga0495665_0001978 3300046531 Bacteria 11079
508 Ga0495640_0056190 3300046533 Bacteria 2689
509 Ga0495640_0066933 3300046533 Bacteria 2421
510 Ga0495586_0011125 3300046535 Bacteria 4781
511 Ga0495586_0133924 3300046535 Bacteria 1388
512 Ga0495586_0162129 3300046535 Bacteria 1261
513 Ga0495587_0000084 3300046536 Bacteria 72926
514 Ga0495587_0109444 3300046536 Bacteria 1588
515 Ga0495609_0101100 3300046538 Bacteria 1249
516 Ga0495645_0000067 3300046543 Bacteria 73037
517 Ga0495667_0013519 3300046559 Bacteria 5523
518 Ga0495667_0023888 3300046559 Bacteria 4117
519 Ga0495656_0219887 3300046615 Bacteria 949
520 Ga0495634_0011063 3300046642 Bacteria 6584
521 Ga0495634_0093685 3300046642 Bacteria 1947
522 Ga0495634_0223989 3300046642 Bacteria 1159
523 Ga0495634_0262590 3300046642 Bacteria 1053
524 Ga0495635_0034594 3300046663 Bacteria 3505
525 Ga0495635_0054154 3300046663 Bacteria 2763
526 Ga0495635_0116528 3300046663 Bacteria 1823
527 Ga0495635_0163289 3300046663 Bacteria 1515
528 Ga0495588_0106877 3300046674 Bacteria 1473
529 Ga0495657_0049340 3300046675 Bacteria 2836
530 Ga0495657_0170437 3300046675 Bacteria 1341
531 Ga0495599_0000009 3300046678 Bacteria 217299
532 Ga0495599_0017375 3300046678 Bacteria 4472
533 Ga0495623_0000264 3300046679 Bacteria 33990
534 Ga0495646_0006633 3300046680 Bacteria 7341
535 Ga0495646_0038952 3300046680 Bacteria 2932
536 Ga0495658_0000911 3300046683 Bacteria 15814
537 Ga0495658_0002150 3300046683 Bacteria 9972
538 Ga0495658_0290176 3300046683 Bacteria 1033
539 Ga0495613_0010614 3300046689 Bacteria 6831
540 Ga0495613_0014535 3300046689 Bacteria 5840
541 Ga0495613_0342421 3300046689 Bacteria 1028
542 Ga0495624_0008092 3300046690 Bacteria 7360
543 Ga0495624_0021127 3300046690 Bacteria 4322
544 Ga0495624_0044908 3300046690 Bacteria 2815
545 Ga0495624_0192181 3300046690 Bacteria 1241
546 Ga0495624_0258811 3300046690 Bacteria 1052
547 Ga0495600_0099056 3300046809 Bacteria 1900
548 Ga0495581_0000303 3300047315 Bacteria 24088
549 Ga0495581_0001922 3300047315 Bacteria 11649
550 Ga0495581_0002796 3300047315 Bacteria 9962
551 Ga0495581_0035944 3300047315 Bacteria 2865
552 Ga0495581_0138328 3300047315 Bacteria 1420
553 Ga0495581_0219629 3300047315 Bacteria 1111
554 Ga0495604_0000608 3300047317 Bacteria 30795
555 Ga0495674_0008104 3300047319 Bacteria 10026
556 Ga0495674_0106339 3300047319 Bacteria 2383
557 Ga0495676_0000450 3300047321 Bacteria 33719
558 Ga0495676_0046057 3300047321 Bacteria 3544
559 Ga0495676_0060958 3300047321 Bacteria 2953
560 Ga0495676_0149495 3300047321 Bacteria 1664
561 Ga0495680_0002792 3300047322 Bacteria 17600
562 Ga0495680_0010144 3300047322 Bacteria 8419
563 Ga0495680_0061547 3300047322 Bacteria 2887
564 Ga0495675_0000363 3300047444 Bacteria 31622
565 Ga0495684_0028355 3300047471 Bacteria 4298
566 Ga0495684_0068354 3300047471 Bacteria 2701
567 Ga0495684_0172704 3300047471 Bacteria 1606
568 Ga0495593_0007244 3300047673 Bacteria 6498
569 Ga0495593_0024859 3300047673 Bacteria 3315
570 Ga0495602_0000234 3300048088 Bacteria 51947
571 Ga0495614_0003528 3300048089 Bacteria 7008
572 Ga0495614_0012807 3300048089 Bacteria 3680
573 Ga0496100_0057462 3300048903 Bacteria 2548
574 Ga0496100_0074261 3300048903 Bacteria 2278
575 Ga0496101_0189236 3300048904 Bacteria 1588
576 Ga0496101_0502574 3300048904 Bacteria 958
577 Ga0496102_0026710 3300048905 Bacteria 5152
578 Ga0496102_0301831 3300048905 Bacteria 1509
579 Ga0496103_0224181 3300048906 Bacteria 1209
580 Ga0496103_0248859 3300048906 Bacteria 1144
581 Ga0496104_0028498 3300048907 Bacteria 5176
582 Ga0496104_0087849 3300048907 Bacteria 2969
583 Ga0496104_0175487 3300048907 Bacteria 2053
584 Ga0496104_0241696 3300048907 Bacteria 1718
585 Ga0496104_0510892 3300048907 Bacteria 1113
