F477304
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 720 | 325 | 677 | 298 |
Family's Representative Sequence
| Representative Sequence | 3300021384|Ga0213876_10071368|Ga0213876_100713683 |
| Length | 336 |
| Sequence | MWTPSDIAAFGRPAEKIVPLCYPHSYMSGTVLDGKKVSREIRDELRPRIDALRSNKRAPALAVVLVGDNPASQIYVRNKIKACQELGIRSIELRPAQDITTEQLLEQISPLNRDSDVDGILIQMPLPKQIDVNTLNLHLDPMRDVDGFSAYSLGRLVRNEPAPRACTPAGIMELLKRYQISIAGRRAVVVGRSDIVGKPIALMLLHENATVTICHSKTRDLAGECRRADILIAAMGRPAAITADYIKPGAVVVDVGVNRLTNEAEVVRLFPHDTGRLAGYAKNGSTLVGDVEPMAMQEISSAYTPVPGGVGPLTIAMLMANTVKLAEMRLLGKSAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2506783011 | Frankia datiscae Dg1 | Isolate | Nodule |
| 3 | 2508501039 | Frankia saprophytica CN3 | Isolate | Nodule |
| 4 | 2517572101 | Frankia sp. DC12 | Isolate | Nodule |
| 5 | 2524023129 | Paenibacillus pinihumi DSM 23905 | Isolate | Rhizosphere |
| 6 | 2527291627 | Frankia casuarinae Thr | Isolate | Nodule |
| 7 | 2527291629 | Frankia sp. BMG5.23 | Isolate | Nodule |
| 8 | 2546825537 | Frankia sp. CcI6 | Isolate | Rhizoplane |
| 9 | 2576861822 | Frankia sp. CeD | Isolate | Nodule |
| 10 | 2579778521 | Frankia torreyi CpI1-S | Isolate | Unclassified |
| 11 | 2619618881 | Frankia sp. ACN1ag | Isolate | Unclassified |
| 12 | 2619619003 | Frankia sp. CpI1-P | Isolate | Nodule |
| 13 | 2626541554 | Frankia sp. AvcI.1 | Isolate | Nodule |
| 14 | 2675902999 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 15 | 2684623035 | Frankia sp. NRRL B-16219 | Isolate | Rhizosphere |
| 16 | 2684623036 | Frankia sp. CgIM4 | Isolate | Nodule |
| 17 | 2687453737 | Frankia sp. BMG5.36 | Isolate | Nodule |
| 18 | 2687453743 | Frankia colletiae Cc1.17 | Isolate | Nodule |
| 19 | 2710264753 | Frankia sp. KB5 | Isolate | Nodule |
| 20 | 2721755693 | Paenibacillus polymyxa YC0573 | Isolate | Rhizosphere |
| 21 | 2728369359 | Paenibacillus polymyxa YC0136 | Isolate | Rhizosphere |
| 22 | 2744054657 | Brevibacillus sp. SKDU10 | Isolate | Unclassified |
| 23 | 2751185905 | Paenibacillus kribbensis 6hRe76 | Isolate | Unclassified |
| 24 | 2773857921 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 25 | 2773857924 | Frankia sp. CgIS1 | Isolate | Nodule |
| 26 | 2802428803 | Paenibacillus peoriae NMA1017 | Isolate | Rhizosphere |
| 27 | 2816332336 | Brevibacillus laterosporus ZQ2 | Isolate | Unclassified |
| 28 | 2889276214 | Paenibacillus sp. PvR133 | Isolate | Rhizosphere |
| 29 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 30 | 2904113452 | Paenibacillus paridis py1325 | Isolate | Unclassified |
| 31 | 2904595352 | Paenibacillus sp. 1182 | Isolate | Unclassified |
| 32 | 2919414237 | Neobacillus niacini 3240 | Isolate | Rhizosphere |
| 33 | 2925326138 | Paenibacillus hemerocallicola KCTC 33185 | Isolate | Unclassified |
| 34 | 2939702853 | Paenibacillus sp. PvR008 | Isolate | Rhizosphere |
| 35 | 2996706504 | Paenibacillus sp. OT2-17 | Isolate | Rhizosphere |
| 36 | 3006969106 | Bacillus sp. FJAT-50079 | Isolate | Rhizosphere |
| 37 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 38 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 39 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 40 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 41 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 42 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 45 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 46 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 48 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 50 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 65 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 69 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 70 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 72 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 80 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 82 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 83 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 84 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 85 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 86 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 87 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 88 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 89 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 90 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 91 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 92 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 93 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 94 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 96 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 98 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 99 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 100 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 101 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 102 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 103 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 104 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 105 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 107 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 108 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 131 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 134 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 135 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 136 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 137 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 138 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 140 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 183 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 187 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 188 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 189 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 190 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 191 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 192 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 193 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 194 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 195 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 196 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 197 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 198 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 199 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 200 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 201 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 202 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 203 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 204 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 205 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 206 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 207 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 208 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 209 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 210 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 211 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 212 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 213 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 214 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 215 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 216 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 217 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 218 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 219 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 220 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 221 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 222 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 223 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 224 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 225 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 226 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 227 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 228 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 229 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 230 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 231 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 232 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 233 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 234 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 235 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 236 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 237 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 238 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 262 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 263 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 264 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 265 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 266 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 267 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 268 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 269 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 270 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 271 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 272 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 273 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 274 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 275 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 276 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 277 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 278 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 279 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 280 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 281 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 282 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 314 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 315 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 316 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 318 | 637000116 | Frankia casuarinae CcI3 | Isolate | Nodule |
| 319 | 648028048 | Paenibacillus polymyxa E681 | Isolate | Rhizosphere |
| 320 | 8002775197 | Frankia nepalensis CN7 | Isolate | Nodule |
| 321 | 8002784119 | Frankia sp. AgB1.9 | Isolate | Nodule |
| 322 | 8054913762 | Frankia gtarii Agncl-10 | Isolate | Nodule |
| 323 | 8054920844 | Frankia tisae Agncl-8 | Isolate | Nodule |
| 324 | 8057473075 | Paenibacillus endoradicis T3-5-0-4 | Isolate | Unclassified |
| 325 | 8057977335 | Paenibacillus oenotherae DT7-4 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.03 |
| Metatranscriptomes | 0 |
| Isolates | 5.97 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.56 |
| Nodule | 2.78 |
| Rhizoplane | 3.47 |
| Rhizosphere | 81.53 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.67 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_2607737 | 2162886012 | Bacteria | 1941 |
| 2 | LJQas_1000007 | 3300000549 | Bacteria | 31319 |
| 3 | JGI25406J46586_10031864 | 3300003203 | Bacteria | 1966 |
| 4 | Ga0055541_1006232 | 3300003841 | Bacteria | 2034 |
| 5 | Ga0065704_10093027 | 3300005289 | Bacteria | 2621 |
| 6 | Ga0065715_10124535 | 3300005293 | Bacteria | 2152 |
| 7 | Ga0070658_10017385 | 3300005327 | Bacteria | 5754 |
| 8 | Ga0070658_10169684 | 3300005327 | Bacteria | 1833 |
| 9 | Ga0070683_100013341 | 3300005329 | Bacteria | 7164 |
| 10 | Ga0070683_100018105 | 3300005329 | Bacteria | 6234 |
| 11 | Ga0070683_100046079 | 3300005329 | Bacteria | 4026 |
| 12 | Ga0070683_100263147 | 3300005329 | Bacteria | 1641 |
| 13 | Ga0070690_100053341 | 3300005330 | Unclassified | 2587 |
| 14 | Ga0070690_100386479 | 3300005330 | Bacteria | 1024 |
| 15 | Ga0068869_100023139 | 3300005334 | Bacteria | 4287 |
| 16 | Ga0070680_100009354 | 3300005336 | Bacteria | 7528 |
| 17 | Ga0070680_100010904 | 3300005336 | Bacteria | 7022 |
| 18 | Ga0070680_100038161 | 3300005336 | Unclassified | 3884 |
| 19 | Ga0070680_100307333 | 3300005336 | Bacteria | 1345 |
| 20 | Ga0068868_100002275 | 3300005338 | Bacteria | 13264 |
| 21 | Ga0070660_100034314 | 3300005339 | Bacteria | 3832 |
| 22 | Ga0070660_100167511 | 3300005339 | Bacteria | 1773 |
| 23 | Ga0070689_100034718 | 3300005340 | Bacteria | 3848 |
| 24 | Ga0070691_10017606 | 3300005341 | Bacteria | 3288 |
| 25 | Ga0070661_100013004 | 3300005344 | Bacteria | 5834 |
| 26 | Ga0070661_100026126 | 3300005344 | Bacteria | 4197 |
| 27 | Ga0070661_100115847 | 3300005344 | Bacteria | 2004 |
| 28 | Ga0070661_100286029 | 3300005344 | Unclassified | 1280 |