586 Ga0496105_0027795 3300048908 Bacteria 4624
587 Ga0496105_0212725 3300048908 Bacteria 1575
588 Ga0496106_0033197 3300048909 Bacteria 3850
589 Ga0496106_0170550 3300048909 Bacteria 1725
590 Ga0496107_0024982 3300048910 Bacteria 4229
591 Ga0496107_0237561 3300048910 Bacteria 1356
592 Ga0496108_0013326 3300048911 Bacteria 6703
593 Ga0496108_0037726 3300048911 Bacteria 4026
594 Ga0496108_0039971 3300048911 Bacteria 3909
595 Ga0496108_0040521 3300048911 Bacteria 3883
596 Ga0496108_0177278 3300048911 Bacteria 1845
597 Ga0496109_0001117 3300048912 Bacteria 22290
598 Ga0496109_0002561 3300048912 Bacteria 15221
599 Ga0496109_0039991 3300048912 Bacteria 4246
600 Ga0496109_0078000 3300048912 Bacteria 3049
601 Ga0496109_0164031 3300048912 Bacteria 2082
602 Ga0496109_0229821 3300048912 Bacteria 1745
603 Ga0496109_0379567 3300048912 Bacteria 1335
604 Ga0496110_0013018 3300048913 Bacteria 6862
605 Ga0496110_0017413 3300048913 Bacteria 6011
606 Ga0496110_0046569 3300048913 Bacteria 3794
607 Ga0496110_0089399 3300048913 Bacteria 2753
608 Ga0496110_0113120 3300048913 Bacteria 2441
609 Ga0496111_0002962 3300048914 Bacteria 10398
610 Ga0496111_0016341 3300048914 Bacteria 5112
611 Ga0496111_0322158 3300048914 Bacteria 1145
612 Ga0496112_0000390 3300048915 Bacteria 28702
613 Ga0496112_0029858 3300048915 Bacteria 5274
614 Ga0496112_0031640 3300048915 Bacteria 5133
615 Ga0496112_0040279 3300048915 Bacteria 4568
616 Ga0496112_0114224 3300048915 Bacteria 2671
617 Ga0496112_0122869 3300048915 Bacteria 2567
618 Ga0496112_0187721 3300048915 Bacteria 2030
619 Ga0496112_0228956 3300048915 Bacteria 1813
620 Ga0496112_0284890 3300048915 Bacteria 1599
621 Ga0496112_0505137 3300048915 Bacteria 1144
622 Ga0496113_0079470 3300048916 Bacteria 2511
623 Ga0496113_0090555 3300048916 Bacteria 2356
624 Ga0496113_0157474 3300048916 Bacteria 1794
625 Ga0496113_0204360 3300048916 Unclassified 1571
626 Ga0496113_0210571 3300048916 Bacteria 1547
627 Ga0496113_0605083 3300048916 Bacteria 878
628 Ga0496114_0015424 3300048917 Bacteria 6146
629 Ga0496114_0053541 3300048917 Bacteria 3364
630 Ga0496114_0338679 3300048917 Bacteria 1330
631 Ga0496114_0490626 3300048917 Bacteria 1087
632 Ga0496114_0664647 3300048917 Bacteria 916
633 Ga0496115_0008579 3300048918 Bacteria 7565
634 Ga0496115_0137849 3300048918 Bacteria 2012
635 Ga0496115_0250362 3300048918 Bacteria 1459
636 Ga0501031_0000671 3300049568 Bacteria 20378
637 Ga0501032_0000289 3300049569 Bacteria 42315
638 Ga0501033_0001004 3300049570 Bacteria 25689
639 Ga0501033_0135585 3300049570 Bacteria 1781
640 Ga0501034_0151908 3300049571 Bacteria 2291
641 Ga0501034_0326114 3300049571 Unclassified 1467
642 Ga0501036_0001436 3300049572 Bacteria 18313
643 Ga0501036_0118835 3300049572 Bacteria 2232
644 Ga0501037_0000205 3300049573 Bacteria 53176
645 Ga0501038_0001405 3300049574 Bacteria 22037
646 Ga0501039_0000149 3300049575 Bacteria 47666
647 Ga0501040_0000317 3300049576 Bacteria 28397
648 Ga0501040_0036968 3300049576 Bacteria 3315
649 Ga0501040_0152320 3300049576 Bacteria 1632
650 Ga0501041_0004443 3300049577 Bacteria 8117
651 Ga0501041_0021657 3300049577 Bacteria 3851
652 Ga0501041_0203285 3300049577 Bacteria 1242
653 Ga0501042_0000079 3300049578 Bacteria 36581
654 Ga0501042_0031749 3300049578 Bacteria 3737
655 Ga0501043_0000217 3300049579 Bacteria 52111
656 Ga0501046_0000689 3300049580 Bacteria 32787
657 Ga0501046_0035310 3300049580 Bacteria 4030
658 Ga0501047_0030191 3300049581 Bacteria 5226
659 Ga0501048_0000664 3300049582 Bacteria 24852
660 Ga0501048_0021537 3300049582 Bacteria 4720
661 Ga0501067_0043147 3300049583 Bacteria 2505
662 Ga0501068_0003163 3300049584 Bacteria 8811
663 Ga0501069_0002161 3300049585 Bacteria 9894