| 29 | Ga0070668_100049194 | 3300005347 | Bacteria | 3244 |
| 30 | Ga0070675_100155155 | 3300005354 | Bacteria | 1965 |
| 31 | Ga0070671_100312434 | 3300005355 | Bacteria | 1339 |
| 32 | Ga0070674_100020577 | 3300005356 | Bacteria | 4219 |
| 33 | Ga0070659_100083707 | 3300005366 | Bacteria | 2550 |
| 34 | Ga0070709_10106829 | 3300005434 | Bacteria | 1875 |
| 35 | Ga0070709_10127394 | 3300005434 | Bacteria | 1734 |
| 36 | Ga0070709_10301612 | 3300005434 | Bacteria | 1170 |
| 37 | Ga0070713_100093866 | 3300005436 | Bacteria | 2586 |
| 38 | Ga0070713_100147555 | 3300005436 | Bacteria | 2089 |
| 39 | Ga0070713_100211971 | 3300005436 | Bacteria | 1754 |
| 40 | Ga0070711_100030940 | 3300005439 | Bacteria | 3549 |
| 41 | Ga0070711_100242037 | 3300005439 | Unclassified | 1411 |
| 42 | Ga0070711_100277359 | 3300005439 | Bacteria | 1325 |
| 43 | Ga0070700_100403488 | 3300005441 | Bacteria | 1028 |
| 44 | Ga0070694_100037348 | 3300005444 | Bacteria | 3222 |
| 45 | Ga0070708_100015506 | 3300005445 | Bacteria | 6298 |
| 46 | Ga0070708_100081034 | 3300005445 | Bacteria | 2938 |
| 47 | Ga0070678_100179288 | 3300005456 | Bacteria | 1733 |
| 48 | Ga0070678_100219297 | 3300005456 | Bacteria | 1580 |
| 49 | Ga0070681_10000605 | 3300005458 | Bacteria | 29575 |
| 50 | Ga0070681_10005377 | 3300005458 | Bacteria | 12369 |
| 51 | Ga0070681_10034973 | 3300005458 | Bacteria | 5046 |
| 52 | Ga0070681_10043027 | 3300005458 | Bacteria | 4525 |
| 53 | Ga0070681_10150205 | 3300005458 | Bacteria | 2256 |
| 54 | Ga0070681_10213804 | 3300005458 | Bacteria | 1844 |
| 55 | Ga0070706_100027585 | 3300005467 | Bacteria | 5226 |
| 56 | Ga0070707_100089736 | 3300005468 | Bacteria | 2975 |
| 57 | Ga0070707_100156247 | 3300005468 | Bacteria | 2222 |
| 58 | Ga0070707_100294931 | 3300005468 | Bacteria | 1576 |
| 59 | Ga0070699_100024627 | 3300005518 | Bacteria | 5188 |
| 60 | Ga0070699_100208234 | 3300005518 | Bacteria | 1740 |
| 61 | Ga0070679_100005804 | 3300005530 | Bacteria | 11455 |
| 62 | Ga0070679_100009024 | 3300005530 | Bacteria | 9406 |
| 63 | Ga0070679_100140602 | 3300005530 | Bacteria | 2394 |
| 64 | Ga0070679_100170443 | 3300005530 | Unclassified | 2150 |
| 65 | Ga0070684_100002114 | 3300005535 | Bacteria | 14642 |
| 66 | Ga0070684_100022521 | 3300005535 | Bacteria | 5257 |
| 67 | Ga0070684_100249089 | 3300005535 | Unclassified | 1624 |
| 68 | Ga0070697_100036073 | 3300005536 | Bacteria | 3993 |
| 69 | Ga0070697_100037641 | 3300005536 | Bacteria | 3908 |
| 70 | Ga0070697_100046586 | 3300005536 | Bacteria | 3514 |
| 71 | Ga0068853_100038145 | 3300005539 | Bacteria | 4091 |
| 72 | Ga0068853_100081151 | 3300005539 | Bacteria | 2839 |
| 73 | Ga0068853_100314152 | 3300005539 | Bacteria | 1451 |
| 74 | Ga0070672_100246532 | 3300005543 | Bacteria | 1504 |
| 75 | Ga0070686_100071878 | 3300005544 | Bacteria | 2267 |
| 76 | Ga0070695_100016987 | 3300005545 | Bacteria | 4412 |
| 77 | Ga0070695_100026911 | 3300005545 | Bacteria | 3560 |
| 78 | Ga0070695_100060897 | 3300005545 | Bacteria | 2447 |
| 79 | Ga0070696_100040063 | 3300005546 | Bacteria | 3235 |
| 80 | Ga0070693_100006824 | 3300005547 | Bacteria | 5548 |
| 81 | Ga0070665_100048003 | 3300005548 | Bacteria | 4286 |
| 82 | Ga0070665_100175928 | 3300005548 | Bacteria | 2141 |
| 83 | Ga0070665_100238239 | 3300005548 | Bacteria | 1820 |
| 84 | Ga0070704_100248779 | 3300005549 | Bacteria | 1459 |
| 85 | Ga0068855_100004587 | 3300005563 | Bacteria | 16867 |
| 86 | Ga0068855_100007492 | 3300005563 | Bacteria | 13215 |
| 87 | Ga0068855_100049900 | 3300005563 | Bacteria | 4934 |
| 88 | Ga0068855_100058864 | 3300005563 | Bacteria | 4497 |
| 89 | Ga0068855_100085120 | 3300005563 | Bacteria | 3659 |
| 90 | Ga0068855_100093880 | 3300005563 | Unclassified | 3460 |
| 91 | Ga0068855_100095978 | 3300005563 | Bacteria | 3417 |
| 92 | Ga0068855_100189752 | 3300005563 | Bacteria | 2319 |
| 93 | Ga0070664_100176442 | 3300005564 | Bacteria | 1897 |
| 94 | Ga0070664_100309057 | 3300005564 | Bacteria | 1430 |
| 95 | Ga0070664_100336510 | 3300005564 | Bacteria | 1370 |
| 96 | Ga0068857_100003819 | 3300005577 | Bacteria | 12677 |
| 97 | Ga0068857_100007396 | 3300005577 | Bacteria | 9457 |
| 98 | Ga0068854_100142677 | 3300005578 | Bacteria | 1839 |
| 99 | Ga0068856_100010972 | 3300005614 | Bacteria | 8796 |
| 100 | Ga0068856_100022526 | 3300005614 | Bacteria | 6125 |
| 101 | Ga0068856_100027489 | 3300005614 | Bacteria | 5550 |
| 102 | Ga0068856_100036394 | 3300005614 | Bacteria | 4826 |
| 103 | Ga0068856_100040539 | 3300005614 | Bacteria | 4575 |
| 104 | Ga0068856_100086445 | 3300005614 | Bacteria | 3116 |
| 105 | Ga0068856_100118059 | 3300005614 | Bacteria | 2654 |
| 106 | Ga0068856_100125226 | 3300005614 | Unclassified | 2573 |
| 107 | Ga0068856_100218103 | 3300005614 | Bacteria | 1923 |
| 108 | Ga0068852_100210130 | 3300005616 | Bacteria | 1846 |
| 109 | Ga0068852_100264604 | 3300005616 | Bacteria | 1652 |
| 110 | Ga0068852_100284848 | 3300005616 | Bacteria | 1594 |
| 111 | Ga0068859_100000054 | 3300005617 | Bacteria | 123173 |
| 112 | Ga0068859_100001223 | 3300005617 | Bacteria | 26205 |
| 113 | Ga0068859_100024538 | 3300005617 | Bacteria | 6049 |
| 114 | Ga0068859_100043795 | 3300005617 | Bacteria | 4498 |
| 115 | Ga0068859_100058013 | 3300005617 | Bacteria | 3899 |
| 116 | Ga0068859_100281892 | 3300005617 | Bacteria | 1755 |
| 117 | Ga0068864_100020562 | 3300005618 | Bacteria | 5522 |
| 118 | Ga0068864_100129878 | 3300005618 | Bacteria | 2262 |
| 119 | Ga0068864_100225252 | 3300005618 | Unclassified | 1732 |
| 120 | Ga0068861_100301950 | 3300005719 | Bacteria | 1387 |
| 121 | Ga0068863_100419081 | 3300005841 | Bacteria | 1311 |
| 122 | Ga0068863_100474461 | 3300005841 | Bacteria | 1229 |
| 123 | Ga0068858_100005980 | 3300005842 | Bacteria | 11883 |
| 124 | Ga0068858_100068750 | 3300005842 | Unclassified | 3282 |
| 125 | Ga0068858_100072117 | 3300005842 | Bacteria | 3204 |
| 126 | Ga0068858_100073980 | 3300005842 | Bacteria | 3163 |
| 127 | Ga0068858_100129946 | 3300005842 | Bacteria | 2361 |
| 128 | Ga0068858_100147216 | 3300005842 | Bacteria | 2212 |
| 129 | Ga0068858_100272745 | 3300005842 | Bacteria | 1610 |
| 130 | Ga0068860_100030585 | 3300005843 | Bacteria | 5178 |
| 131 | Ga0068862_100000037 | 3300005844 | Bacteria | 172796 |
| 132 | Ga0068862_100265430 | 3300005844 | Unclassified | 1568 |
| 133 | Ga0081455_10007431 | 3300005937 | Bacteria | 11544 |
| 134 | Ga0081455_10027970 | 3300005937 | Bacteria | 5157 |
| 135 | Ga0081455_10133534 | 3300005937 | Bacteria | 1937 |
| 136 | Ga0081539_10001047 | 3300005985 | Bacteria | 50655 |
| 137 | Ga0081539_10008121 | 3300005985 | Bacteria | 9270 |
| 138 | Ga0070717_10023812 | 3300006028 | Bacteria | 4857 |
| 139 | Ga0070717_10451066 | 3300006028 | Bacteria | 1159 |
| 140 | Ga0070712_100162944 | 3300006175 | Bacteria | 1723 |
| 141 | Ga0070712_100310671 | 3300006175 | Archaea | 1279 |
| 142 | Ga0097621_100012173 | 3300006237 | Bacteria | 6367 |
| 143 | Ga0097621_100059860 | 3300006237 | Bacteria | 3120 |
| 144 | Ga0097621_100454928 | 3300006237 | Bacteria | 1154 |
| 145 | Ga0097621_100456789 | 3300006237 | Bacteria | 1151 |
| 146 | Ga0097621_100629932 | 3300006237 | Bacteria | 982 |
| 147 | Ga0068871_100005987 | 3300006358 | Bacteria | 8558 |
| 148 | Ga0068871_100043122 | 3300006358 | Unclassified | 3624 |
| 149 | Ga0068871_100262525 | 3300006358 | Bacteria | 1507 |
| 150 | Ga0068871_100275505 | 3300006358 | Bacteria | 1470 |
| 151 | Ga0068871_100503766 | 3300006358 | Bacteria | 1092 |
| 152 | Ga0075428_100005577 | 3300006844 | Bacteria | 13988 |
| 153 | Ga0075430_100013130 | 3300006846 | Bacteria | 7057 |
| 154 | Ga0075431_100045761 | 3300006847 | Bacteria | 4511 |
| 155 | Ga0075433_10003719 | 3300006852 | Bacteria | 11807 |
| 156 | Ga0075434_100000069 | 3300006871 | Bacteria | 53659 |
| 157 | Ga0075434_100319193 | 3300006871 | Bacteria | 1574 |
| 158 | Ga0068865_100030146 | 3300006881 | Bacteria | 3605 |
| 159 | Ga0075436_100007970 | 3300006914 | Bacteria | 7254 |
| 160 | Ga0075436_100016687 | 3300006914 | Bacteria | 5026 |
| 161 | Ga0097620_100000054 | 3300006931 | Bacteria | 123173 |
| 162 | Ga0097620_100001223 | 3300006931 | Bacteria | 26205 |
| 163 | Ga0097620_100024538 | 3300006931 | Bacteria | 6049 |
| 164 | Ga0097620_100043791 | 3300006931 | Bacteria | 4498 |
| 165 | Ga0097620_100058013 | 3300006931 | Bacteria | 3899 |
| 166 | Ga0097620_100281880 | 3300006931 | Bacteria | 1755 |
| 167 | Ga0075435_100106627 | 3300007076 | Bacteria | 2327 |
| 168 | Ga0075435_100116985 | 3300007076 | Archaea | 2221 |
| 169 | Ga0099794_10069567 | 3300007265 | Bacteria | 1722 |
| 170 | Ga0105240_10003303 | 3300009093 | Bacteria | 25212 |
| 171 | Ga0105240_10003832 | 3300009093 | Bacteria | 23257 |
| 172 | Ga0105240_10013706 | 3300009093 | Bacteria | 11109 |
| 173 | Ga0105240_10037802 | 3300009093 | Bacteria | 6199 |
| 174 | Ga0105240_10063307 | 3300009093 | Bacteria | 4602 |
| 175 | Ga0105240_10084091 | 3300009093 | Bacteria | 3902 |
| 176 | Ga0105240_10156934 | 3300009093 | Bacteria | 2705 |
| 177 | Ga0105240_10664710 | 3300009093 | Bacteria | 1140 |
| 178 | Ga0105240_10716684 | 3300009093 | Bacteria | 1091 |
| 179 | Ga0111539_10077847 | 3300009094 | Bacteria | 3902 |
| 180 | Ga0111539_10263308 | 3300009094 | Bacteria | 2007 |
| 181 | Ga0111539_10340307 | 3300009094 | Bacteria | 1746 |
| 182 | Ga0105245_10002254 | 3300009098 | Bacteria | 17460 |
| 183 | Ga0105245_10061145 | 3300009098 | Bacteria | 3394 |
| 184 | Ga0105245_10107928 | 3300009098 | Bacteria | 2585 |
| 185 | Ga0105245_10157114 | 3300009098 | Bacteria | 2155 |
| 186 | Ga0105245_10262345 | 3300009098 | Bacteria | 1682 |
| 187 | Ga0105247_10000125 | 3300009101 | Bacteria | 74220 |
| 188 | Ga0105247_10005102 | 3300009101 | Bacteria | 8317 |
| 189 | Ga0105247_10071278 | 3300009101 | Bacteria | 2173 |
| 190 | Ga0114129_10299524 | 3300009147 | Bacteria | 2144 |
| 191 | Ga0114129_10333590 | 3300009147 | Bacteria | 2013 |
| 192 | Ga0105243_10090788 | 3300009148 | Bacteria | 2514 |
| 193 | Ga0105241_10008535 | 3300009174 | Bacteria | 7534 |
| 194 | Ga0105241_10045243 | 3300009174 | Unclassified | 3339 |
| 195 | Ga0105241_10138018 | 3300009174 | Bacteria | 1982 |
| 196 | Ga0105242_10013866 | 3300009176 | Bacteria | 6235 |
| 197 | Ga0105248_10000018 | 3300009177 | Bacteria | 294894 |
| 198 | Ga0105248_10003078 | 3300009177 | Bacteria | 18491 |
| 199 | Ga0105248_10045759 | 3300009177 | Bacteria | 4906 |
| 200 | Ga0105248_10054531 | 3300009177 | Bacteria | 4483 |
| 201 | Ga0105248_10085631 | 3300009177 | Bacteria | 3546 |
| 202 | Ga0105248_10107131 | 3300009177 | Bacteria | 3151 |
| 203 | Ga0105248_10232588 | 3300009177 | Bacteria | 2075 |
| 204 | Ga0105248_10239066 | 3300009177 | Bacteria | 2044 |
| 205 | Ga0105248_10332995 | 3300009177 | Unclassified | 1710 |
| 206 | Ga0105237_10000223 | 3300009545 | Bacteria | 79892 |
| 207 | Ga0105237_10021372 | 3300009545 | Bacteria | 6653 |
| 208 | Ga0105237_10046509 | 3300009545 | Bacteria | 4365 |
| 209 | Ga0105237_10077423 | 3300009545 | Bacteria | 3315 |
| 210 | Ga0105237_10110999 | 3300009545 | Bacteria | 2734 |
| 211 | Ga0105237_10173473 | 3300009545 | Bacteria | 2156 |
| 212 | Ga0105237_10457109 | 3300009545 | Bacteria | 1283 |
| 213 | Ga0105238_10008033 | 3300009551 | Bacteria | 10557 |
| 214 | Ga0105238_10008204 | 3300009551 | Bacteria | 10447 |
| 215 | Ga0105238_10011819 | 3300009551 | Bacteria | 8795 |
| 216 | Ga0105238_10018386 | 3300009551 | Bacteria | 7114 |
| 217 | Ga0105238_10062169 | 3300009551 | Bacteria | 3735 |
| 218 | Ga0105238_10063942 | 3300009551 | Bacteria | 3680 |
| 219 | Ga0105238_10118213 | 3300009551 | Bacteria | 2631 |
| 220 | Ga0105249_10089219 | 3300009553 | Bacteria | 2881 |
| 221 | Ga0105249_10134884 | 3300009553 | Bacteria | 2361 |
| 222 | Ga0105249_10150578 | 3300009553 | Bacteria | 2240 |
| 223 | Ga0105249_10237101 | 3300009553 | Bacteria | 1802 |
| 224 | Ga0105239_10006113 | 3300010375 | Bacteria | 14019 |
| 225 | Ga0105239_10018215 | 3300010375 | Bacteria | 7763 |
| 226 | Ga0105239_10019814 | 3300010375 | Bacteria | 7424 |
| 227 | Ga0105239_10020900 | 3300010375 | Bacteria | 7222 |
| 228 | Ga0105239_10226136 | 3300010375 | Unclassified | 2099 |
| 229 | Ga0105239_10242934 | 3300010375 | Bacteria | 2021 |
| 230 | Ga0105246_10190773 | 3300011119 | Bacteria | 1586 |
| 231 | Ga0157370_10005991 | 3300013104 | Bacteria | 13531 |
| 232 | Ga0157370_10006307 | 3300013104 | Bacteria | 13104 |
| 233 | Ga0157370_10016399 | 3300013104 | Bacteria | 7499 |
| 234 | Ga0157370_10040560 | 3300013104 | Bacteria | 4495 |
| 235 | Ga0157370_10057435 | 3300013104 | Bacteria | 3700 |
| 236 | Ga0157370_10065457 | 3300013104 | Bacteria | 3439 |
| 237 | Ga0157369_10008782 | 3300013105 | Bacteria | 11578 |
| 238 | Ga0157369_10012845 | 3300013105 | Bacteria | 9495 |
| 239 | Ga0157369_10013263 | 3300013105 | Bacteria | 9324 |
| 240 | Ga0157369_10016965 | 3300013105 | Bacteria | 8182 |
| 241 | Ga0157369_10063670 | 3300013105 | Bacteria | 3973 |
| 242 | Ga0157369_10112426 | 3300013105 | Bacteria | 2893 |
| 243 | Ga0157369_10152686 | 3300013105 | Bacteria | 2441 |
| 244 | Ga0157369_10204804 | 3300013105 | Unclassified | 2070 |
| 245 | Ga0157374_10012136 | 3300013296 | Bacteria | 7484 |
| 246 | Ga0157374_10067061 | 3300013296 | Bacteria | 3373 |
| 247 | Ga0157374_10258466 | 3300013296 | Bacteria | 1715 |
| 248 | Ga0157374_10303284 | 3300013296 | Bacteria | 1580 |
| 249 | Ga0157378_10054675 | 3300013297 | Bacteria | 3554 |
| 250 | Ga0157378_10166445 | 3300013297 | Bacteria | 2065 |
| 251 | Ga0157378_10184073 | 3300013297 | Bacteria | 1966 |
| 252 | Ga0157378_10365856 | 3300013297 | Bacteria | 1412 |
| 253 | Ga0163162_10013500 | 3300013306 | Bacteria | 7974 |
| 254 | Ga0163162_10086353 | 3300013306 | Bacteria | 3215 |
| 255 | Ga0163162_10124049 | 3300013306 | Unclassified | 2688 |
| 256 | Ga0163162_10209761 | 3300013306 | Bacteria | 2077 |
| 257 | Ga0163162_10258956 | 3300013306 | Unclassified | 1871 |
| 258 | Ga0163162_10512574 | 3300013306 | Bacteria | 1329 |
| 259 | Ga0163162_10799954 | 3300013306 | Bacteria | 1060 |
| 260 | Ga0157372_10007318 | 3300013307 | Bacteria | 11750 |
| 261 | Ga0157372_10020322 | 3300013307 | Bacteria | 7162 |
| 262 | Ga0157372_10057171 | 3300013307 | Bacteria | 4360 |
| 263 | Ga0157372_10118462 | 3300013307 | Bacteria | 3038 |
| 264 | Ga0157372_10374825 | 3300013307 | Bacteria | 1658 |
| 265 | Ga0157372_10665210 | 3300013307 | Bacteria | 1213 |
| 266 | Ga0157375_10005690 | 3300013308 | Bacteria | 10846 |
| 267 | Ga0157375_10159781 | 3300013308 | Bacteria | 2395 |
| 268 | Ga0157375_10249317 | 3300013308 | Bacteria | 1936 |
| 269 | Ga0157375_10327530 | 3300013308 | Bacteria | 1697 |
| 270 | Ga0157375_10700022 | 3300013308 | Bacteria | 1167 |
| 271 | Ga0163163_10002598 | 3300014325 | Bacteria | 15306 |
| 272 | Ga0163163_10018126 | 3300014325 | Bacteria | 6581 |
| 273 | Ga0163163_10040514 | 3300014325 | Bacteria | 4549 |
| 274 | Ga0163163_10043155 | 3300014325 | Bacteria | 4420 |
| 275 | Ga0163163_10152034 | 3300014325 | Bacteria | 2358 |
| 276 | Ga0163163_10266364 | 3300014325 | Bacteria | 1765 |
| 277 | Ga0163163_10451920 | 3300014325 | Bacteria | 1345 |
| 278 | Ga0163163_10511951 | 3300014325 | Bacteria | 1262 |
| 279 | Ga0163163_10875955 | 3300014325 | Bacteria | 961 |
| 280 | Ga0182008_10078939 | 3300014497 | Bacteria | 1619 |
| 281 | Ga0182008_10080883 | 3300014497 | Bacteria | 1599 |
| 282 | Ga0157379_10050360 | 3300014968 | Bacteria | 3718 |
| 283 | Ga0157379_10065070 | 3300014968 | Bacteria | 3259 |
| 284 | Ga0157379_10269986 | 3300014968 | Bacteria | 1547 |
| 285 | Ga0157379_10469430 | 3300014968 | Bacteria | 1164 |
| 286 | Ga0157376_10096022 | 3300014969 | Bacteria | 2579 |
| 287 | Ga0157376_10182786 | 3300014969 | Unclassified | 1918 |
| 288 | Ga0157376_10354898 | 3300014969 | Bacteria | 1404 |
| 289 | Ga0157376_10525925 | 3300014969 | Bacteria | 1166 |
| 290 | Ga0182006_1057686 | 3300015261 | Bacteria | 1475 |
| 291 | Ga0213872_10000182 | 3300021361 | Bacteria | 56427 |
| 292 | Ga0213874_10011049 | 3300021377 | Unclassified | 2277 |
| 293 | Ga0213874_10061087 | 3300021377 | Bacteria | 1180 |
| 294 | Ga0213876_10003589 | 3300021384 | Bacteria | 8828 |
| 295 | Ga0213876_10014097 | 3300021384 | Bacteria | 4238 |
| 296 | Ga0213876_10025225 | 3300021384 | Bacteria | 3137 |
| 297 | Ga0213876_10071368 | 3300021384 | Bacteria | 1834 |
| 298 | Ga0213875_10000019 | 3300021388 | Bacteria | 231333 |
| 299 | Ga0213875_10000109 | 3300021388 | Bacteria | 94035 |
| 300 | Ga0213875_10000137 | 3300021388 | Bacteria | 80801 |
| 301 | Ga0213875_10001103 | 3300021388 | Bacteria | 18734 |
| 302 | Ga0213875_10003448 | 3300021388 | Bacteria | 9003 |
| 303 | Ga0213875_10059306 | 3300021388 | Bacteria | 1791 |
| 304 | Ga0213875_10091566 | 3300021388 | Bacteria | 1418 |
| 305 | Ga0213875_10092868 | 3300021388 | Bacteria | 1407 |
| 306 | Ga0209566_100108 | 3300025225 | Bacteria | 119382 |
| 307 | Ga0209675_1030371 | 3300025291 | Bacteria | 1290 |
| 308 | Ga0209025_1004716 | 3300025294 | Bacteria | 11631 |
| 309 | Ga0207656_10029760 | 3300025321 | Bacteria | 2252 |
| 310 | Ga0207710_10000149 | 3300025900 | Bacteria | 79810 |
| 311 | Ga0207710_10002412 | 3300025900 | Bacteria | 8707 |
| 312 | Ga0207680_10044635 | 3300025903 | Bacteria | 2608 |
| 313 | Ga0207647_10206988 | 3300025904 | Bacteria | 1134 |
| 314 | Ga0207705_10047594 | 3300025909 | Bacteria | 3084 |
| 315 | Ga0207705_10067567 | 3300025909 | Bacteria | 2587 |
| 316 | Ga0207684_10071762 | 3300025910 | Bacteria | 2942 |
| 317 | Ga0207684_10127316 | 3300025910 | Bacteria | 2186 |
| 318 | Ga0207684_10220381 | 3300025910 | Bacteria | 1637 |
| 319 | Ga0207654_10078752 | 3300025911 | Bacteria | 1978 |
| 320 | Ga0207707_10000372 | 3300025912 | Bacteria | 47046 |
| 321 | Ga0207707_10007147 | 3300025912 | Bacteria | 9721 |
| 322 | Ga0207707_10007166 | 3300025912 | Bacteria | 9705 |
| 323 | Ga0207707_10057693 | 3300025912 | Bacteria | 3379 |
| 324 | Ga0207707_10060292 | 3300025912 | Bacteria | 3301 |
| 325 | Ga0207707_10248489 | 3300025912 | Bacteria | 1545 |
| 326 | Ga0207707_10292634 | 3300025912 | Unclassified | 1409 |
| 327 | Ga0207695_10000563 | 3300025913 | Bacteria | 76084 |
| 328 | Ga0207695_10001447 | 3300025913 | Bacteria | 39719 |
| 329 | Ga0207695_10008730 | 3300025913 | Bacteria | 12638 |
| 330 | Ga0207695_10016938 | 3300025913 | Bacteria | 8503 |
| 331 | Ga0207695_10035763 | 3300025913 | Bacteria | 5380 |
| 332 | Ga0207695_10220905 | 3300025913 | Bacteria | 1802 |
| 333 | Ga0207695_10305061 | 3300025913 | Bacteria | 1483 |
| 334 | Ga0207671_10000256 | 3300025914 | Bacteria | 79879 |
| 335 | Ga0207660_10023863 | 3300025917 | Unclassified | 4135 |
| 336 | Ga0207660_10052210 | 3300025917 | Bacteria | 2910 |
| 337 | Ga0207660_10087896 | 3300025917 | Bacteria | 2297 |
| 338 | Ga0207660_10390683 | 3300025917 | Bacteria | 1119 |
| 339 | Ga0207657_10008514 | 3300025919 | Bacteria | 10401 |
| 340 | Ga0207657_10022801 | 3300025919 | Bacteria | 5846 |
| 341 | Ga0207657_10141762 | 3300025919 | Bacteria | 1963 |
| 342 | Ga0207652_10008525 | 3300025921 | Bacteria | 8251 |
| 343 | Ga0207652_10009178 | 3300025921 | Bacteria | 7960 |
| 344 | Ga0207652_10078610 | 3300025921 | Bacteria | 2881 |
| 345 | Ga0207652_10111378 | 3300025921 | Bacteria | 2427 |
| 346 | Ga0207652_10447328 | 3300025921 | Bacteria | 1165 |
| 347 | Ga0207646_10000447 | 3300025922 | Bacteria | 55120 |
| 348 | Ga0207694_10002271 | 3300025924 | Bacteria | 15729 |
| 349 | Ga0207694_10003426 | 3300025924 | Bacteria | 12624 |
| 350 | Ga0207694_10009451 | 3300025924 | Bacteria | 7349 |
| 351 | Ga0207694_10051476 | 3300025924 | Bacteria | 3192 |
| 352 | Ga0207694_10096390 | 3300025924 | Bacteria | 2339 |
| 353 | Ga0207694_10151685 | 3300025924 | Bacteria | 1867 |
| 354 | Ga0207694_10192305 | 3300025924 | Bacteria | 1658 |
| 355 | Ga0207659_10149339 | 3300025926 | Bacteria | 1823 |
| 356 | Ga0207687_10023621 | 3300025927 | Bacteria | 4101 |
| 357 | Ga0207687_10025790 | 3300025927 | Bacteria | 3934 |
| 358 | Ga0207687_10174634 | 3300025927 | Bacteria | 1660 |
| 359 | Ga0207687_10355395 | 3300025927 | Bacteria | 1195 |
| 360 | Ga0207700_10108197 | 3300025928 | Bacteria | 2232 |
| 361 | Ga0207700_10123466 | 3300025928 | Bacteria | 2103 |
| 362 | Ga0207644_10013253 | 3300025931 | Bacteria | 5493 |
| 363 | Ga0207709_10060594 | 3300025935 | Bacteria | 2360 |
| 364 | Ga0207704_10162165 | 3300025938 | Bacteria | 1592 |
| 365 | Ga0207691_10093132 | 3300025940 | Bacteria | 2698 |
| 366 | Ga0207711_10000062 | 3300025941 | Bacteria | 125048 |
| 367 | Ga0207711_10003507 | 3300025941 | Bacteria | 13580 |
| 368 | Ga0207711_10048173 | 3300025941 | Bacteria | 3646 |
| 369 | Ga0207711_10274577 | 3300025941 | Bacteria | 1551 |
| 370 | Ga0207711_10466262 | 3300025941 | Bacteria | 1176 |
| 371 | Ga0207689_10025222 | 3300025942 | Bacteria | 4984 |
| 372 | Ga0207689_10197476 | 3300025942 | Bacteria | 1660 |
| 373 | Ga0207661_10028768 | 3300025944 | Bacteria | 4260 |
| 374 | Ga0207661_10031447 | 3300025944 | Bacteria | 4100 |
| 375 | Ga0207661_10131306 | 3300025944 | Bacteria | 2145 |
| 376 | Ga0207661_10309717 | 3300025944 | Bacteria | 1417 |
| 377 | Ga0207661_10543208 | 3300025944 | Bacteria | 1064 |
| 378 | Ga0207667_10001746 | 3300025949 | Bacteria | 27378 |
| 379 | Ga0207667_10015000 | 3300025949 | Bacteria | 8814 |
| 380 | Ga0207667_10021589 | 3300025949 | Bacteria | 7132 |
| 381 | Ga0207667_10039308 | 3300025949 | Bacteria | 5044 |
| 382 | Ga0207667_10050214 | 3300025949 | Bacteria | 4402 |
| 383 | Ga0207667_10140890 | 3300025949 | Bacteria | 2483 |
| 384 | Ga0207712_10106426 | 3300025961 | Bacteria | 2095 |
| 385 | Ga0207668_10030442 | 3300025972 | Bacteria | 3547 |
| 386 | Ga0207668_10118986 | 3300025972 | Bacteria | 1997 |
| 387 | Ga0207677_10003453 | 3300026023 | Bacteria | 8374 |
| 388 | Ga0207677_10162637 | 3300026023 | Bacteria | 1736 |
| 389 | Ga0207703_10010141 | 3300026035 | Bacteria | 7385 |
| 390 | Ga0207703_10012257 | 3300026035 | Bacteria | 6685 |
| 391 | Ga0207703_10026240 | 3300026035 | Unclassified | 4584 |
| 392 | Ga0207703_10033766 | 3300026035 | Unclassified | 4058 |
| 393 | Ga0207703_10045889 | 3300026035 | Bacteria | 3516 |
| 394 | Ga0207703_10054895 | 3300026035 | Bacteria | 3241 |
| 395 | Ga0207703_10080867 | 3300026035 | Bacteria | 2707 |
| 396 | Ga0207639_10035103 | 3300026041 | Bacteria | 3709 |
| 397 | Ga0207678_10274679 | 3300026067 | Unclassified | 1446 |
| 398 | Ga0207708_10190444 | 3300026075 | Bacteria | 1632 |
| 399 | Ga0207702_10003891 | 3300026078 | Bacteria | 13446 |
| 400 | Ga0207702_10045510 | 3300026078 | Bacteria | 3691 |
| 401 | Ga0207702_10067007 | 3300026078 | Unclassified | 3080 |
| 402 | Ga0207702_10153726 | 3300026078 | Bacteria | 2095 |
| 403 | Ga0207641_10298302 | 3300026088 | Bacteria | 1521 |
| 404 | Ga0207676_10015283 | 3300026095 | Bacteria | 5536 |
| 405 | Ga0207676_10018647 | 3300026095 | Bacteria | 5050 |
| 406 | Ga0207676_10120766 | 3300026095 | Bacteria | 2209 |
| 407 | Ga0207674_10000503 | 3300026116 | Bacteria | 51625 |
| 408 | Ga0207674_10002123 | 3300026116 | Bacteria | 25062 |
| 409 | Ga0207674_10006162 | 3300026116 | Bacteria | 14164 |
| 410 | Ga0207675_100352431 | 3300026118 | Bacteria | 1443 |
| 411 | Ga0207683_10240206 | 3300026121 | Bacteria | 1652 |
| 412 | Ga0207683_10461022 | 3300026121 | Unclassified | 1172 |
| 413 | Ga0207698_10013952 | 3300026142 | Bacteria | 5322 |
| 414 | Ga0207698_10015980 | 3300026142 | Bacteria | 5047 |
| 415 | Ga0207698_10618425 | 3300026142 | Bacteria | 1070 |
| 416 | Ga0209974_10016501 | 3300027876 | Bacteria | 2453 |
| 417 | Ga0207428_10002460 | 3300027907 | Bacteria | 18500 |
| 418 | Ga0268266_10003198 | 3300028379 | Bacteria | 16572 |
| 419 | Ga0268266_10204867 | 3300028379 | Unclassified | 1807 |
| 420 | Ga0268266_10228066 | 3300028379 | Bacteria | 1715 |
| 421 | Ga0268266_10422514 | 3300028379 | Bacteria | 1263 |
| 422 | Ga0268265_10000008 | 3300028380 | Bacteria | 417328 |
| 423 | Ga0268264_10008000 | 3300028381 | Bacteria | 8793 |
| 424 | Ga0268264_10025531 | 3300028381 | Unclassified | 4828 |
| 425 | Ga0265338_10001562 | 3300028800 | Bacteria | 36957 |
| 426 | Ga0265338_10056535 | 3300028800 | Bacteria | 3479 |
| 427 | Ga0265338_10241884 | 3300028800 | Bacteria | 1336 |
| 428 | Ga0265330_10004925 | 3300031235 | Bacteria | 6725 |
| 429 | Ga0265330_10007010 | 3300031235 | Bacteria | 5531 |
| 430 | Ga0265330_10022903 | 3300031235 | Bacteria | 2839 |
| 431 | Ga0265330_10038588 | 3300031235 | Bacteria | 2123 |
| 432 | Ga0265325_10041187 | 3300031241 | Bacteria | 2421 |
| 433 | Ga0265329_10030458 | 3300031242 | Bacteria | 1758 |
| 434 | Ga0265339_10000166 | 3300031249 | Bacteria | 55317 |
| 435 | Ga0265339_10021965 | 3300031249 | Bacteria | 3703 |
| 436 | Ga0265331_10007181 | 3300031250 | Bacteria | 6476 |
| 437 | Ga0265316_10001544 | 3300031344 | Bacteria | 24695 |
| 438 | Ga0265316_10004170 | 3300031344 | Bacteria | 14449 |
| 439 | Ga0265316_10013362 | 3300031344 | Bacteria | 7297 |
| 440 | Ga0265316_10116486 | 3300031344 | Bacteria | 2020 |
| 441 | Ga0265316_10174139 | 3300031344 | Bacteria | 1604 |
| 442 | Ga0307408_100015360 | 3300031548 | Bacteria | 5097 |
| 443 | Ga0265313_10003840 | 3300031595 | Bacteria | 11854 |