664 Ga0501069_0065343 3300049585 Bacteria 2034
665 Ga0501070_0003257 3300049586 Bacteria 14098
666 Ga0501070_0105251 3300049586 Bacteria 2332
667 Ga0501071_0000107 3300049587 Bacteria 32264
668 Ga0501071_0152163 3300049587 Bacteria 1726
669 Ga0501072_0005662 3300049588 Bacteria 9513
670 Ga0501073_0001108 3300049589 Bacteria 19540
671 Ga0501073_0270535 3300049589 Bacteria 1172
672 Ga0501074_0003869 3300049590 Bacteria 10663
673 Ga0501074_0020086 3300049590 Bacteria 4855
674 Ga0501075_0000070 3300049591 Bacteria 45029
675 Ga0501075_0119924 3300049591 Bacteria 2001
676 Ga0501075_0206399 3300049591 Bacteria 1499
677 Ga0501076_0000331 3300049592 Bacteria 29298
678 Ga0501077_0003683 3300049593 Bacteria 9225
679 Ga0501079_0000822 3300049741 Bacteria 21077
680 Ga0501079_0091537 3300049741 Bacteria 2356
681 Ga0501079_0100398 3300049741 Bacteria 2244
682 Ga0501079_0477847 3300049741 Bacteria 979
683 Ga0501080_0006430 3300049742 Bacteria 10544
684 Ga0501080_0007960 3300049742 Bacteria 9604
685 Ga0501081_0000820 3300049743 Bacteria 18365
686 Ga0501081_0295328 3300049743 Bacteria 1188
687 Ga0501083_0000086 3300049744 Bacteria 63536
688 Ga0501035_0044330 3300049822 Bacteria 4006
689 Ga0501044_0012086 3300049823 Bacteria 9352
690 Ga0501045_0003841 3300049824 Bacteria 10336
691 nmdc:mga00v17_116709_c1 3300050491 Bacteria 1697
692 nmdc:mga05p37_379487_c1 3300050507 Bacteria 1657
693 nmdc:mga05p37_81498_c1 3300050507 Bacteria 3986
694 nmdc:mga09592_331721_c1 3300050508 Bacteria 1317
695 nmdc:mga06r32_368682_c1 3300050510 Bacteria 1419
696 nmdc:mga06r32_42646_c1 3300050510 Bacteria 4315
697 nmdc:mga08y16_290301_c1 3300050511 Bacteria 1686
698 nmdc:mga08y16_325245_c1 3300050511 Bacteria 1582
699 nmdc:mga0n895_65577_c1 3300050512 Bacteria 3595
700 nmdc:mga0rr50_6077_c1 3300050513 Bacteria 7297
701 nmdc:mga0rr50_6103_c1 3300050513 Bacteria 7287
702 nmdc:mga08x19_23434_c1 3300050514 Bacteria 3830
703 nmdc:mga08x19_44008_c1 3300050514 Bacteria 2849
704 nmdc:mga0a205_35909_c1 3300050515 Bacteria 4761
705 Ga0495601_0009701 3300053077 Bacteria 5696
706 Ga0495601_0020160 3300053077 Bacteria 4070
707 Ga0495601_0042472 3300053077 Bacteria 2852
708 Ga0495601_0120269 3300053077 Bacteria 1705
709 Ga0495595_0152317 3300053084 Bacteria 1138
710 Ga0495619_0003374 3300053085 Bacteria 10327
711 Ga0495619_0020014 3300053085 Bacteria 4258
712 Ga0495619_0115145 3300053085 Bacteria 1840
713 Ga0495619_0265816 3300053085 Bacteria 1189
714 Ga0501084_0008450 3300054114 Bacteria 8510
715 Ga0501084_0162123 3300054114 Bacteria 1886
716 Ga0590075_036243 3300059424 Bacteria 1257
717 Ga0501082_0001195 3300060353 Bacteria 22857
718 Ga0466962_0004082 3300061719 Bacteria 6993
719 Ga0530510_0002191 3300061734 Bacteria 13395
720 Ga0530510_0031417 3300061734 Bacteria 3818
721 Ga0466963_0254649
722 JGI25407J50210_10037201
723 Ga0070658_10005067
724 Ga0070658_10009665
725 Ga0070658_10009919
726 Ga0070658_10070161
727 Ga0070658_10147864
728 Ga0070683_100105842
729 Ga0070683_100526989
730 Ga0070690_100084102
731 Ga0070690_100157982
732 Ga0070670_100005965
733 Ga0070680_100019068
734 Ga0070680_100051865
735 Ga0070680_100182113
736 Ga0070682_100012208
737 Ga0070660_100002084
738 Ga0070660_100010360
739 Ga0070660_100048195
740 Ga0070660_100152987
741 Ga0070660_100182903
742 Ga0070691_10030649
743 Ga0070691_10084725
744 Ga0070687_100022052
745 Ga0070661_100043113
746 Ga0070661_100201216
747 Ga0070692_10138913
748 Ga0070668_100103455
749 Ga0070669_100091266
750 Ga0070675_100102959
751 Ga0070674_100075814
752 Ga0070674_100098402
753 Ga0070673_100027107
754 Ga0070688_100001335
755 Ga0070659_100021168
756 Ga0070659_100056044
757 Ga0070659_100145364
758 Ga0070667_100200917
759 Ga0070709_10049886