| 444 | Ga0265313_10008990 | 3300031595 | Bacteria | 6552 |
| 445 | Ga0265314_10237486 | 3300031711 | Bacteria | 1053 |
| 446 | Ga0265342_10004295 | 3300031712 | Bacteria | 11284 |
| 447 | Ga0265342_10055883 | 3300031712 | Bacteria | 2342 |
| 448 | Ga0316576_10010783 | 3300031727 | Bacteria | 5953 |
| 449 | Ga0307410_10243692 | 3300031852 | Bacteria | 1394 |
| 450 | Ga0307406_10104875 | 3300031901 | Bacteria | 1933 |
| 451 | Ga0307406_10173181 | 3300031901 | Bacteria | 1564 |
| 452 | Ga0307409_100013621 | 3300031995 | Bacteria | 5246 |
| 453 | Ga0307411_10023799 | 3300032005 | Bacteria | 3637 |
| 454 | Ga0307411_10188687 | 3300032005 | Bacteria | 1572 |
| 455 | Ga0307415_100139531 | 3300032126 | Bacteria | 1849 |
| 456 | Ga0373929_0000001 | 3300035085 | Bacteria | 956023 |
| 457 | Ga0373934_0013316 | 3300035086 | Bacteria | 3108 |
| 458 | Ga0373936_0021787 | 3300035113 | Bacteria | 2493 |
| 459 | Ga0373954_0099487 | 3300035118 | Bacteria | 1402 |
| 460 | Ga0373954_0136727 | 3300035118 | Bacteria | 1194 |
| 461 | Ga0373956_0007033 | 3300035119 | Bacteria | 4525 |
| 462 | Ga0373957_0030295 | 3300035120 | Bacteria | 1982 |
| 463 | Ga0373957_0096527 | 3300035120 | Bacteria | 1180 |
| 464 | Ga0373943_0021984 | 3300035170 | Bacteria | 2950 |
| 465 | Ga0373943_0304227 | 3300035170 | Unclassified | 906 |
| 466 | Ga0373946_0061604 | 3300035171 | Bacteria | 1598 |
| 467 | Ga0373955_0043801 | 3300035172 | Bacteria | 2408 |
| 468 | Ga0373955_0132194 | 3300035172 | Bacteria | 1457 |
| 469 | Ga0316574_0007195 | 3300035398 | Bacteria | 6082 |
| 470 | Ga0373935_0200642 | 3300035692 | Bacteria | 1378 |
| 471 | Ga0373935_0239424 | 3300035692 | Unclassified | 1266 |
| 472 | Ga0373927_0001504 | 3300035695 | Bacteria | 17541 |
| 473 | Ga0373927_0006461 | 3300035695 | Bacteria | 7985 |
| 474 | Ga0373927_0007949 | 3300035695 | Bacteria | 7161 |
| 475 | Ga0373933_0009825 | 3300035724 | Bacteria | 5237 |
| 476 | Ga0373947_0000236 | 3300035725 | Bacteria | 31165 |
| 477 | Ga0373947_0104728 | 3300035725 | Unclassified | 1782 |
| 478 | Ga0373947_0153208 | 3300035725 | Bacteria | 1486 |
| 479 | Ga0373947_0185495 | 3300035725 | Bacteria | 1356 |
| 480 | Ga0373937_0007488 | 3300036401 | Bacteria | 9448 |
| 481 | Ga0373937_0029905 | 3300036401 | Unclassified | 4934 |
| 482 | Ga0373937_0052871 | 3300036401 | Bacteria | 3726 |
| 483 | Ga0373937_0063437 | 3300036401 | Bacteria | 3398 |
| 484 | Ga0373937_0127978 | 3300036401 | Bacteria | 2370 |
| 485 | Ga0373937_0323476 | 3300036401 | Bacteria | 1459 |
| 486 | Ga0373937_0381349 | 3300036401 | Bacteria | 1337 |
| 487 | Ga0373925_0000139 | 3300037068 | Bacteria | 77722 |
| 488 | Ga0373925_0025741 | 3300037068 | Bacteria | 4302 |
| 489 | Ga0373925_0094477 | 3300037068 | Bacteria | 2290 |
| 490 | Ga0373925_0112771 | 3300037068 | Bacteria | 2102 |
| 491 | Ga0373925_0654404 | 3300037068 | Bacteria | 866 |
| 492 | Ga0395900_0334769 | 3300037418 | Unclassified | 1491 |
| 493 | Ga0436364_0082088 | 3300037853 | Bacteria | 178031 |
| 494 | Ga0436364_0096221 | 3300037853 | Bacteria | 10527 |
| 495 | Ga0436364_0197022 | 3300037853 | Bacteria | 80312 |
| 496 | Ga0436364_0199614 | 3300037853 | Unclassified | 2306 |
| 497 | Ga0436364_0313932 | 3300037853 | Bacteria | 7755 |
| 498 | Ga0436364_0366372 | 3300037853 | Bacteria | 231753 |
| 499 | Ga0436364_0452996 | 3300037853 | Bacteria | 6077 |
| 500 | Ga0436364_0472599 | 3300037853 | Bacteria | 2421 |
| 501 | Ga0436364_1023107 | 3300037853 | Bacteria | 4470 |
| 502 | Ga0436364_1046789 | 3300037853 | Bacteria | 1565 |
| 503 | Ga0436364_1239453 | 3300037853 | Bacteria | 9049 |
| 504 | Ga0436364_1247308 | 3300037853 | Unclassified | 2502 |
| 505 | Ga0436364_1265083 | 3300037853 | Bacteria | 3197 |
| 506 | Ga0436364_1326320 | 3300037853 | Bacteria | 13298 |
| 507 | Ga0400483_130213 | 3300039062 | Bacteria | 38867 |
| 508 | Ga0400483_164907 | 3300039062 | Bacteria | 38857 |
| 509 | Ga0436365_0500041 | 3300039437 | Bacteria | 2754 |
| 510 | Ga0436365_0586387 | 3300039437 | Bacteria | 1803 |
| 511 | Ga0436365_1155152 | 3300039437 | Bacteria | 27379 |
| 512 | Ga0436365_1532991 | 3300039437 | Unclassified | 1409 |
| 513 | Ga0436365_1557740 | 3300039437 | Bacteria | 2674 |
| 514 | Ga0436365_1806953 | 3300039437 | Bacteria | 11991 |
| 515 | Ga0436365_1870226 | 3300039437 | Unclassified | 2652 |
| 516 | Ga0436360_0212151 | 3300039438 | Bacteria | 1614 |
| 517 | Ga0436361_0126076 | 3300039447 | Bacteria | 97470 |
| 518 | Ga0436363_0052707 | 3300039450 | Bacteria | 4459 |
| 519 | Ga0436363_0305072 | 3300039450 | Bacteria | 3553 |
| 520 | Ga0436363_0647531 | 3300039450 | Bacteria | 1759 |
| 521 | Ga0436363_1068053 | 3300039450 | Unclassified | 1723 |
| 522 | Ga0436362_0471056 | 3300039453 | Bacteria | 3856 |
| 523 | Ga0436362_0556739 | 3300039453 | Bacteria | 2633 |
| 524 | Ga0436362_0890112 | 3300039453 | Bacteria | 1315 |
| 525 | Ga0436362_0963183 | 3300039453 | Unclassified | 2394 |
| 526 | Ga0439439_0000364 | 3300041406 | Bacteria | 7408 |
| 527 | Ga0439433_0041527 | 3300041999 | Bacteria | 1071 |
| 528 | Ga0439449_0000684 | 3300042007 | Bacteria | 12908 |
| 529 | Ga0439462_0001458 | 3300042015 | Bacteria | 5275 |
| 530 | Ga0450923_021441 | 3300042125 | Bacteria | 1260 |
| 531 | Ga0451577_0553201 | 3300042876 | Unclassified | 1045 |
| 532 | Ga0466961_0050872 | 3300044693 | Bacteria | 2646 |
| 533 | Ga0466963_0003571 | 3300044694 | Bacteria | 8933 |
| 534 | Ga0453684_0037846 | 3300044712 | Bacteria | 6614 |
| 535 | Ga0453684_0061499 | 3300044712 | Bacteria | 4820 |
| 536 | Ga0451576_0000417 | 3300045051 | Bacteria | 98902 |
| 537 | Ga0451576_0140758 | 3300045051 | Bacteria | 2516 |
| 538 | Ga0451576_0224788 | 3300045051 | Bacteria | 1960 |
| 539 | Ga0451576_0659283 | 3300045051 | Bacteria | 1100 |
| 540 | Ga0466967_0018179 | 3300045976 | Bacteria | 5610 |
| 541 | Ga0495592_0041600 | 3300046454 | Bacteria | 3444 |
| 542 | Ga0495592_0149165 | 3300046454 | Bacteria | 1619 |
| 543 | Ga0495651_0059928 | 3300046462 | Bacteria | 2917 |
| 544 | Ga0495651_0118703 | 3300046462 | Bacteria | 1946 |
| 545 | Ga0495580_0004196 | 3300046472 | Bacteria | 12119 |
| 546 | Ga0495580_0015979 | 3300046472 | Bacteria | 5646 |
| 547 | Ga0495580_0026187 | 3300046472 | Bacteria | 4255 |
| 548 | Ga0495580_0029946 | 3300046472 | Bacteria | 3946 |
| 549 | Ga0495580_0048971 | 3300046472 | Bacteria | 2990 |
| 550 | Ga0495580_0080968 | 3300046472 | Bacteria | 2263 |
| 551 | Ga0495580_0114366 | 3300046472 | Bacteria | 1874 |
| 552 | Ga0495580_0139981 | 3300046472 | Bacteria | 1677 |
| 553 | Ga0495582_0076753 | 3300046473 | Bacteria | 1852 |
| 554 | Ga0495582_0083217 | 3300046473 | Bacteria | 1778 |
| 555 | Ga0495639_0064283 | 3300046475 | Bacteria | 1686 |
| 556 | Ga0495664_0074207 | 3300046477 | Bacteria | 2035 |
| 557 | Ga0495594_0017572 | 3300046499 | Bacteria | 3781 |
| 558 | Ga0495628_0118358 | 3300046516 | Unclassified | 2034 |
| 559 | Ga0495628_0529843 | 3300046516 | Bacteria | 848 |
| 560 | Ga0495648_0199001 | 3300046524 | Bacteria | 1004 |
| 561 | Ga0495652_0105876 | 3300046529 | Bacteria | 2272 |
| 562 | Ga0495652_0129100 | 3300046529 | Bacteria | 2004 |
| 563 | Ga0495665_0091083 | 3300046531 | Bacteria | 1602 |
| 564 | Ga0495586_0096141 | 3300046535 | Bacteria | 1640 |
| 565 | Ga0495586_0148444 | 3300046535 | Bacteria | 1318 |
| 566 | Ga0495668_0000277 | 3300046616 | Bacteria | 71164 |
| 567 | Ga0495634_0017369 | 3300046642 | Bacteria | 5135 |
| 568 | Ga0495661_0072108 | 3300046665 | Bacteria | 2016 |
| 569 | Ga0495623_0161155 | 3300046679 | Unclassified | 1318 |
| 570 | Ga0495658_0399063 | 3300046683 | Archaea | 877 |
| 571 | Ga0495624_0169747 | 3300046690 | Unclassified | 1331 |
| 572 | Ga0495680_0107329 | 3300047322 | Bacteria | 2074 |
| 573 | Ga0495675_0242017 | 3300047444 | Bacteria | 1086 |
| 574 | Ga0495684_0223931 | 3300047471 | Unclassified | 1378 |
| 575 | Ga0495602_0182331 | 3300048088 | Bacteria | 1618 |
| 576 | Ga0495626_0015994 | 3300048091 | Bacteria | 3824 |
| 577 | Ga0496102_0361519 | 3300048905 | Bacteria | 1367 |
| 578 | Ga0496102_0376505 | 3300048905 | Bacteria | 1336 |
| 579 | Ga0496104_0068796 | 3300048907 | Bacteria | 3364 |
| 580 | Ga0496105_0011415 | 3300048908 | Bacteria | 7017 |
| 581 | Ga0496105_0168540 | 3300048908 | Bacteria | 1796 |
| 582 | Ga0496107_0195116 | 3300048910 | Bacteria | 1505 |
| 583 | Ga0496108_0028771 | 3300048911 | Bacteria | 4597 |
| 584 | Ga0496108_0186754 | 3300048911 | Bacteria | 1796 |
| 585 | Ga0496109_0000016 | 3300048912 | Bacteria | 212455 |
| 586 | Ga0496109_0011620 | 3300048912 | Bacteria | 7571 |
| 587 | Ga0496109_0018772 | 3300048912 | Bacteria | 6082 |
| 588 | Ga0496109_0022922 | 3300048912 | Bacteria | 5535 |
| 589 | Ga0496109_0105115 | 3300048912 | Bacteria | 2622 |
| 590 | Ga0496109_0121729 | 3300048912 | Bacteria | 2431 |
| 591 | Ga0496109_0134749 | 3300048912 | Bacteria | 2307 |
| 592 | Ga0496109_0582679 | 3300048912 | Bacteria | 1054 |
| 593 | Ga0496110_0033002 | 3300048913 | Bacteria | 4475 |
| 594 | Ga0496111_0037135 | 3300048914 | Bacteria | 3486 |
| 595 | Ga0496111_0120134 | 3300048914 | Bacteria | 1941 |
| 596 | Ga0496112_0100369 | 3300048915 | Bacteria | 2864 |
| 597 | Ga0496112_0396347 | 3300048915 | Bacteria | 1320 |
| 598 | Ga0496113_0301789 | 3300048916 | Bacteria | 1282 |
| 599 | Ga0496115_0062817 | 3300048918 | Bacteria | 2997 |
| 600 | Ga0496115_0083150 | 3300048918 | Bacteria | 2609 |
| 601 | Ga0496116_0000687 | 3300048919 | Bacteria | 43932 |
| 602 | Ga0496116_0003007 | 3300048919 | Bacteria | 17088 |
| 603 | Ga0496116_0018895 | 3300048919 | Bacteria | 5292 |
| 604 | Ga0496116_0043105 | 3300048919 | Bacteria | 3077 |
| 605 | Ga0496117_0000161 | 3300048920 | Bacteria | 141379 |
| 606 | Ga0496117_0034956 | 3300048920 | Bacteria | 3780 |
| 607 | Ga0496118_0007983 | 3300048921 | Bacteria | 11063 |
| 608 | Ga0496118_0035679 | 3300048921 | Bacteria | 4034 |
| 609 | Ga0496118_0064168 | 3300048921 | Bacteria | 2697 |
| 610 | Ga0496118_0126232 | 3300048921 | Bacteria | 1655 |
| 611 | Ga0496119_0000042 | 3300048922 | Bacteria | 200701 |
| 612 | Ga0496119_0024040 | 3300048922 | Bacteria | 4300 |
| 613 | Ga0496119_0169212 | 3300048922 | Bacteria | 1155 |
| 614 | Ga0496120_0000083 | 3300048923 | Bacteria | 157876 |
| 615 | Ga0496120_0000283 | 3300048923 | Bacteria | 85428 |
| 616 | Ga0496120_0002496 | 3300048923 | Bacteria | 18464 |
| 617 | Ga0496120_0005499 | 3300048923 | Bacteria | 10087 |
| 618 | Ga0496121_0048366 | 3300048924 | Bacteria | 3618 |
| 619 | Ga0496121_0089174 | 3300048924 | Bacteria | 2415 |
| 620 | Ga0496121_0169988 | 3300048924 | Bacteria | 1585 |
| 621 | Ga0496122_0000012 | 3300048925 | Bacteria | 526837 |
| 622 | Ga0496122_0009285 | 3300048925 | Bacteria | 10399 |
| 623 | Ga0496122_0025502 | 3300048925 | Bacteria | 5131 |
| 624 | Ga0496123_0001574 | 3300048926 | Bacteria | 31186 |
| 625 | Ga0496123_0005728 | 3300048926 | Bacteria | 12374 |
| 626 | Ga0496123_0011656 | 3300048926 | Bacteria | 7588 |
| 627 | Ga0496125_0000010 | 3300048928 | Bacteria | 671167 |
| 628 | Ga0496125_0000431 | 3300048928 | Bacteria | 77252 |
| 629 | Ga0496125_0001417 | 3300048928 | Bacteria | 35011 |
| 630 | Ga0496126_0000008 | 3300048929 | Bacteria | 781752 |
| 631 | Ga0496126_0000461 | 3300048929 | Bacteria | 80907 |
| 632 | Ga0496126_0017417 | 3300048929 | Bacteria | 7158 |
| 633 | Ga0501031_0027847 | 3300049568 | Bacteria | 3683 |
| 634 | Ga0501032_0015200 | 3300049569 | Bacteria | 5434 |
| 635 | Ga0501038_0003585 | 3300049574 | Bacteria | 14445 |
| 636 | Ga0501039_0042482 | 3300049575 | Bacteria | 3513 |
| 637 | Ga0501041_0156690 | 3300049577 | Bacteria | 1423 |
| 638 | Ga0501046_0390600 | 3300049580 | Bacteria | 1006 |
| 639 | Ga0501047_0001292 | 3300049581 | Bacteria | 24708 |
| 640 | Ga0501047_0221804 | 3300049581 | Bacteria | 1747 |
| 641 | Ga0501067_0040970 | 3300049583 | Bacteria | 2572 |
| 642 | Ga0501068_0000108 | 3300049584 | Bacteria | 35756 |
| 643 | Ga0501069_0001287 | 3300049585 | Bacteria | 12294 |
| 644 | Ga0501070_0350958 | 3300049586 | Bacteria | 1197 |
| 645 | Ga0501072_0000002 | 3300049588 | Bacteria | 319523 |
| 646 | Ga0501073_0004186 | 3300049589 | Bacteria | 10819 |
| 647 | Ga0501074_0002365 | 3300049590 | Bacteria | 13131 |
| 648 | Ga0501074_0410645 | 3300049590 | Bacteria | 960 |
| 649 | Ga0501075_0170278 | 3300049591 | Bacteria | 1662 |
| 650 | Ga0501076_0003889 | 3300049592 | Bacteria | 10524 |
| 651 | Ga0501077_0148822 | 3300049593 | Bacteria | 1485 |
| 652 | Ga0501079_0207833 | 3300049741 | Bacteria | 1529 |
| 653 | Ga0501080_0092520 | 3300049742 | Bacteria | 2808 |
| 654 | Ga0501083_0001967 | 3300049744 | Bacteria | 14120 |
| 655 | Ga0501044_0017299 | 3300049823 | Bacteria | 7732 |
| 656 | nmdc:mga05p37_454675_c1 | 3300050507 | Bacteria | 1481 |
| 657 | nmdc:mga0qj67_92397_c1 | 3300050509 | Bacteria | 2433 |
| 658 | nmdc:mga06r32_66914_c1 | 3300050510 | Bacteria | 3468 |
| 659 | nmdc:mga06r32_722291_c1 | 3300050510 | Bacteria | 961 |
| 660 | nmdc:mga08y16_13302_c1 | 3300050511 | Bacteria | 8655 |
| 661 | nmdc:mga08y16_286600_c1 | 3300050511 | Bacteria | 1698 |
| 662 | nmdc:mga0n895_514_c1 | 3300050512 | Bacteria | 26317 |
| 663 | nmdc:mga0rr50_287013_c1 | 3300050513 | Bacteria | 1374 |
| 664 | nmdc:mga0rr50_8099_c1 | 3300050513 | Bacteria | 6523 |
| 665 | nmdc:mga08x19_12901_c1 | 3300050514 | Bacteria | 5042 |
| 666 | nmdc:mga08x19_827_c2 | 3300050514 | Bacteria | 15119 |
| 667 | Ga0495601_0122703 | 3300053077 | Bacteria | 1688 |
| 668 | Ga0495612_0019411 | 3300053078 | Bacteria | 2722 |
| 669 | Ga0501084_0000054 | 3300054114 | Bacteria | 90236 |
| 670 | Ga0501084_0087935 | 3300054114 | Bacteria | 2609 |
| 671 | Ga0501084_0340003 | 3300054114 | Bacteria | 1268 |
| 672 | Ga0590071_003190 | 3300059421 | Bacteria | 4047 |
| 673 | Ga0590075_011613 | 3300059424 | Bacteria | 2131 |
| 674 | Ga0590077_000882 | 3300059426 | Bacteria | 7687 |
| 675 | Ga0590077_012694 | 3300059426 | Bacteria | 1748 |
| 676 | Ga0501082_0016842 | 3300060353 | Bacteria | 6293 |
| 677 | Ga0530510_0080386 | 3300061734 | Bacteria | 2372 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049577 | Ga0501041_0156690 | Ga0501041_0156690_115_948 | 241 |
| 2 | 3300046516 | Ga0495628_0529843 | Ga0495628_0529843_23_799 | 244 |
| 3 | 3300049590 | Ga0501074_0410645 | Ga0501074_0410645_165_929 | 244 |
| 4 | 3300025941 | Ga0207711_10000062 | Ga0207711_1000006248 | 252 |
| 5 | 3300009101 | Ga0105247_10000125 | Ga0105247_1000012519 | 253 |
| 6 | 3300009177 | Ga0105248_10003078 | Ga0105248_1000307816 | 253 |
| 7 | 3300014325 | Ga0163163_10043155 | Ga0163163_100431554 | 253 |
| 8 | 3300048922 | Ga0496119_0024040 | Ga0496119_0024040_3402_4208 | 253 |
| 9 | 3300048923 | Ga0496120_0000283 | Ga0496120_0000283_28532_29338 | 253 |
| 10 | 3300048924 | Ga0496121_0169988 | Ga0496121_0169988_730_1536 | 253 |
| 11 | 3300009147 | Ga0114129_10299524 | Ga0114129_102995243 | 255 |
| 12 | 3300005617 | Ga0068859_100000054 | Ga0068859_10000005431 | 260 |
| 13 | 3300005844 | Ga0068862_100000037 | Ga0068862_100000037146 | 260 |
| 14 | 3300006931 | Ga0097620_100000054 | Ga0097620_10000005431 | 260 |
| 15 | 3300009177 | Ga0105248_10000018 | Ga0105248_1000001869 | 260 |
| 16 | 3300028380 | Ga0268265_10000008 | Ga0268265_10000008191 | 260 |
| 17 | 3300048920 | Ga0496117_0034956 | Ga0496117_0034956_251_1087 | 260 |
| 18 | 3300048921 | Ga0496118_0064168 | Ga0496118_0064168_878_1714 | 260 |
| 19 | 3300025900 | Ga0207710_10000149 | Ga0207710_1000014952 | 261 |
| 20 | 3300025941 | Ga0207711_10048173 | Ga0207711_100481733 | 261 |
| 21 | 3300048912 | Ga0496109_0105115 | Ga0496109_0105115_807_1646 | 261 |
| 22 | 3300048926 | Ga0496123_0011656 | Ga0496123_0011656_1689_2603 | 261 |
| 23 | 3300048928 | Ga0496125_0001417 | Ga0496125_0001417_20365_21279 | 261 |
| 24 | 3300035118 | Ga0373954_0136727 | Ga0373954_0136727_320_1144 | 263 |
| 25 | 3300046472 | Ga0495580_0114366 | Ga0495580_0114366_44_844 | 263 |
| 26 | 3300047444 | Ga0495675_0242017 | Ga0495675_0242017_231_1055 | 263 |
| 27 | 3300037068 | Ga0373925_0654404 | Ga0373925_0654404_36_854 | 265 |
| 28 | iso_pu_bacteria | 2675902999 | 2676198933 | 265 |
| 29 | iso_pu_bacteria | 2773857921 | 2774843511 | 265 |
| 30 | 3300046683 | Ga0495658_0399063 | Ga0495658_0399063_14_835 | 266 |
| 31 | 3300009553 | Ga0105249_10150578 | Ga0105249_101505782 | 268 |
| 32 | 3300021384 | Ga0213876_10014097 | Ga0213876_100140973 | 269 |
| 33 | iso_pu_bacteria | 2506783011 | 2506866930 | 270 |
| 34 | iso_pu_bacteria | 2684623035 | 2686537516 | 270 |
| 35 | iso_pu_bacteria | 2687453743 | 2689991307 | 270 |
| 36 | iso_pu_bacteria | 2895880812 | 2895890913 | 270 |
| 37 | iso_pu_bacteria | 2527291627 | 2528203559 | 271 |
| 38 | iso_pu_bacteria | 2527291629 | 2528214317 | 271 |
| 39 | iso_pu_bacteria | 2546825537 | 2546948322 | 271 |
| 40 | iso_pu_bacteria | 2576861822 | 2579749639 | 271 |
| 41 | iso_pu_bacteria | 2579778521 | 2579858163 | 271 |
| 42 | iso_pu_bacteria | 2619618881 | 2619859104 | 271 |
| 43 | iso_pu_bacteria | 2619619003 | 2620354158 | 271 |
| 44 | iso_pu_bacteria | 2626541554 | 2626639121 | 271 |
| 45 | iso_pu_bacteria | 2684623036 | 2686544800 | 271 |
| 46 | iso_pu_bacteria | 2710264753 | 2710601910 | 271 |
| 47 | iso_pu_bacteria | 2773857924 | 2774863645 | 271 |
| 48 | iso_pu_bacteria | 637000116 | 637878829 | 271 |
| 49 | iso_pu_bacteria | 8054913762 | 8054915258 | 271 |
| 50 | iso_pu_bacteria | 8054920844 | 8054922172 | 271 |
| 51 | iso_pu_bacteria | 2517572101 | 2517764687 | 272 |
| 52 | iso_pu_bacteria | 8002775197 | 8002779324 | 272 |
| 53 | iso_pu_bacteria | 8002784119 | 8002784165 | 272 |
| 54 | 3300059421 | Ga0590071_003190 | Ga0590071_003190_1674_2525 | 273 |
| 55 | 3300059424 | Ga0590075_011613 | Ga0590075_011613_1048_1899 | 273 |
| 56 | 3300059426 | Ga0590077_000882 | Ga0590077_000882_875_1726 | 273 |
| 57 | iso_pu_bacteria | 2508501039 | 2508674004 | 273 |
| 58 | iso_pu_bacteria | 2687453737 | 2689962385 | 273 |
| 59 | 3300045051 | Ga0451576_0224788 | Ga0451576_0224788_954_1790 | 274 |
| 60 | 3300048918 | Ga0496115_0083150 | Ga0496115_0083150_1136_1987 | 274 |
| 61 | 3300050510 | nmdc:mga06r32_722291_c1 | nmdc:mga06r32_722291_c1_91_927 | 275 |
| 62 | 3300005617 | Ga0068859_100001223 | Ga0068859_1000012236 | 276 |
| 63 | 3300005842 | Ga0068858_100072117 | Ga0068858_1000721172 | 276 |
| 64 | 3300005937 | Ga0081455_10007431 | Ga0081455_1000743112 | 276 |
| 65 | 3300006931 | Ga0097620_100001223 | Ga0097620_10000122316 | 276 |
| 66 | 3300009094 | Ga0111539_10340307 | Ga0111539_103403072 | 276 |
| 67 | 3300014968 | Ga0157379_10269986 | Ga0157379_102699862 | 276 |
| 68 | 3300026035 | Ga0207703_10054895 | Ga0207703_100548953 | 276 |
| 69 | 3300046524 | Ga0495648_0199001 | Ga0495648_0199001_160_993 | 276 |
| 70 | 3300048919 | Ga0496116_0000687 | Ga0496116_0000687_3899_4738 | 276 |
| 71 | 3300048920 | Ga0496117_0000161 | Ga0496117_0000161_40346_41185 | 276 |
| 72 | 3300048921 | Ga0496118_0035679 | Ga0496118_0035679_1214_2053 | 276 |
| 73 | 3300048921 | Ga0496118_0126232 | Ga0496118_0126232_786_1619 | 276 |
| 74 | 3300048922 | Ga0496119_0000042 | Ga0496119_0000042_76004_76843 | 276 |
| 75 | 3300048923 | Ga0496120_0000083 | Ga0496120_0000083_80073_80912 | 276 |
| 76 | 3300048923 | Ga0496120_0005499 | Ga0496120_0005499_57_896 | 276 |
| 77 | 3300048925 | Ga0496122_0025502 | Ga0496122_0025502_1692_2531 | 276 |
| 78 | 3300048926 | Ga0496123_0001574 | Ga0496123_0001574_3401_4240 | 276 |
| 79 | 3300048928 | Ga0496125_0000010 | Ga0496125_0000010_559601_560440 | 276 |
| 80 | 3300048929 | Ga0496126_0000461 | Ga0496126_0000461_33742_34581 | 276 |
| 81 | 3300050511 | nmdc:mga08y16_286600_c1 | nmdc:mga08y16_286600_c1_313_1161 | 276 |
| 82 | iso_pu_bacteria | 2919414237 | 2919414511 | 276 |
| 83 | 3300006844 | Ga0075428_100005577 | Ga0075428_1000055774 | 277 |
| 84 | 3300025913 | Ga0207695_10001447 | Ga0207695_1000144727 | 277 |
| 85 | 3300039062 | Ga0400483_130213 | Ga0400483_130213_12158_13018 | 277 |
| 86 | 3300039062 | Ga0400483_164907 | Ga0400483_164907_16229_17089 | 277 |
| 87 | 3300044712 | Ga0453684_0037846 | Ga0453684_0037846_1237_2112 | 277 |
| 88 | 3300044712 | Ga0453684_0061499 | Ga0453684_0061499_2677_3522 | 277 |
| 89 | 3300045051 | Ga0451576_0140758 | Ga0451576_0140758_818_1756 | 277 |
| 90 | 3300048912 | Ga0496109_0121729 | Ga0496109_0121729_895_1755 | 277 |
| 91 | 3300048915 | Ga0496112_0396347 | Ga0496112_0396347_207_1067 | 277 |
| 92 | 3300048916 | Ga0496113_0301789 | Ga0496113_0301789_394_1254 | 277 |
| 93 | 3300048919 | Ga0496116_0018895 | Ga0496116_0018895_122_976 | 277 |
| 94 | 3300048919 | Ga0496116_0043105 | Ga0496116_0043105_2195_3049 | 277 |
| 95 | 3300048923 | Ga0496120_0002496 | Ga0496120_0002496_15695_16549 | 277 |
| 96 | 3300048925 | Ga0496122_0000012 | Ga0496122_0000012_191702_192553 | 277 |
| 97 | 3300048926 | Ga0496123_0005728 | Ga0496123_0005728_4982_5833 | 277 |
| 98 | 3300048928 | Ga0496125_0000431 | Ga0496125_0000431_32875_33729 | 277 |
| 99 | 3300048929 | Ga0496126_0000008 | Ga0496126_0000008_191697_192548 | 277 |
| 100 | 3300048929 | Ga0496126_0017417 | Ga0496126_0017417_820_1674 | 277 |
| 101 | 3300049568 | Ga0501031_0027847 | Ga0501031_0027847_161_1021 | 277 |
| 102 | 3300049741 | Ga0501079_0207833 | Ga0501079_0207833_351_1208 | 277 |
| 103 | 3300054114 | Ga0501084_0340003 | Ga0501084_0340003_85_942 | 277 |
| 104 | iso_pu_bacteria | 2721755693 | 2723602272 | 277 |
| 105 | iso_pu_bacteria | 2728369359 | 2730138407 | 277 |
| 106 | iso_pu_bacteria | 2744054657 | 2745166234 | 277 |
| 107 | iso_pu_bacteria | 2751185905 | 2753809140 | 277 |
| 108 | iso_pu_bacteria | 2802428803 | 2802439498 | 277 |
| 109 | iso_pu_bacteria | 2816332336 | 2817618061 | 277 |
| 110 | iso_pu_bacteria | 2889276214 | 2889278356 | 277 |
| 111 | iso_pu_bacteria | 2904595352 | 2904600143 | 277 |
| 112 | iso_pu_bacteria | 2925326138 | 2925328343 | 277 |
| 113 | iso_pu_bacteria | 2939702853 | 2939706290 | 277 |
| 114 | iso_pu_bacteria | 2996706504 | 2996709459 | 277 |
| 115 | iso_pu_bacteria | 3006969106 | 3006973210 | 277 |
| 116 | iso_pu_bacteria | 648028048 | 648168812 | 277 |
| 117 | 3300005327 | Ga0070658_10169684 | Ga0070658_101696843 | 278 |
| 118 | 3300013306 | Ga0163162_10512574 | Ga0163162_105125741 | 278 |
| 119 | 3300021384 | Ga0213876_10025225 | Ga0213876_100252252 | 278 |
| 120 | 3300039437 | Ga0436365_1806953 | Ga0436365_1806953_9195_10037 | 278 |
| 121 | 3300045051 | Ga0451576_0659283 | Ga0451576_0659283_17_883 | 278 |
| 122 | 3300048919 | Ga0496116_0003007 | Ga0496116_0003007_13531_14439 | 278 |
| 123 | iso_pu_bacteria | 2524023129 | 2524190811 | 278 |
| 124 | iso_pu_bacteria | 2904113452 | 2904118188 | 278 |
| 125 | iso_pu_bacteria | 8057473075 | 8057477220 | 278 |
| 126 | iso_pu_bacteria | 8057977335 | 8057978998 | 278 |
| 127 | 3300005336 | Ga0070680_100038161 | Ga0070680_1000381612 | 279 |
| 128 | 3300005458 | Ga0070681_10005377 | Ga0070681_100053777 | 279 |
| 129 | 3300005530 | Ga0070679_100005804 | Ga0070679_1000058045 | 279 |
| 130 | 3300025912 | Ga0207707_10007166 | Ga0207707_100071665 | 279 |
| 131 | 3300025917 | Ga0207660_10023863 | Ga0207660_100238634 | 279 |
| 132 | 3300025921 | Ga0207652_10009178 | Ga0207652_100091785 | 279 |
| 133 | 3300039437 | Ga0436365_1532991 | Ga0436365_1532991_140_997 | 279 |
| 134 | 3300039437 | Ga0436365_1557740 | Ga0436365_1557740_1483_2331 | 279 |
| 135 | 3300039453 | Ga0436362_0890112 | Ga0436362_0890112_241_1098 | 279 |
| 136 | 3300005289 | Ga0065704_10093027 | Ga0065704_100930272 | 280 |
| 137 | 3300005617 | Ga0068859_100058013 | Ga0068859_1000580131 | 280 |
| 138 | 3300006871 | Ga0075434_100319193 | Ga0075434_1003191932 | 280 |
| 139 | 3300006931 | Ga0097620_100058013 | Ga0097620_1000580134 | 280 |
| 140 | 3300042876 | Ga0451577_0553201 | Ga0451577_0553201_141_992 | 280 |
| 141 | 3300003203 | JGI25406J46586_10031864 | JGI25406J46586_100318641 | 281 |
| 142 | 3300003841 | Ga0055541_1006232 | Ga0055541_10062322 | 281 |
| 143 | 3300005985 | Ga0081539_10001047 | Ga0081539_100010472 | 281 |
| 144 | 3300009094 | Ga0111539_10263308 | Ga0111539_102633082 | 281 |
| 145 | 3300025291 | Ga0209675_1030371 | Ga0209675_10303711 | 281 |
| 146 | 3300025294 | Ga0209025_1004716 | Ga0209025_100471612 | 281 |
| 147 | 3300026075 | Ga0207708_10190444 | Ga0207708_101904442 | 281 |
| 148 | 3300027876 | Ga0209974_10016501 | Ga0209974_100165012 | 281 |
| 149 | 3300031727 | Ga0316576_10010783 | Ga0316576_100107835 | 281 |
| 150 | 3300035398 | Ga0316574_0007195 | Ga0316574_0007195_968_1816 | 281 |
| 151 | 3300048921 | Ga0496118_0007983 | Ga0496118_0007983_8803_9669 | 281 |
| 152 | 3300048922 | Ga0496119_0169212 | Ga0496119_0169212_119_985 | 281 |
| 153 | 3300048924 | Ga0496121_0048366 | Ga0496121_0048366_2562_3428 | 281 |
| 154 | 3300048924 | Ga0496121_0089174 | Ga0496121_0089174_193_1059 | 281 |
| 155 | 3300048925 | Ga0496122_0009285 | Ga0496122_0009285_738_1604 | 281 |
| 156 | 3300049569 | Ga0501032_0015200 | Ga0501032_0015200_1797_2645 | 281 |
| 157 | 3300049574 | Ga0501038_0003585 | Ga0501038_0003585_10842_11690 | 281 |
| 158 | 3300049575 | Ga0501039_0042482 | Ga0501039_0042482_690_1538 | 281 |
| 159 | 3300049581 | Ga0501047_0001292 | Ga0501047_0001292_20914_21762 | 281 |
| 160 | 3300049584 | Ga0501068_0000108 | Ga0501068_0000108_9936_10784 | 281 |
| 161 | 3300049585 | Ga0501069_0001287 | Ga0501069_0001287_3559_4407 | 281 |