760 Ga0070709_10053605
761 Ga0070709_10144083
762 Ga0070714_100006363
763 Ga0070714_100074192
764 Ga0070714_100075914
765 Ga0070714_100159092
766 Ga0070714_100563244
767 Ga0070713_100840974
768 Ga0070710_10037317
769 Ga0070710_10067735
770 Ga0070701_10003191
771 Ga0070701_10207469
772 Ga0070711_100350104
773 Ga0070705_100029659
774 Ga0070705_100469145
775 Ga0070700_100097775
776 Ga0070700_100138578
777 Ga0070700_100244197
778 Ga0070694_100217499
779 Ga0070694_100293979
780 Ga0070708_100030482
781 Ga0070708_100115088
782 Ga0070708_100224126
783 Ga0070663_100008657
784 Ga0070678_100173500
785 Ga0070678_100204323
786 Ga0070681_10000870
787 Ga0070681_10011999
788 Ga0070681_10026180
789 Ga0070681_10145933
790 Ga0070681_10350767
791 Ga0068867_100002315
792 Ga0068867_100112829
793 Ga0070685_10319166
794 Ga0070706_100009221
795 Ga0070706_100025664
796 Ga0070706_100104135
797 Ga0070706_100157001
798 Ga0070707_100000499
799 Ga0070707_100102187
800 Ga0070698_100007169
801 Ga0070698_100169895
802 Ga0070698_100366559
803 Ga0070699_100086802
804 Ga0070699_100395669
805 Ga0070679_100115648
806 Ga0070679_100199946
807 Ga0070679_100256105
808 Ga0070679_100299398
809 Ga0070679_100308169
810 Ga0070684_100082322
811 Ga0070684_100207147
812 Ga0070684_100360737
813 Ga0070697_100128269
814 Ga0068853_100080154
815 Ga0068853_100479422
816 Ga0070686_100005644
817 Ga0070686_100024086
818 Ga0070695_100000005
819 Ga0070695_100046805
820 Ga0070695_100133470
821 Ga0070696_100027543
822 Ga0070696_100036365
823 Ga0070665_100038717
824 Ga0070704_100010268
825 Ga0070704_100091223
826 Ga0070704_100108666
827 Ga0070704_100294556
828 Ga0068855_100213971
829 Ga0068855_100679432
830 Ga0070664_100142699
831 Ga0070664_100164740
832 Ga0070664_100343299
833 Ga0068857_100007868
834 Ga0068857_100038703
835 Ga0068857_100232741
836 Ga0068857_100375824
837 Ga0068854_100048671
838 Ga0068856_100141424
839 Ga0068856_100174252
840 Ga0068856_100567044
841 Ga0068856_100750185
842 Ga0070702_100012206
843 Ga0070702_100076447
844 Ga0068852_100127396
845 Ga0068852_100392871
846 Ga0068866_10005257
847 Ga0068866_10096757
848 Ga0068870_10001681
849 Ga0068863_100220564
850 Ga0068860_100100032
851 Ga0068860_100176733
852 Ga0081455_10010902
853 Ga0081455_10127859
854 Ga0081538_10000531
855 Ga0081538_10006735
856 Ga0081538_10126919
857 Ga0081539_10001582
858 Ga0070717_10010897
859 Ga0070717_10011613
860 Ga0070717_10012034
861 Ga0070717_10053273
862 Ga0070717_10106177
863 Ga0070717_10248596
864 Ga0075365_10175590
865 Ga0075364_10015843
866 Ga0075432_10016731
867 Ga0070716_100136889
868 Ga0070712_100083999
869 Ga0068871_100059434
870 Ga0068871_100288602
871 Ga0075428_100359776
872 Ga0075431_100049253
873 Ga0075431_100343762
874 Ga0075433_10061216
875 Ga0075433_10062999
876 Ga0068865_100008726
877 Ga0068865_100213549
878 Ga0075436_100009010
879 Ga0075435_100020369
880 Ga0075435_100021671
881 Ga0105240_10010278
882 Ga0105240_10290427
883 Ga0111539_10026631
884 Ga0111539_10070886
885 Ga0111539_10250925
886 Ga0111539_10362946
887 Ga0111539_10840104
888 Ga0105245_10097836
889 Ga0105245_10121059
890 Ga0105247_10287186
891 Ga0114129_10073321
892 Ga0114129_10113350
893 Ga0105243_10020894
894 Ga0105243_10336224
895 Ga0105242_10011334
896 Ga0105248_10170911
897 Ga0105248_10604925
898 Ga0105237_10113772
899 Ga0105237_10265665
900 Ga0105238_10243998
901 Ga0105249_10036376
902 Ga0105249_10115126
903 Ga0105239_10089971
904 Ga0105239_10122930
905 Ga0105239_10509577
906 Ga0157371_10012788
907 Ga0157370_10007418
908 Ga0157370_10073012
909 Ga0157370_10212724
910 Ga0157370_10243339
911 Ga0157369_10003200
912 Ga0157369_10048500
913 Ga0157369_10108289
914 Ga0157369_10401179
915 Ga0157374_10001910
916 Ga0157378_10068324
917 Ga0163162_10022800
918 Ga0163162_10333502
919 Ga0157375_10014891
920 Ga0157375_10071713
921 Ga0157375_10147870
922 Ga0157375_10223878
923 Ga0157375_10224644
924 Ga0157380_10087954
925 Ga0182008_10026919
926 Ga0182008_10067478
927 Ga0157377_10002074
928 Ga0157376_10008931
929 Ga0157376_10021984
930 Ga0157376_10220874
931 Ga0163161_10119548
932 Ga0197907_11168973
933 Ga0206356_10015860
934 Ga0206356_11892464
935 Ga0206354_11647680
936 Ga0206353_10474326
937 Ga0206353_11246867
938 Ga0207692_10041910
939 Ga0207688_10115413
940 Ga0207643_10001454
941 Ga0207643_10319711
942 Ga0207705_10006869
943 Ga0207684_10066919
944 Ga0207684_10123935
945 Ga0207684_10149007
946 Ga0207707_10003093
947 Ga0207707_10145049
948 Ga0207707_10148092
949 Ga0207707_10188350
950 Ga0207707_10695881
951 Ga0207695_10024627
952 Ga0207695_10041943
953 Ga0207695_10228239
954 Ga0207693_10000175
955 Ga0207693_10005241
956 Ga0207693_10124745
957 Ga0207660_10016180
958 Ga0207660_10169774
959 Ga0207657_10002919
960 Ga0207657_10007326
961 Ga0207657_10009371
962 Ga0207657_10027664
963 Ga0207657_10045707
964 Ga0207657_10046866
965 Ga0207657_10053684
966 Ga0207652_10045947
967 Ga0207652_10224814
968 Ga0207652_10236495
969 Ga0207646_10000903
970 Ga0207646_10013338
971 Ga0207646_10265206
972 Ga0207694_10102242
973 Ga0207694_10235330
974 Ga0207650_10018208
975 Ga0207659_10156237
976 Ga0207687_10259134
977 Ga0207700_10680183
978 Ga0207664_10014135
979 Ga0207664_10056229
980 Ga0207664_10066412
981 Ga0207664_10169161
982 Ga0207664_10224073
983 Ga0207664_10230705
984 Ga0207664_10377730
985 Ga0207664_10536220
986 Ga0207644_10125205
987 Ga0207690_10143537
988 Ga0207690_10166348
989 Ga0207690_10254007
990 Ga0207706_10007998
991 Ga0207706_10142098
992 Ga0207669_10002491
993 Ga0207669_10074594
994 Ga0207669_10098358
995 Ga0207665_10010583
996 Ga0207691_10004674
997 Ga0207711_10312537
998 Ga0207689_10174339
999 Ga0207661_10040413
1000 Ga0207661_10161114
1001 Ga0207661_10325895
1002 Ga0207661_10547560
1003 Ga0207679_10076890
1004 Ga0207679_10425207
1005 Ga0207667_10675803
1006 Ga0207667_10763371
1007 Ga0207651_10216597
1008 Ga0207712_10101840
1009 Ga0207712_10319867
1010 Ga0207668_10170096
1011 Ga0207668_10421504
1012 Ga0207640_10395281
1013 Ga0207658_10435372
1014 Ga0207677_10337042
1015 Ga0207703_10148456
1016 Ga0207639_10365298
1017 Ga0207639_10403310
1018 Ga0207708_10006150
1019 Ga0207708_10022931
1020 Ga0207708_10053844
1021 Ga0207702_10020325
1022 Ga0207702_10084955
1023 Ga0207641_10116902
1024 Ga0207648_10000150
1025 Ga0207648_10001463
1026 Ga0207674_10012665
1027 Ga0207674_10047390
1028 Ga0207675_100017001
1029 Ga0207675_100020233
1030 Ga0207683_10000131
1031 Ga0207683_10066955
1032 Ga0207683_10290332
1033 Ga0209966_1020534
1034 Ga0207428_10012901
1035 Ga0268266_10081625
1036 Ga0265319_1005673
1037 Ga0265319_1005744
1038 Ga0265334_10046396
1039 Ga0265318_10000834
1040 Ga0265318_10011876
1041 Ga0265323_10028518
1042 Ga0265322_10016600
1043 Ga0265322_10018877
1044 Ga0265336_10035669
1045 Ga0265338_10016043
1046 Ga0265338_10036385
1047 Ga0265338_10063620
1048 Ga0265338_10349495
1049 Ga0265324_10096230
1050 Ga0265330_10006324
1051 Ga0265332_10002374
1052 Ga0265332_10028478
1053 Ga0265328_10011998
1054 Ga0265320_10081349
1055 Ga0265325_10052766
1056 Ga0265325_10058447
1057 Ga0265329_10002938
1058 Ga0265340_10006769
1059 Ga0265339_10003289
1060 Ga0265331_10031227
1061 Ga0265331_10100154
1062 Ga0265327_10038720
1063 Ga0265327_10077245
1064 Ga0265316_10078049
1065 Ga0265313_10009032
1066 Ga0265313_10014012
1067 Ga0265313_10034822
1068 Ga0265314_10050996
1069 Ga0265314_10161043
1070 Ga0265314_10168361
1071 Ga0265314_10230285
1072 Ga0265342_10015437
1073 Ga0307406_10462169
1074 Ga0307416_100043566