| 162 | 3300049586 | Ga0501070_0350958 | Ga0501070_0350958_189_1037 | 281 |
| 163 | 3300049588 | Ga0501072_0000002 | Ga0501072_0000002_208145_208993 | 281 |
| 164 | 3300049589 | Ga0501073_0004186 | Ga0501073_0004186_8459_9307 | 281 |
| 165 | 3300049590 | Ga0501074_0002365 | Ga0501074_0002365_6761_7609 | 281 |
| 166 | 3300049591 | Ga0501075_0170278 | Ga0501075_0170278_385_1233 | 281 |
| 167 | 3300049592 | Ga0501076_0003889 | Ga0501076_0003889_7758_8606 | 281 |
| 168 | 3300049593 | Ga0501077_0148822 | Ga0501077_0148822_324_1172 | 281 |
| 169 | 3300049742 | Ga0501080_0092520 | Ga0501080_0092520_1469_2317 | 281 |
| 170 | 3300049744 | Ga0501083_0001967 | Ga0501083_0001967_6650_7498 | 281 |
| 171 | 3300049823 | Ga0501044_0017299 | Ga0501044_0017299_4773_5621 | 281 |
| 172 | 3300054114 | Ga0501084_0000054 | Ga0501084_0000054_58223_59071 | 281 |
| 173 | 3300059426 | Ga0590077_012694 | Ga0590077_012694_773_1624 | 281 |
| 174 | 3300060353 | Ga0501082_0016842 | Ga0501082_0016842_4954_5802 | 281 |
| 175 | 3300061734 | Ga0530510_0080386 | Ga0530510_0080386_1457_2305 | 281 |
| 176 | 3300005347 | Ga0070668_100049194 | Ga0070668_1000491942 | 282 |
| 177 | 3300005356 | Ga0070674_100020577 | Ga0070674_1000205772 | 282 |
| 178 | 3300005444 | Ga0070694_100037348 | Ga0070694_1000373482 | 282 |
| 179 | 3300005445 | Ga0070708_100015506 | Ga0070708_1000155066 | 282 |
| 180 | 3300005467 | Ga0070706_100027585 | Ga0070706_1000275852 | 282 |
| 181 | 3300005468 | Ga0070707_100089736 | Ga0070707_1000897362 | 282 |
| 182 | 3300005530 | Ga0070679_100170443 | Ga0070679_1001704432 | 282 |
| 183 | 3300005536 | Ga0070697_100036073 | Ga0070697_1000360734 | 282 |
| 184 | 3300005536 | Ga0070697_100046586 | Ga0070697_1000465864 | 282 |
| 185 | 3300005544 | Ga0070686_100071878 | Ga0070686_1000718781 | 282 |
| 186 | 3300005545 | Ga0070695_100016987 | Ga0070695_1000169873 | 282 |
| 187 | 3300005545 | Ga0070695_100026911 | Ga0070695_1000269112 | 282 |
| 188 | 3300005546 | Ga0070696_100040063 | Ga0070696_1000400634 | 282 |
| 189 | 3300005549 | Ga0070704_100248779 | Ga0070704_1002487792 | 282 |
| 190 | 3300005618 | Ga0068864_100129878 | Ga0068864_1001298782 | 282 |
| 191 | 3300005719 | Ga0068861_100301950 | Ga0068861_1003019502 | 282 |
| 192 | 3300005842 | Ga0068858_100272745 | Ga0068858_1002727452 | 282 |
| 193 | 3300005937 | Ga0081455_10133534 | Ga0081455_101335341 | 282 |
| 194 | 3300005985 | Ga0081539_10008121 | Ga0081539_100081213 | 282 |
| 195 | 3300009553 | Ga0105249_10089219 | Ga0105249_100892192 | 282 |
| 196 | 3300013297 | Ga0157378_10054675 | Ga0157378_100546753 | 282 |
| 197 | 3300013306 | Ga0163162_10799954 | Ga0163162_107999541 | 282 |
| 198 | 3300014325 | Ga0163163_10451920 | Ga0163163_104519202 | 282 |
| 199 | 3300014497 | Ga0182008_10078939 | Ga0182008_100789391 | 282 |
| 200 | 3300021388 | Ga0213875_10000137 | Ga0213875_1000013756 | 282 |
| 201 | 3300025225 | Ga0209566_100108 | Ga0209566_10010850 | 282 |
| 202 | 3300025910 | Ga0207684_10071762 | Ga0207684_100717622 | 282 |
| 203 | 3300025910 | Ga0207684_10220381 | Ga0207684_102203812 | 282 |
| 204 | 3300025972 | Ga0207668_10030442 | Ga0207668_100304423 | 282 |
| 205 | 3300026023 | Ga0207677_10162637 | Ga0207677_101626372 | 282 |
| 206 | 3300026118 | Ga0207675_100352431 | Ga0207675_1003524312 | 282 |
| 207 | 3300031241 | Ga0265325_10041187 | Ga0265325_100411872 | 282 |
| 208 | 3300031249 | Ga0265339_10021965 | Ga0265339_100219652 | 282 |
| 209 | 3300031595 | Ga0265313_10008990 | Ga0265313_100089906 | 282 |
| 210 | 3300035170 | Ga0373943_0304227 | Ga0373943_0304227_28_885 | 282 |
| 211 | 3300035725 | Ga0373947_0153208 | Ga0373947_0153208_294_1289 | 282 |
| 212 | 3300037068 | Ga0373925_0112771 | Ga0373925_0112771_100_1095 | 282 |
| 213 | 3300037853 | Ga0436364_0082088 | Ga0436364_0082088_17975_18907 | 282 |
| 214 | 3300041406 | Ga0439439_0000364 | Ga0439439_0000364_2719_3579 | 282 |
| 215 | 3300041999 | Ga0439433_0041527 | Ga0439433_0041527_160_1020 | 282 |
| 216 | 3300042007 | Ga0439449_0000684 | Ga0439449_0000684_9158_10018 | 282 |
| 217 | 3300042015 | Ga0439462_0001458 | Ga0439462_0001458_2549_3409 | 282 |
| 218 | 3300042125 | Ga0450923_021441 | Ga0450923_021441_217_1149 | 282 |
| 219 | 3300045976 | Ga0466967_0018179 | Ga0466967_0018179_2912_3820 | 282 |
| 220 | 3300046454 | Ga0495592_0149165 | Ga0495592_0149165_536_1435 | 282 |
| 221 | 3300046462 | Ga0495651_0059928 | Ga0495651_0059928_257_1156 | 282 |
| 222 | 3300046665 | Ga0495661_0072108 | Ga0495661_0072108_39_905 | 282 |
| 223 | 3300047322 | Ga0495680_0107329 | Ga0495680_0107329_731_1630 | 282 |
| 224 | 3300048088 | Ga0495602_0182331 | Ga0495602_0182331_323_1222 | 282 |
| 225 | 3300048091 | Ga0495626_0015994 | Ga0495626_0015994_500_1366 | 282 |
| 226 | 3300048905 | Ga0496102_0361519 | Ga0496102_0361519_401_1294 | 282 |
| 227 | 3300048907 | Ga0496104_0068796 | Ga0496104_0068796_98_1066 | 282 |
| 228 | 3300048908 | Ga0496105_0011415 | Ga0496105_0011415_2946_3914 | 282 |
| 229 | 3300048908 | Ga0496105_0168540 | Ga0496105_0168540_222_1211 | 282 |
| 230 | 3300048910 | Ga0496107_0195116 | Ga0496107_0195116_171_1112 | 282 |
| 231 | 3300048911 | Ga0496108_0028771 | Ga0496108_0028771_853_1821 | 282 |
| 232 | 3300048911 | Ga0496108_0186754 | Ga0496108_0186754_723_1652 | 282 |
| 233 | 3300048912 | Ga0496109_0011620 | Ga0496109_0011620_5135_6103 | 282 |
| 234 | 3300048912 | Ga0496109_0018772 | Ga0496109_0018772_1320_2306 | 282 |
| 235 | 3300048912 | Ga0496109_0134749 | Ga0496109_0134749_1144_2139 | 282 |
| 236 | 3300048912 | Ga0496109_0582679 | Ga0496109_0582679_49_978 | 282 |
| 237 | 3300048913 | Ga0496110_0033002 | Ga0496110_0033002_760_1728 | 282 |
| 238 | 3300048914 | Ga0496111_0037135 | Ga0496111_0037135_847_1815 | 282 |
| 239 | 3300048915 | Ga0496112_0100369 | Ga0496112_0100369_882_1811 | 282 |
| 240 | 3300049583 | Ga0501067_0040970 | Ga0501067_0040970_1452_2444 | 282 |
| 241 | 3300053077 | Ga0495601_0122703 | Ga0495601_0122703_70_969 | 282 |
| 242 | 3300053078 | Ga0495612_0019411 | Ga0495612_0019411_1365_2264 | 282 |
| 243 | 3300035725 | Ga0373947_0104728 | Ga0373947_0104728_653_1513 | 283 |
| 244 | 3300037068 | Ga0373925_0094477 | Ga0373925_0094477_1014_1874 | 283 |
| 245 | 3300046472 | Ga0495580_0004196 | Ga0495580_0004196_3391_4251 | 283 |
| 246 | 3300009545 | Ga0105237_10000223 | Ga0105237_1000022355 | 284 |
| 247 | 3300009551 | Ga0105238_10063942 | Ga0105238_100639423 | 284 |
| 248 | 3300013296 | Ga0157374_10258466 | Ga0157374_102584662 | 284 |
| 249 | 3300025914 | Ga0207671_10000256 | Ga0207671_1000025657 | 284 |
| 250 | 3300025924 | Ga0207694_10192305 | Ga0207694_101923052 | 284 |
| 251 | 3300046472 | Ga0495580_0015979 | Ga0495580_0015979_1978_2919 | 284 |
| 252 | 3300006914 | Ga0075436_100016687 | Ga0075436_1000166875 | 285 |
| 253 | 3300025910 | Ga0207684_10127316 | Ga0207684_101273163 | 285 |
| 254 | 3300028800 | Ga0265338_10001562 | Ga0265338_1000156239 | 285 |
| 255 | 3300045051 | Ga0451576_0000417 | Ga0451576_0000417_39664_40527 | 285 |
| 256 | 3300050514 | nmdc:mga08x19_827_c2 | nmdc:mga08x19_827_c2_7898_8830 | 285 |
| 257 | 3300005434 | Ga0070709_10127394 | Ga0070709_101273942 | 286 |
| 258 | 3300006175 | Ga0070712_100162944 | Ga0070712_1001629444 | 286 |
| 259 | 3300028800 | Ga0265338_10056535 | Ga0265338_100565353 | 286 |
| 260 | 3300031235 | Ga0265330_10004925 | Ga0265330_100049259 | 286 |
| 261 | 3300031250 | Ga0265331_10007181 | Ga0265331_100071819 | 286 |
| 262 | 3300031344 | Ga0265316_10013362 | Ga0265316_1001336210 | 286 |
| 263 | 3300031344 | Ga0265316_10174139 | Ga0265316_101741392 | 286 |
| 264 | 3300000549 | LJQas_1000007 | LJQas_100000721 | 287 |
| 265 | 3300005458 | Ga0070681_10034973 | Ga0070681_100349734 | 287 |
| 266 | 3300005468 | Ga0070707_100294931 | Ga0070707_1002949312 | 287 |
| 267 | 3300025912 | Ga0207707_10060292 | Ga0207707_100602922 | 287 |
| 268 | 3300005338 | Ga0068868_100002275 | Ga0068868_1000022754 | 288 |
| 269 | 3300005548 | Ga0070665_100048003 | Ga0070665_1000480033 | 288 |
| 270 | 3300005563 | Ga0068855_100004587 | Ga0068855_1000045874 | 288 |
| 271 | 3300005617 | Ga0068859_100024538 | Ga0068859_1000245387 | 288 |
| 272 | 3300006237 | Ga0097621_100059860 | Ga0097621_1000598604 | 288 |
| 273 | 3300006358 | Ga0068871_100005987 | Ga0068871_1000059878 | 288 |
| 274 | 3300006931 | Ga0097620_100024538 | Ga0097620_1000245387 | 288 |
| 275 | 3300009176 | Ga0105242_10013866 | Ga0105242_100138663 | 288 |
| 276 | 3300009545 | Ga0105237_10046509 | Ga0105237_100465094 | 288 |
| 277 | 3300009551 | Ga0105238_10008204 | Ga0105238_100082048 | 288 |
| 278 | 3300010375 | Ga0105239_10019814 | Ga0105239_100198146 | 288 |
| 279 | 3300013297 | Ga0157378_10365856 | Ga0157378_103658562 | 288 |
| 280 | 3300014325 | Ga0163163_10266364 | Ga0163163_102663642 | 288 |
| 281 | 3300025913 | Ga0207695_10016938 | Ga0207695_100169383 | 288 |
| 282 | 3300025924 | Ga0207694_10003426 | Ga0207694_100034266 | 288 |
| 283 | 3300025927 | Ga0207687_10174634 | Ga0207687_101746341 | 288 |
| 284 | 3300025949 | Ga0207667_10021589 | Ga0207667_100215892 | 288 |
| 285 | 3300026023 | Ga0207677_10003453 | Ga0207677_100034534 | 288 |
| 286 | 3300028379 | Ga0268266_10003198 | Ga0268266_1000319813 | 288 |
| 287 | 3300046472 | Ga0495580_0139981 | Ga0495580_0139981_486_1373 | 288 |
| 288 | 3300021377 | Ga0213874_10061087 | Ga0213874_100610871 | 289 |
| 289 | 3300025913 | Ga0207695_10305061 | Ga0207695_103050612 | 289 |
| 290 | 3300039450 | Ga0436363_0305072 | Ga0436363_0305072_135_1067 | 289 |
| 291 | 3300005445 | Ga0070708_100081034 | Ga0070708_1000810342 | 290 |
| 292 | 3300013297 | Ga0157378_10166445 | Ga0157378_101664453 | 290 |
| 293 | 3300031901 | Ga0307406_10173181 | Ga0307406_101731811 | 291 |
| 294 | 3300032005 | Ga0307411_10023799 | Ga0307411_100237992 | 291 |
| 295 | 3300007265 | Ga0099794_10069567 | Ga0099794_100695671 | 292 |
| 296 | 3300035119 | Ga0373956_0007033 | Ga0373956_0007033_667_1596 | 292 |
| 297 | 3300036401 | Ga0373937_0063437 | Ga0373937_0063437_1521_2450 | 292 |
| 298 | 3300031249 | Ga0265339_10000166 | Ga0265339_100001666 | 293 |
| 299 | 3300031344 | Ga0265316_10001544 | Ga0265316_1000154420 | 293 |
| 300 | 3300031712 | Ga0265342_10055883 | Ga0265342_100558832 | 293 |
| 301 | 3300005439 | Ga0070711_100030940 | Ga0070711_1000309402 | 294 |
| 302 | 3300006175 | Ga0070712_100310671 | Ga0070712_1003106712 | 294 |
| 303 | 3300005327 | Ga0070658_10017385 | Ga0070658_100173856 | 295 |
| 304 | 3300005329 | Ga0070683_100013341 | Ga0070683_1000133418 | 295 |
| 305 | 3300005329 | Ga0070683_100018105 | Ga0070683_1000181057 | 295 |
| 306 | 3300005329 | Ga0070683_100046079 | Ga0070683_1000460794 | 295 |
| 307 | 3300005329 | Ga0070683_100263147 | Ga0070683_1002631472 | 295 |
| 308 | 3300005336 | Ga0070680_100009354 | Ga0070680_1000093549 | 295 |
| 309 | 3300005339 | Ga0070660_100034314 | Ga0070660_1000343144 | 295 |
| 310 | 3300005339 | Ga0070660_100167511 | Ga0070660_1001675112 | 295 |
| 311 | 3300005341 | Ga0070691_10017606 | Ga0070691_100176063 | 295 |
| 312 | 3300005344 | Ga0070661_100026126 | Ga0070661_1000261264 | 295 |
| 313 | 3300005434 | Ga0070709_10106829 | Ga0070709_101068292 | 295 |
| 314 | 3300005436 | Ga0070713_100093866 | Ga0070713_1000938663 | 295 |
| 315 | 3300005436 | Ga0070713_100147555 | Ga0070713_1001475554 | 295 |
| 316 | 3300005439 | Ga0070711_100242037 | Ga0070711_1002420371 | 295 |
| 317 | 3300005439 | Ga0070711_100277359 | Ga0070711_1002773592 | 295 |
| 318 | 3300005441 | Ga0070700_100403488 | Ga0070700_1004034881 | 295 |
| 319 | 3300005458 | Ga0070681_10000605 | Ga0070681_1000060522 | 295 |
| 320 | 3300005458 | Ga0070681_10043027 | Ga0070681_100430274 | 295 |
| 321 | 3300005530 | Ga0070679_100009024 | Ga0070679_1000090245 | 295 |
| 322 | 3300005530 | Ga0070679_100140602 | Ga0070679_1001406023 | 295 |
| 323 | 3300005535 | Ga0070684_100002114 | Ga0070684_10000211413 | 295 |
| 324 | 3300005535 | Ga0070684_100022521 | Ga0070684_1000225213 | 295 |
| 325 | 3300005535 | Ga0070684_100249089 | Ga0070684_1002490891 | 295 |
| 326 | 3300005539 | Ga0068853_100038145 | Ga0068853_1000381453 | 295 |
| 327 | 3300005545 | Ga0070695_100060897 | Ga0070695_1000608973 | 295 |
| 328 | 3300005547 | Ga0070693_100006824 | Ga0070693_1000068243 | 295 |
| 329 | 3300005563 | Ga0068855_100007492 | Ga0068855_10000749211 | 295 |
| 330 | 3300005563 | Ga0068855_100049900 | Ga0068855_1000499003 | 295 |
| 331 | 3300005563 | Ga0068855_100085120 | Ga0068855_1000851203 | 295 |
| 332 | 3300005563 | Ga0068855_100093880 | Ga0068855_1000938803 | 295 |
| 333 | 3300005577 | Ga0068857_100003819 | Ga0068857_1000038199 | 295 |
| 334 | 3300005577 | Ga0068857_100007396 | Ga0068857_1000073964 | 295 |
| 335 | 3300005614 | Ga0068856_100010972 | Ga0068856_1000109725 | 295 |
| 336 | 3300005614 | Ga0068856_100022526 | Ga0068856_1000225264 | 295 |
| 337 | 3300005614 | Ga0068856_100036394 | Ga0068856_1000363943 | 295 |
| 338 | 3300005614 | Ga0068856_100086445 | Ga0068856_1000864452 | 295 |
| 339 | 3300005614 | Ga0068856_100118059 | Ga0068856_1001180592 | 295 |
| 340 | 3300005616 | Ga0068852_100264604 | Ga0068852_1002646042 | 295 |
| 341 | 3300005616 | Ga0068852_100284848 | Ga0068852_1002848482 | 295 |
| 342 | 3300005617 | Ga0068859_100281892 | Ga0068859_1002818922 | 295 |
| 343 | 3300005618 | Ga0068864_100020562 | Ga0068864_1000205623 | 295 |
| 344 | 3300005842 | Ga0068858_100005980 | Ga0068858_1000059808 | 295 |
| 345 | 3300005842 | Ga0068858_100129946 | Ga0068858_1001299462 | 295 |
| 346 | 3300005842 | Ga0068858_100147216 | Ga0068858_1001472162 | 295 |
| 347 | 3300006237 | Ga0097621_100012173 | Ga0097621_1000121733 | 295 |
| 348 | 3300006237 | Ga0097621_100454928 | Ga0097621_1004549282 | 295 |
| 349 | 3300006358 | Ga0068871_100262525 | Ga0068871_1002625252 | 295 |
| 350 | 3300006881 | Ga0068865_100030146 | Ga0068865_1000301462 | 295 |
| 351 | 3300006931 | Ga0097620_100281880 | Ga0097620_1002818803 | 295 |
| 352 | 3300009093 | Ga0105240_10003303 | Ga0105240_100033035 | 295 |
| 353 | 3300009093 | Ga0105240_10003832 | Ga0105240_1000383210 | 295 |
| 354 | 3300009093 | Ga0105240_10037802 | Ga0105240_100378024 | 295 |
| 355 | 3300009093 | Ga0105240_10063307 | Ga0105240_100633073 | 295 |
| 356 | 3300009093 | Ga0105240_10084091 | Ga0105240_100840914 | 295 |
| 357 | 3300009093 | Ga0105240_10664710 | Ga0105240_106647102 | 295 |
| 358 | 3300009098 | Ga0105245_10002254 | Ga0105245_100022547 | 295 |
| 359 | 3300009098 | Ga0105245_10061145 | Ga0105245_100611452 | 295 |
| 360 | 3300009098 | Ga0105245_10107928 | Ga0105245_101079283 | 295 |
| 361 | 3300009098 | Ga0105245_10262345 | Ga0105245_102623452 | 295 |
| 362 | 3300009101 | Ga0105247_10071278 | Ga0105247_100712783 | 295 |
| 363 | 3300009148 | Ga0105243_10090788 | Ga0105243_100907881 | 295 |
| 364 | 3300009174 | Ga0105241_10008535 | Ga0105241_100085354 | 295 |
| 365 | 3300009174 | Ga0105241_10138018 | Ga0105241_101380182 | 295 |
| 366 | 3300009177 | Ga0105248_10045759 | Ga0105248_100457593 | 295 |
| 367 | 3300009177 | Ga0105248_10085631 | Ga0105248_100856311 | 295 |
| 368 | 3300009177 | Ga0105248_10107131 | Ga0105248_101071313 | 295 |
| 369 | 3300009177 | Ga0105248_10332995 | Ga0105248_103329952 | 295 |
| 370 | 3300009545 | Ga0105237_10021372 | Ga0105237_100213725 | 295 |
| 371 | 3300009545 | Ga0105237_10077423 | Ga0105237_100774233 | 295 |
| 372 | 3300009545 | Ga0105237_10110999 | Ga0105237_101109992 | 295 |
| 373 | 3300009551 | Ga0105238_10008033 | Ga0105238_100080339 | 295 |
| 374 | 3300009551 | Ga0105238_10011819 | Ga0105238_100118197 | 295 |
| 375 | 3300009551 | Ga0105238_10018386 | Ga0105238_100183862 | 295 |
| 376 | 3300009551 | Ga0105238_10062169 | Ga0105238_100621693 | 295 |
| 377 | 3300009553 | Ga0105249_10237101 | Ga0105249_102371012 | 295 |
| 378 | 3300010375 | Ga0105239_10006113 | Ga0105239_1000611311 | 295 |
| 379 | 3300010375 | Ga0105239_10018215 | Ga0105239_100182152 | 295 |
| 380 | 3300010375 | Ga0105239_10020900 | Ga0105239_100209004 | 295 |
| 381 | 3300011119 | Ga0105246_10190773 | Ga0105246_101907731 | 295 |
| 382 | 3300013104 | Ga0157370_10005991 | Ga0157370_1000599112 | 295 |
| 383 | 3300013104 | Ga0157370_10006307 | Ga0157370_1000630711 | 295 |
| 384 | 3300013104 | Ga0157370_10057435 | Ga0157370_100574353 | 295 |
| 385 | 3300013105 | Ga0157369_10008782 | Ga0157369_100087825 | 295 |
| 386 | 3300013105 | Ga0157369_10013263 | Ga0157369_100132633 | 295 |
| 387 | 3300013105 | Ga0157369_10016965 | Ga0157369_100169658 | 295 |
| 388 | 3300013105 | Ga0157369_10112426 | Ga0157369_101124263 | 295 |
| 389 | 3300013296 | Ga0157374_10012136 | Ga0157374_100121362 | 295 |
| 390 | 3300013306 | Ga0163162_10013500 | Ga0163162_100135004 | 295 |
| 391 | 3300013306 | Ga0163162_10209761 | Ga0163162_102097613 | 295 |
| 392 | 3300013306 | Ga0163162_10258956 | Ga0163162_102589562 | 295 |
| 393 | 3300013307 | Ga0157372_10007318 | Ga0157372_100073185 | 295 |
| 394 | 3300013307 | Ga0157372_10057171 | Ga0157372_100571712 | 295 |
| 395 | 3300013307 | Ga0157372_10374825 | Ga0157372_103748252 | 295 |
| 396 | 3300013307 | Ga0157372_10665210 | Ga0157372_106652102 | 295 |
| 397 | 3300013308 | Ga0157375_10005690 | Ga0157375_100056906 | 295 |
| 398 | 3300013308 | Ga0157375_10700022 | Ga0157375_107000221 | 295 |
| 399 | 3300014325 | Ga0163163_10002598 | Ga0163163_1000259814 | 295 |
| 400 | 3300014325 | Ga0163163_10018126 | Ga0163163_100181264 | 295 |
| 401 | 3300014325 | Ga0163163_10875955 | Ga0163163_108759551 | 295 |
| 402 | 3300014968 | Ga0157379_10050360 | Ga0157379_100503602 | 295 |
| 403 | 3300014968 | Ga0157379_10065070 | Ga0157379_100650702 | 295 |
| 404 | 3300014969 | Ga0157376_10096022 | Ga0157376_100960222 | 295 |
| 405 | 3300014969 | Ga0157376_10182786 | Ga0157376_101827862 | 295 |
| 406 | 3300025903 | Ga0207680_10044635 | Ga0207680_100446352 | 295 |
| 407 | 3300025909 | Ga0207705_10067567 | Ga0207705_100675672 | 295 |
| 408 | 3300025911 | Ga0207654_10078752 | Ga0207654_100787522 | 295 |
| 409 | 3300025912 | Ga0207707_10000372 | Ga0207707_100003723 | 295 |
| 410 | 3300025912 | Ga0207707_10248489 | Ga0207707_102484892 | 295 |
| 411 | 3300025913 | Ga0207695_10000563 | Ga0207695_1000056332 | 295 |
| 412 | 3300025913 | Ga0207695_10008730 | Ga0207695_100087306 | 295 |
| 413 | 3300025913 | Ga0207695_10035763 | Ga0207695_100357634 | 295 |
| 414 | 3300025917 | Ga0207660_10052210 | Ga0207660_100522103 | 295 |
| 415 | 3300025917 | Ga0207660_10087896 | Ga0207660_100878962 | 295 |
| 416 | 3300025919 | Ga0207657_10008514 | Ga0207657_100085143 | 295 |
| 417 | 3300025919 | Ga0207657_10141762 | Ga0207657_101417623 | 295 |
| 418 | 3300025921 | Ga0207652_10008525 | Ga0207652_100085253 | 295 |
| 419 | 3300025921 | Ga0207652_10111378 | Ga0207652_101113783 | 295 |
| 420 | 3300025924 | Ga0207694_10002271 | Ga0207694_1000227111 | 295 |
| 421 | 3300025924 | Ga0207694_10009451 | Ga0207694_100094515 | 295 |
| 422 | 3300025924 | Ga0207694_10051476 | Ga0207694_100514762 | 295 |
| 423 | 3300025924 | Ga0207694_10096390 | Ga0207694_100963902 | 295 |
| 424 | 3300025927 | Ga0207687_10023621 | Ga0207687_100236212 | 295 |
| 425 | 3300025927 | Ga0207687_10025790 | Ga0207687_100257903 | 295 |
| 426 | 3300025927 | Ga0207687_10355395 | Ga0207687_103553952 | 295 |
| 427 | 3300025928 | Ga0207700_10108197 | Ga0207700_101081973 | 295 |
| 428 | 3300025928 | Ga0207700_10123466 | Ga0207700_101234662 | 295 |
| 429 | 3300025931 | Ga0207644_10013253 | Ga0207644_100132535 | 295 |
| 430 | 3300025935 | Ga0207709_10060594 | Ga0207709_100605943 | 295 |
| 431 | 3300025938 | Ga0207704_10162165 | Ga0207704_101621652 | 295 |
| 432 | 3300025941 | Ga0207711_10003507 | Ga0207711_100035073 | 295 |
| 433 | 3300025941 | Ga0207711_10274577 | Ga0207711_102745771 | 295 |
| 434 | 3300025942 | Ga0207689_10197476 | Ga0207689_101974762 | 295 |
| 435 | 3300025944 | Ga0207661_10028768 | Ga0207661_100287684 | 295 |
| 436 | 3300025944 | Ga0207661_10031447 | Ga0207661_100314474 | 295 |
| 437 | 3300025944 | Ga0207661_10131306 | Ga0207661_101313062 | 295 |
| 438 | 3300025944 | Ga0207661_10309717 | Ga0207661_103097172 | 295 |
| 439 | 3300025944 | Ga0207661_10543208 | Ga0207661_105432081 | 295 |
| 440 | 3300025949 | Ga0207667_10001746 | Ga0207667_1000174624 | 295 |
| 441 | 3300025949 | Ga0207667_10015000 | Ga0207667_100150005 | 295 |
| 442 | 3300025949 | Ga0207667_10039308 | Ga0207667_100393084 | 295 |
| 443 | 3300026035 | Ga0207703_10010141 | Ga0207703_100101413 | 295 |
| 444 | 3300026035 | Ga0207703_10012257 | Ga0207703_100122575 | 295 |
| 445 | 3300026035 | Ga0207703_10045889 | Ga0207703_100458893 | 295 |
| 446 | 3300026035 | Ga0207703_10080867 | Ga0207703_100808673 | 295 |
| 447 | 3300026041 | Ga0207639_10035103 | Ga0207639_100351034 | 295 |
| 448 | 3300026078 | Ga0207702_10003891 | Ga0207702_100038915 | 295 |
| 449 | 3300026078 | Ga0207702_10045510 | Ga0207702_100455102 | 295 |
| 450 | 3300026095 | Ga0207676_10015283 | Ga0207676_100152835 | 295 |
| 451 | 3300026095 | Ga0207676_10018647 | Ga0207676_100186474 | 295 |
| 452 | 3300026116 | Ga0207674_10000503 | Ga0207674_1000050354 | 295 |
| 453 | 3300026116 | Ga0207674_10002123 | Ga0207674_100021239 | 295 |
| 454 | 3300026116 | Ga0207674_10006162 | Ga0207674_100061628 | 295 |
| 455 | 3300026142 | Ga0207698_10015980 | Ga0207698_100159805 | 295 |
| 456 | 3300026142 | Ga0207698_10618425 | Ga0207698_106184251 | 295 |
| 457 | 3300028379 | Ga0268266_10228066 | Ga0268266_102280662 | 295 |
| 458 | 3300028800 | Ga0265338_10241884 | Ga0265338_102418842 | 295 |
| 459 | 3300031595 | Ga0265313_10003840 | Ga0265313_100038405 | 295 |
| 460 | 3300031711 | Ga0265314_10237486 | Ga0265314_102374861 | 295 |
| 461 | 3300035086 | Ga0373934_0013316 | Ga0373934_0013316_1996_2916 | 295 |
| 462 | 3300035113 | Ga0373936_0021787 | Ga0373936_0021787_114_1010 | 295 |
| 463 | 3300035118 | Ga0373954_0099487 | Ga0373954_0099487_388_1281 | 295 |
| 464 | 3300035120 | Ga0373957_0030295 | Ga0373957_0030295_149_1054 | 295 |
| 465 | 3300035120 | Ga0373957_0096527 | Ga0373957_0096527_152_1069 | 295 |
| 466 | 3300035171 | Ga0373946_0061604 | Ga0373946_0061604_279_1175 | 295 |
| 467 | 3300035172 | Ga0373955_0043801 | Ga0373955_0043801_1084_2004 | 295 |
| 468 | 3300035172 | Ga0373955_0132194 | Ga0373955_0132194_154_1059 | 295 |
| 469 | 3300035692 | Ga0373935_0200642 | Ga0373935_0200642_118_1038 | 295 |
| 470 | 3300035695 | Ga0373927_0007949 | Ga0373927_0007949_5992_6900 | 295 |
| 471 | 3300035724 | Ga0373933_0009825 | Ga0373933_0009825_327_1232 | 295 |
| 472 | 3300035725 | Ga0373947_0185495 | Ga0373947_0185495_290_1198 | 295 |
| 473 | 3300036401 | Ga0373937_0007488 | Ga0373937_0007488_8063_8968 | 295 |
| 474 | 3300036401 | Ga0373937_0029905 | Ga0373937_0029905_3371_4282 | 295 |
| 475 | 3300036401 | Ga0373937_0052871 | Ga0373937_0052871_1099_1992 | 295 |
| 476 | 3300036401 | Ga0373937_0127978 | Ga0373937_0127978_377_1297 | 295 |
| 477 | 3300036401 | Ga0373937_0323476 | Ga0373937_0323476_518_1438 | 295 |
| 478 | 3300037068 | Ga0373925_0025741 | Ga0373925_0025741_989_1894 | 295 |
| 479 | 3300046454 | Ga0495592_0041600 | Ga0495592_0041600_340_1233 | 295 |
| 480 | 3300046462 | Ga0495651_0118703 | Ga0495651_0118703_265_1185 | 295 |
| 481 | 3300046472 | Ga0495580_0029946 | Ga0495580_0029946_129_1049 | 295 |
| 482 | 3300046472 | Ga0495580_0080968 | Ga0495580_0080968_1194_2099 | 295 |
| 483 | 3300046473 | Ga0495582_0076753 | Ga0495582_0076753_415_1308 | 295 |
| 484 | 3300046473 | Ga0495582_0083217 | Ga0495582_0083217_501_1397 | 295 |
| 485 | 3300046475 | Ga0495639_0064283 | Ga0495639_0064283_339_1232 | 295 |
| 486 | 3300046477 | Ga0495664_0074207 | Ga0495664_0074207_1047_1967 | 295 |
| 487 | 3300046499 | Ga0495594_0017572 | Ga0495594_0017572_1189_2082 | 295 |
| 488 | 3300046516 | Ga0495628_0118358 | Ga0495628_0118358_363_1280 | 295 |
| 489 | 3300046529 | Ga0495652_0105876 | Ga0495652_0105876_1162_2067 | 295 |
| 490 | 3300046529 | Ga0495652_0129100 | Ga0495652_0129100_11_931 | 295 |
| 491 | 3300046531 | Ga0495665_0091083 | Ga0495665_0091083_607_1503 | 295 |
| 492 | 3300046535 | Ga0495586_0096141 | Ga0495586_0096141_446_1339 | 295 |
| 493 | 3300046535 | Ga0495586_0148444 | Ga0495586_0148444_266_1171 | 295 |
| 494 | 3300046642 | Ga0495634_0017369 | Ga0495634_0017369_3845_4738 | 295 |
| 495 | 3300046679 | Ga0495623_0161155 | Ga0495623_0161155_227_1120 | 295 |
| 496 | 3300048905 | Ga0496102_0376505 | Ga0496102_0376505_205_1125 | 295 |
| 497 | 3300009545 | Ga0105237_10457109 | Ga0105237_104571091 | 297 |
| 498 | 3300014325 | Ga0163163_10511951 | Ga0163163_105119511 | 297 |
| 499 | 3300025321 | Ga0207656_10029760 | Ga0207656_100297603 | 297 |
| 500 | 3300009093 | Ga0105240_10156934 | Ga0105240_101569342 | 298 |
| 501 | 3300009177 | Ga0105248_10232588 | Ga0105248_102325882 | 298 |
| 502 | 3300009551 | Ga0105238_10118213 | Ga0105238_101182133 | 298 |
| 503 | 3300013307 | Ga0157372_10118462 | Ga0157372_101184623 | 298 |
| 504 | 3300014497 | Ga0182008_10080883 | Ga0182008_100808831 | 298 |
| 505 | 3300015261 | Ga0182006_1057686 | Ga0182006_10576861 | 298 |
| 506 | 3300025919 | Ga0207657_10022801 | Ga0207657_100228015 | 298 |
| 507 | 3300025924 | Ga0207694_10151685 | Ga0207694_101516852 | 298 |
| 508 | 3300039453 | Ga0436362_0963183 | Ga0436362_0963183_1163_2062 | 298 |
| 509 | 3300048914 | Ga0496111_0120134 | Ga0496111_0120134_963_1910 | 298 |