1075 Ga0373926_0008664
1076 Ga0373926_0015810
1077 Ga0373926_0023801
1078 Ga0373936_0066756
1079 Ga0373945_0004925
1080 Ga0373945_0014403
1081 Ga0373960_0064192
1082 Ga0373943_0001000
1083 Ga0373943_0002001
1084 Ga0373943_0046038
1085 Ga0373943_0115303
1086 Ga0373946_0003724
1087 Ga0373946_0029677
1088 Ga0373931_0127783
1089 Ga0373935_0019335
1090 Ga0373935_0106225
1091 Ga0373935_0133157
1092 Ga0373927_0007065
1093 Ga0373947_0002467
1094 Ga0373947_0003941
1095 Ga0373947_0126504
1096 Ga0373925_0001527
1097 Ga0373925_0002820
1098 Ga0373925_0353973
1099 Ga0373925_0502926
1100 Ga0395899_0008878
1101 Ga0395899_0044967
1102 Ga0395899_0083996
1103 Ga0395899_0148286
1104 Ga0395900_0016257
1105 Ga0395900_0019099
1106 Ga0395900_0026336
1107 Ga0395900_0028374
1108 Ga0395900_0140280
1109 Ga0395900_0171796
1110 Ga0395900_0735882
1111 Ga0395898_0016502
1112 Ga0395898_0020075
1113 Ga0395898_0054427
1114 Ga0395898_0058561
1115 Ga0395898_0072804
1116 Ga0395898_0117585
1117 Ga0395898_0154098
1118 Ga0395898_0430893
1119 Ga0395898_0495078
1120 Ga0395905_0022721
1121 Ga0395905_0035769
1122 Ga0395905_0059823
1123 Ga0395905_0142481
1124 Ga0395901_0018485
1125 Ga0395901_0035704
1126 Ga0395901_0053799
1127 Ga0395901_0057906
1128 Ga0395901_0139848
1129 Ga0395901_0159848
1130 Ga0395901_0244881
1131 Ga0395901_0697920
1132 Ga0439439_0004018
1133 Ga0439461_0039326
1134 Ga0451853_2920526
1135 Ga0439431_0029845
1136 Ga0450920_001273
1137 Ga0439446_0001447
1138 Ga0439434_0004304
1139 Ga0466961_0036487
1140 Ga0466963_0007240
1141 Ga0466963_0009165
1142 Ga0466963_0015568
1143 Ga0466963_0074598
1144 Ga0466963_0184361
1145 Ga0466963_0321593
1146 Ga0466963_0468949
1147 Ga0466964_0007647
1148 Ga0466964_0041586
1149 Ga0466971_0008935
1150 Ga0466957_0008381
1151 Ga0466957_0029107
1152 Ga0466957_0056010
1153 Ga0466960_0014989
1154 Ga0466959_0017268
1155 Ga0466959_0021488
1156 Ga0451576_0009360
1157 Ga0466958_0041429
1158 Ga0466958_0062080
1159 Ga0466967_0001981
1160 Ga0466967_0015949
1161 Ga0466967_0036476
1162 Ga0466967_0051537
1163 Ga0466967_0060193
1164 Ga0466967_0062924
1165 Ga0466967_0262843
1166 Ga0466967_0270537
1167 Ga0466967_0321485
1168 Ga0466967_0375937
1169 Ga0466967_0662551
1170 Ga0466967_0675497
1171 Ga0466967_0724654
1172 Ga0495592_0000124
1173 Ga0495592_0031471
1174 Ga0495603_0025144
1175 Ga0495603_0052357
1176 Ga0495603_0062326
1177 Ga0495603_0083414
1178 Ga0495629_0000607
1179 Ga0495629_0037964
1180 Ga0495629_0051069
1181 Ga0495629_0143366
1182 Ga0495629_0212613
1183 Ga0495641_0001116
1184 Ga0495641_0001867
1185 Ga0495641_0018285
1186 Ga0495641_0202946
1187 Ga0495651_0000310
1188 Ga0495651_0116756
1189 Ga0495651_0202618
1190 Ga0495653_0000599
1191 Ga0495653_0010560
1192 Ga0495653_0045594
1193 Ga0495653_0111486
1194 Ga0495580_0067956
1195 Ga0495582_0000372
1196 Ga0495582_0003449
1197 Ga0495582_0030273
1198 Ga0495582_0047726
1199 Ga0495639_0001653
1200 Ga0495639_0003719
1201 Ga0495639_0025472
1202 Ga0495662_0000207
1203 Ga0495662_0024263
1204 Ga0495664_0002089
1205 Ga0495584_0029002
1206 Ga0495584_0102129
1207 Ga0495585_0110035
1208 Ga0495596_0055569
1209 Ga0495608_0001941
1210 Ga0495608_0017681
1211 Ga0495618_0000808
1212 Ga0495618_0010550
1213 Ga0495618_0053581
1214 Ga0495618_0097505
1215 Ga0495618_0184505
1216 Ga0495628_0000436
1217 Ga0495630_0016685
1218 Ga0495630_0021670
1219 Ga0495630_0028379
1220 Ga0495631_0035371
1221 Ga0495666_0000776
1222 Ga0495666_0058000
1223 Ga0495652_0000050
1224 Ga0495652_0003053
1225 Ga0495652_0185407
1226 Ga0495665_0000111
1227 Ga0495665_0001978
1228 Ga0495640_0056190
1229 Ga0495640_0066933
1230 Ga0495586_0011125
1231 Ga0495586_0133924
1232 Ga0495586_0162129
1233 Ga0495587_0000084
1234 Ga0495587_0109444
1235 Ga0495609_0101100
1236 Ga0495645_0000067
1237 Ga0495667_0013519
1238 Ga0495667_0023888
1239 Ga0495656_0219887
1240 Ga0495634_0011063
1241 Ga0495634_0093685
1242 Ga0495634_0223989
1243 Ga0495634_0262590
1244 Ga0495635_0034594
1245 Ga0495635_0054154
1246 Ga0495635_0116528
1247 Ga0495635_0163289
1248 Ga0495588_0106877
1249 Ga0495657_0049340
1250 Ga0495657_0170437
1251 Ga0495599_0000009
1252 Ga0495599_0017375
1253 Ga0495623_0000264
1254 Ga0495646_0006633
1255 Ga0495646_0038952
1256 Ga0495658_0000911
1257 Ga0495658_0002150
1258 Ga0495658_0290176
1259 Ga0495613_0010614
1260 Ga0495613_0014535
1261 Ga0495613_0342421
1262 Ga0495624_0008092
1263 Ga0495624_0021127
1264 Ga0495624_0044908
1265 Ga0495624_0192181
1266 Ga0495624_0258811
1267 Ga0495600_0099056
1268 Ga0495581_0000303
1269 Ga0495581_0001922
1270 Ga0495581_0002796
1271 Ga0495581_0035944
1272 Ga0495581_0138328
1273 Ga0495581_0219629
1274 Ga0495604_0000608
1275 Ga0495674_0008104
1276 Ga0495674_0106339
1277 Ga0495676_0000450
1278 Ga0495676_0046057
1279 Ga0495676_0060958
1280 Ga0495676_0149495
1281 Ga0495680_0002792
1282 Ga0495680_0010144
1283 Ga0495680_0061547
1284 Ga0495675_0000363
1285 Ga0495684_0028355
1286 Ga0495684_0068354
1287 Ga0495684_0172704
1288 Ga0495593_0007244
1289 Ga0495593_0024859
1290 Ga0495602_0000234
1291 Ga0495614_0003528
1292 Ga0495614_0012807
1293 Ga0496100_0057462
1294 Ga0496100_0074261
1295 Ga0496101_0189236
1296 Ga0496101_0502574
1297 Ga0496102_0026710
1298 Ga0496102_0301831
1299 Ga0496103_0224181
1300 Ga0496103_0248859
1301 Ga0496104_0028498
1302 Ga0496104_0087849
1303 Ga0496104_0175487
1304 Ga0496104_0241696
1305 Ga0496104_0510892
1306 Ga0496105_0027795
1307 Ga0496105_0212725
1308 Ga0496106_0033197
1309 Ga0496106_0170550
1310 Ga0496107_0024982
1311 Ga0496107_0237561
1312 Ga0496108_0013326
1313 Ga0496108_0037726
1314 Ga0496108_0039971
1315 Ga0496108_0040521
1316 Ga0496108_0177278
1317 Ga0496109_0001117
1318 Ga0496109_0002561
1319 Ga0496109_0039991
1320 Ga0496109_0078000
1321 Ga0496109_0164031
1322 Ga0496109_0229821
1323 Ga0496109_0379567
1324 Ga0496110_0013018
1325 Ga0496110_0017413
1326 Ga0496110_0046569
1327 Ga0496110_0089399
1328 Ga0496110_0113120
1329 Ga0496111_0002962
1330 Ga0496111_0016341
1331 Ga0496111_0322158
1332 Ga0496112_0000390
1333 Ga0496112_0029858
1334 Ga0496112_0031640
1335 Ga0496112_0040279
1336 Ga0496112_0114224
1337 Ga0496112_0122869
1338 Ga0496112_0187721
1339 Ga0496112_0228956
1340 Ga0496112_0284890
1341 Ga0496112_0505137
1342 Ga0496113_0079470
1343 Ga0496113_0090555
1344 Ga0496113_0157474
1345 Ga0496113_0204360
1346 Ga0496113_0210571
1347 Ga0496113_0605083
1348 Ga0496114_0015424
1349 Ga0496114_0053541
1350 Ga0496114_0338679
1351 Ga0496114_0490626
1352 Ga0496114_0664647
1353 Ga0496115_0008579
1354 Ga0496115_0137849
1355 Ga0496115_0250362
1356 Ga0501031_0000671
1357 Ga0501032_0000289
1358 Ga0501033_0001004
1359 Ga0501033_0135585
1360 Ga0501034_0151908
1361 Ga0501034_0326114
1362 Ga0501036_0001436
1363 Ga0501036_0118835
1364 Ga0501037_0000205
1365 Ga0501038_0001405
1366 Ga0501039_0000149
1367 Ga0501040_0000317
1368 Ga0501040_0036968
1369 Ga0501040_0152320
1370 Ga0501041_0004443
1371 Ga0501041_0021657
1372 Ga0501041_0203285
1373 Ga0501042_0000079
1374 Ga0501042_0031749
1375 Ga0501043_0000217
1376 Ga0501046_0000689
1377 Ga0501046_0035310
1378 Ga0501047_0030191
1379 Ga0501048_0000664
1380 Ga0501048_0021537
1381 Ga0501067_0043147
1382 Ga0501068_0003163
1383 Ga0501069_0002161
1384 Ga0501069_0065343
1385 Ga0501070_0003257
1386 Ga0501070_0105251
1387 Ga0501071_0000107
1388 Ga0501071_0152163
1389 Ga0501072_0005662
1390 Ga0501073_0001108
1391 Ga0501073_0270535
1392 Ga0501074_0003869
1393 Ga0501074_0020086
1394 Ga0501075_0000070
1395 Ga0501075_0119924
1396 Ga0501075_0206399
1397 Ga0501076_0000331
1398 Ga0501077_0003683
1399 Ga0501079_0000822
1400 Ga0501079_0091537
1401 Ga0501079_0100398
1402 Ga0501079_0477847
1403 Ga0501080_0006430
1404 Ga0501080_0007960
1405 Ga0501081_0000820
1406 Ga0501081_0295328
1407 Ga0501083_0000086
1408 Ga0501035_0044330
1409 Ga0501044_0012086
1410 Ga0501045_0003841
1411 nmdc:mga00v17_116709_c1
1412 nmdc:mga05p37_379487_c1
1413 nmdc:mga05p37_81498_c1
1414 nmdc:mga09592_331721_c1
1415 nmdc:mga06r32_368682_c1
1416 nmdc:mga06r32_42646_c1
1417 nmdc:mga08y16_290301_c1
1418 nmdc:mga08y16_325245_c1
1419 nmdc:mga0n895_65577_c1
1420 nmdc:mga0rr50_6077_c1
1421 nmdc:mga0rr50_6103_c1
1422 nmdc:mga08x19_23434_c1
1423 nmdc:mga08x19_44008_c1
1424 nmdc:mga0a205_35909_c1
1425 Ga0495601_0009701
1426 Ga0495601_0020160
1427 Ga0495601_0042472
1428 Ga0495601_0120269
1429 Ga0495595_0152317
1430 Ga0495619_0003374
1431 Ga0495619_0020014
1432 Ga0495619_0115145
1433 Ga0495619_0265816
1434 Ga0501084_0008450
1435 Ga0501084_0162123
1436 Ga0590075_036243
1437 Ga0501082_0001195
1438 Ga0466962_0004082
1439 Ga0530510_0002191
1440 Ga0530510_0031417

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00590

TP_methylase

Tetrapyrrole (Corrin/Porphyrin) Methylases

16

216

0.89

PF23016

RsmI_C

RsmI C-terminal HTH domain

237

280

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3kwp-assembly1.cif.gz_A-2 crystal structure of putative methyltransferase from lactobacillus brevis 0.9294 3 221
5hw4-assembly1.cif.gz_B crystal structure of escherichia coli 16s rrna methyltransferase rsmi in complex with adomet 0.9054 2 221
5hw4-assembly2.cif.gz_C-2 crystal structure of escherichia coli 16s rrna methyltransferase rsmi in complex with adomet 0.9024 2 219
5hw4-assembly1.cif.gz_A crystal structure of escherichia coli 16s rrna methyltransferase rsmi in complex with adomet 0.8961 2 224
3kwp-assembly1.cif.gz_A-2 crystal structure of putative methyltransferase from lactobacillus brevis 0.8906 3 221
ID Description Score Start End Superfamily
af_P9WGW7_115_230_3.30.950.10 Alpha Beta;2-Layer Sandwich;Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2;Tetrapyrrole methylase, C-terminal domain 0.9404 110 224 3.30.950.10
af_P9WGW7_115_230_3.30.950.10 Alpha Beta;2-Layer Sandwich;Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2;Tetrapyrrole methylase, C-terminal domain 0.9249 110 224 3.30.950.10
af_P9WGW7_1_114_3.40.1010.10 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.9187 2 109 3.40.1010.10
5hw4C01 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.9171 2 109 3.40.1010.10
af_Q338C6_169_282_3.30.950.10 Alpha Beta;2-Layer Sandwich;Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2;Tetrapyrrole methylase, C-terminal domain 0.913 111 220 3.30.950.10
ID Description Score Start End GO Terms
AF-A0A7Y5XXZ1-F1-model_v4 16S rRNA (Cytidine(1402)-2'-O)-methyltransferase (EC 2.1.1.198) 0.9612 1 174 GO:0005737
GO:0006364
GO:0008168
GO:0032259
AF-A0A7V5SGA9-F1-model_v4 16S rRNA (Cytidine(1402)-2'-O)-methyltransferase (EC 2.1.1.198) 0.9572 2 219 GO:0005737
GO:0006364
GO:0008168
GO:0032259
AF-A0A538NHE9-F1-model_v4 Ribosomal RNA small subunit methyltransferase I (EC 2.1.1.198) (16S rRNA 2'-O-ribose C1402 methyltransferase) (rRNA (cytidine-2'-O-)-methyltransferase RsmI) 0.9565 3 219 GO:0005737
GO:0070677
AF-A0A535RT32-F1-model_v4 Ribosomal RNA small subunit methyltransferase I (EC 2.1.1.198) (16S rRNA 2'-O-ribose C1402 methyltransferase) (rRNA (cytidine-2'-O-)-methyltransferase RsmI) 0.9536 2 223 GO:0005737
GO:0070677
AF-A0A1G0YZE8-F1-model_v4 Ribosomal RNA small subunit methyltransferase I (EC 2.1.1.198) (16S rRNA 2'-O-ribose C1402 methyltransferase) (rRNA (cytidine-2'-O-)-methyltransferase RsmI) 0.9515 2 223 GO:0005737
GO:0070677

Map