| 510 | 3300005330 | Ga0070690_100386479 | Ga0070690_1003864791 | 300 |
| 511 | 3300005434 | Ga0070709_10301612 | Ga0070709_103016121 | 300 |
| 512 | 3300005518 | Ga0070699_100208234 | Ga0070699_1002082342 | 300 |
| 513 | 3300013308 | Ga0157375_10327530 | Ga0157375_103275302 | 300 |
| 514 | 3300035170 | Ga0373943_0021984 | Ga0373943_0021984_1259_2185 | 300 |
| 515 | 3300035692 | Ga0373935_0239424 | Ga0373935_0239424_232_1158 | 300 |
| 516 | 3300035695 | Ga0373927_0001504 | Ga0373927_0001504_11993_12919 | 300 |
| 517 | 3300035725 | Ga0373947_0000236 | Ga0373947_0000236_9938_10864 | 300 |
| 518 | 3300036401 | Ga0373937_0381349 | Ga0373937_0381349_355_1260 | 300 |
| 519 | 3300037068 | Ga0373925_0000139 | Ga0373925_0000139_34369_35295 | 300 |
| 520 | 3300046690 | Ga0495624_0169747 | Ga0495624_0169747_286_1212 | 300 |
| 521 | 3300050507 | nmdc:mga05p37_454675_c1 | nmdc:mga05p37_454675_c1_14_922 | 300 |
| 522 | 3300005456 | Ga0070678_100179288 | Ga0070678_1001792881 | 301 |
| 523 | 3300005458 | Ga0070681_10213804 | Ga0070681_102138043 | 301 |
| 524 | 3300005614 | Ga0068856_100218103 | Ga0068856_1002181032 | 301 |
| 525 | 3300013104 | Ga0157370_10040560 | Ga0157370_100405606 | 301 |
| 526 | 3300013308 | Ga0157375_10249317 | Ga0157375_102493171 | 301 |
| 527 | 3300025909 | Ga0207705_10047594 | Ga0207705_100475943 | 301 |
| 528 | 3300025912 | Ga0207707_10057693 | Ga0207707_100576934 | 301 |
| 529 | 3300026121 | Ga0207683_10240206 | Ga0207683_102402061 | 301 |
| 530 | 3300049580 | Ga0501046_0390600 | Ga0501046_0390600_76_984 | 301 |
| 531 | 3300049581 | Ga0501047_0221804 | Ga0501047_0221804_187_1095 | 301 |
| 532 | 3300005336 | Ga0070680_100010904 | Ga0070680_1000109046 | 302 |
| 533 | 3300005548 | Ga0070665_100238239 | Ga0070665_1002382391 | 302 |
| 534 | 3300005563 | Ga0068855_100058864 | Ga0068855_1000588643 | 302 |
| 535 | 3300005614 | Ga0068856_100125226 | Ga0068856_1001252263 | 302 |
| 536 | 3300006028 | Ga0070717_10451066 | Ga0070717_104510661 | 302 |
| 537 | 3300009093 | Ga0105240_10013706 | Ga0105240_100137064 | 302 |
| 538 | 3300013104 | Ga0157370_10065457 | Ga0157370_100654572 | 302 |
| 539 | 3300013105 | Ga0157369_10012845 | Ga0157369_100128453 | 302 |
| 540 | 3300013296 | Ga0157374_10303284 | Ga0157374_103032842 | 302 |
| 541 | 3300025949 | Ga0207667_10050214 | Ga0207667_100502143 | 302 |
| 542 | 3300026142 | Ga0207698_10013952 | Ga0207698_100139523 | 302 |
| 543 | 3300028379 | Ga0268266_10422514 | Ga0268266_104225141 | 302 |
| 544 | 3300037418 | Ga0395900_0334769 | Ga0395900_0334769_221_1138 | 302 |
| 545 | 3300046472 | Ga0495580_0026187 | Ga0495580_0026187_1400_2329 | 302 |
| 546 | 3300005336 | Ga0070680_100307333 | Ga0070680_1003073331 | 303 |
| 547 | 3300005344 | Ga0070661_100013004 | Ga0070661_1000130041 | 303 |
| 548 | 3300005344 | Ga0070661_100115847 | Ga0070661_1001158472 | 303 |
| 549 | 3300005344 | Ga0070661_100286029 | Ga0070661_1002860292 | 303 |
| 550 | 3300005366 | Ga0070659_100083707 | Ga0070659_1000837072 | 303 |
| 551 | 3300005436 | Ga0070713_100211971 | Ga0070713_1002119711 | 303 |
| 552 | 3300005456 | Ga0070678_100219297 | Ga0070678_1002192972 | 303 |
| 553 | 3300005468 | Ga0070707_100156247 | Ga0070707_1001562472 | 303 |
| 554 | 3300005536 | Ga0070697_100037641 | Ga0070697_1000376413 | 303 |
| 555 | 3300005539 | Ga0068853_100081151 | Ga0068853_1000811512 | 303 |
| 556 | 3300005563 | Ga0068855_100095978 | Ga0068855_1000959783 | 303 |
| 557 | 3300005563 | Ga0068855_100189752 | Ga0068855_1001897521 | 303 |
| 558 | 3300005564 | Ga0070664_100309057 | Ga0070664_1003090571 | 303 |
| 559 | 3300005564 | Ga0070664_100336510 | Ga0070664_1003365102 | 303 |
| 560 | 3300005614 | Ga0068856_100027489 | Ga0068856_1000274894 | 303 |
| 561 | 3300005614 | Ga0068856_100040539 | Ga0068856_1000405392 | 303 |
| 562 | 3300005937 | Ga0081455_10027970 | Ga0081455_100279703 | 303 |
| 563 | 3300006028 | Ga0070717_10023812 | Ga0070717_100238124 | 303 |
| 564 | 3300006846 | Ga0075430_100013130 | Ga0075430_1000131307 | 303 |
| 565 | 3300006847 | Ga0075431_100045761 | Ga0075431_1000457613 | 303 |
| 566 | 3300009098 | Ga0105245_10157114 | Ga0105245_101571143 | 303 |
| 567 | 3300010375 | Ga0105239_10226136 | Ga0105239_102261362 | 303 |
| 568 | 3300013104 | Ga0157370_10016399 | Ga0157370_100163992 | 303 |
| 569 | 3300013105 | Ga0157369_10063670 | Ga0157369_100636704 | 303 |
| 570 | 3300013105 | Ga0157369_10152686 | Ga0157369_101526863 | 303 |
| 571 | 3300013296 | Ga0157374_10067061 | Ga0157374_100670612 | 303 |
| 572 | 3300013307 | Ga0157372_10020322 | Ga0157372_100203223 | 303 |
| 573 | 3300021388 | Ga0213875_10059306 | Ga0213875_100593062 | 303 |
| 574 | 3300025912 | Ga0207707_10292634 | Ga0207707_102926342 | 303 |
| 575 | 3300025917 | Ga0207660_10390683 | Ga0207660_103906831 | 303 |
| 576 | 3300025921 | Ga0207652_10447328 | Ga0207652_104473281 | 303 |
| 577 | 3300025949 | Ga0207667_10140890 | Ga0207667_101408903 | 303 |
| 578 | 3300026078 | Ga0207702_10067007 | Ga0207702_100670073 | 303 |
| 579 | 3300026078 | Ga0207702_10153726 | Ga0207702_101537263 | 303 |
| 580 | 3300026121 | Ga0207683_10461022 | Ga0207683_104610221 | 303 |
| 581 | 3300031235 | Ga0265330_10007010 | Ga0265330_100070104 | 303 |
| 582 | 3300031235 | Ga0265330_10022903 | Ga0265330_100229032 | 303 |
| 583 | 3300031235 | Ga0265330_10038588 | Ga0265330_100385882 | 303 |
| 584 | 3300031242 | Ga0265329_10030458 | Ga0265329_100304582 | 303 |
| 585 | 3300031344 | Ga0265316_10004170 | Ga0265316_1000417010 | 303 |
| 586 | 3300031344 | Ga0265316_10116486 | Ga0265316_101164863 | 303 |
| 587 | 3300031712 | Ga0265342_10004295 | Ga0265342_100042957 | 303 |
| 588 | 3300035695 | Ga0373927_0006461 | Ga0373927_0006461_6235_7167 | 303 |
| 589 | 3300037853 | Ga0436364_1046789 | Ga0436364_1046789_436_1392 | 303 |
| 590 | 3300037853 | Ga0436364_1265083 | Ga0436364_1265083_671_1591 | 303 |
| 591 | 3300044693 | Ga0466961_0050872 | Ga0466961_0050872_1581_2495 | 303 |
| 592 | 3300044694 | Ga0466963_0003571 | Ga0466963_0003571_3190_4104 | 303 |
| 593 | 3300046472 | Ga0495580_0048971 | Ga0495580_0048971_1754_2686 | 303 |
| 594 | 3300047471 | Ga0495684_0223931 | Ga0495684_0223931_47_979 | 303 |
| 595 | 3300048918 | Ga0496115_0062817 | Ga0496115_0062817_370_1293 | 303 |
| 596 | 3300050509 | nmdc:mga0qj67_92397_c1 | nmdc:mga0qj67_92397_c1_1115_2044 | 303 |
| 597 | 3300005518 | Ga0070699_100024627 | Ga0070699_1000246276 | 304 |
| 598 | 3300005548 | Ga0070665_100175928 | Ga0070665_1001759282 | 304 |
| 599 | 3300005616 | Ga0068852_100210130 | Ga0068852_1002101302 | 304 |
| 600 | 3300006852 | Ga0075433_10003719 | Ga0075433_1000371914 | 304 |
| 601 | 3300006871 | Ga0075434_100000069 | Ga0075434_1000000697 | 304 |
| 602 | 3300006914 | Ga0075436_100007970 | Ga0075436_1000079704 | 304 |
| 603 | 3300007076 | Ga0075435_100106627 | Ga0075435_1001066272 | 304 |
| 604 | 3300007076 | Ga0075435_100116985 | Ga0075435_1001169853 | 304 |
| 605 | 3300009093 | Ga0105240_10716684 | Ga0105240_107166841 | 304 |
| 606 | 3300009094 | Ga0111539_10077847 | Ga0111539_100778472 | 304 |
| 607 | 3300009147 | Ga0114129_10333590 | Ga0114129_103335902 | 304 |
| 608 | 3300013105 | Ga0157369_10204804 | Ga0157369_102048042 | 304 |
| 609 | 3300021361 | Ga0213872_10000182 | Ga0213872_1000018249 | 304 |
| 610 | 3300021377 | Ga0213874_10011049 | Ga0213874_100110492 | 304 |
| 611 | 3300021384 | Ga0213876_10003589 | Ga0213876_100035897 | 304 |
| 612 | 3300021384 | Ga0213876_10071368 | Ga0213876_100713683 | 304 |
| 613 | 3300021388 | Ga0213875_10000019 | Ga0213875_10000019100 | 304 |
| 614 | 3300021388 | Ga0213875_10000109 | Ga0213875_1000010955 | 304 |
| 615 | 3300021388 | Ga0213875_10001103 | Ga0213875_100011034 | 304 |
| 616 | 3300021388 | Ga0213875_10003448 | Ga0213875_100034486 | 304 |
| 617 | 3300021388 | Ga0213875_10091566 | Ga0213875_100915662 | 304 |
| 618 | 3300021388 | Ga0213875_10092868 | Ga0213875_100928682 | 304 |
| 619 | 3300025904 | Ga0207647_10206988 | Ga0207647_102069882 | 304 |
| 620 | 3300025922 | Ga0207646_10000447 | Ga0207646_1000044711 | 304 |
| 621 | 3300026067 | Ga0207678_10274679 | Ga0207678_102746792 | 304 |
| 622 | 3300027907 | Ga0207428_10002460 | Ga0207428_100024604 | 304 |
| 623 | 3300028379 | Ga0268266_10204867 | Ga0268266_102048672 | 304 |
| 624 | 3300037853 | Ga0436364_0096221 | Ga0436364_0096221_214_1134 | 304 |
| 625 | 3300037853 | Ga0436364_0197022 | Ga0436364_0197022_11811_12743 | 304 |
| 626 | 3300037853 | Ga0436364_0199614 | Ga0436364_0199614_1181_2101 | 304 |
| 627 | 3300037853 | Ga0436364_0313932 | Ga0436364_0313932_3478_4413 | 304 |
| 628 | 3300037853 | Ga0436364_0366372 | Ga0436364_0366372_127252_128187 | 304 |
| 629 | 3300037853 | Ga0436364_0452996 | Ga0436364_0452996_5079_5999 | 304 |
| 630 | 3300037853 | Ga0436364_0472599 | Ga0436364_0472599_1118_2047 | 304 |
| 631 | 3300037853 | Ga0436364_1023107 | Ga0436364_1023107_1078_1998 | 304 |
| 632 | 3300037853 | Ga0436364_1239453 | Ga0436364_1239453_1540_2460 | 304 |
| 633 | 3300037853 | Ga0436364_1247308 | Ga0436364_1247308_299_1219 | 304 |
| 634 | 3300037853 | Ga0436364_1326320 | Ga0436364_1326320_2499_3425 | 304 |
| 635 | 3300039437 | Ga0436365_0500041 | Ga0436365_0500041_1710_2639 | 304 |
| 636 | 3300039437 | Ga0436365_0586387 | Ga0436365_0586387_110_1042 | 304 |
| 637 | 3300039437 | Ga0436365_1155152 | Ga0436365_1155152_20015_20935 | 304 |
| 638 | 3300039437 | Ga0436365_1870226 | Ga0436365_1870226_1069_1989 | 304 |
| 639 | 3300039438 | Ga0436360_0212151 | Ga0436360_0212151_295_1212 | 304 |
| 640 | 3300039447 | Ga0436361_0126076 | Ga0436361_0126076_58013_58948 | 304 |
| 641 | 3300039450 | Ga0436363_0052707 | Ga0436363_0052707_1328_2254 | 304 |
| 642 | 3300039450 | Ga0436363_0647531 | Ga0436363_0647531_323_1243 | 304 |
| 643 | 3300039450 | Ga0436363_1068053 | Ga0436363_1068053_185_1108 | 304 |
| 644 | 3300039453 | Ga0436362_0471056 | Ga0436362_0471056_1971_2903 | 304 |
| 645 | 3300039453 | Ga0436362_0556739 | Ga0436362_0556739_1561_2484 | 304 |
| 646 | 3300048912 | Ga0496109_0000016 | Ga0496109_0000016_17497_18420 | 304 |
| 647 | 3300050510 | nmdc:mga06r32_66914_c1 | nmdc:mga06r32_66914_c1_1059_1982 | 304 |
| 648 | 3300050511 | nmdc:mga08y16_13302_c1 | nmdc:mga08y16_13302_c1_2075_2998 | 304 |
| 649 | 3300050512 | nmdc:mga0n895_514_c1 | nmdc:mga0n895_514_c1_15372_16313 | 304 |
| 650 | 3300050513 | nmdc:mga0rr50_287013_c1 | nmdc:mga0rr50_287013_c1_12_935 | 304 |
| 651 | 3300050513 | nmdc:mga0rr50_8099_c1 | nmdc:mga0rr50_8099_c1_92_1033 | 304 |
| 652 | 3300050514 | nmdc:mga08x19_12901_c1 | nmdc:mga08x19_12901_c1_3505_4446 | 304 |
| 653 | 3300054114 | Ga0501084_0087935 | Ga0501084_0087935_1617_2540 | 304 |
| 654 | 2162886012 | MBSR1b_contig_2607737 | MBSR1b_0494.00003840 | 305 |
| 655 | 3300005293 | Ga0065715_10124535 | Ga0065715_101245352 | 305 |
| 656 | 3300005330 | Ga0070690_100053341 | Ga0070690_1000533413 | 305 |
| 657 | 3300005334 | Ga0068869_100023139 | Ga0068869_1000231394 | 305 |
| 658 | 3300005340 | Ga0070689_100034718 | Ga0070689_1000347182 | 305 |
| 659 | 3300005354 | Ga0070675_100155155 | Ga0070675_1001551553 | 305 |
| 660 | 3300005355 | Ga0070671_100312434 | Ga0070671_1003124341 | 305 |
| 661 | 3300005458 | Ga0070681_10150205 | Ga0070681_101502052 | 305 |
| 662 | 3300005539 | Ga0068853_100314152 | Ga0068853_1003141521 | 305 |
| 663 | 3300005543 | Ga0070672_100246532 | Ga0070672_1002465322 | 305 |
| 664 | 3300005564 | Ga0070664_100176442 | Ga0070664_1001764422 | 305 |
| 665 | 3300005578 | Ga0068854_100142677 | Ga0068854_1001426772 | 305 |
| 666 | 3300005617 | Ga0068859_100043795 | Ga0068859_1000437952 | 305 |
| 667 | 3300005618 | Ga0068864_100225252 | Ga0068864_1002252522 | 305 |
| 668 | 3300005841 | Ga0068863_100419081 | Ga0068863_1004190812 | 305 |
| 669 | 3300005841 | Ga0068863_100474461 | Ga0068863_1004744611 | 305 |
| 670 | 3300005842 | Ga0068858_100068750 | Ga0068858_1000687502 | 305 |
| 671 | 3300005842 | Ga0068858_100073980 | Ga0068858_1000739802 | 305 |
| 672 | 3300005843 | Ga0068860_100030585 | Ga0068860_1000305851 | 305 |
| 673 | 3300005844 | Ga0068862_100265430 | Ga0068862_1002654302 | 305 |
| 674 | 3300006237 | Ga0097621_100456789 | Ga0097621_1004567891 | 305 |
| 675 | 3300006237 | Ga0097621_100629932 | Ga0097621_1006299321 | 305 |
| 676 | 3300006358 | Ga0068871_100043122 | Ga0068871_1000431222 | 305 |
| 677 | 3300006358 | Ga0068871_100275505 | Ga0068871_1002755051 | 305 |
| 678 | 3300006358 | Ga0068871_100503766 | Ga0068871_1005037661 | 305 |
| 679 | 3300006931 | Ga0097620_100043791 | Ga0097620_1000437912 | 305 |
| 680 | 3300009101 | Ga0105247_10005102 | Ga0105247_100051026 | 305 |
| 681 | 3300009174 | Ga0105241_10045243 | Ga0105241_100452434 | 305 |
| 682 | 3300009177 | Ga0105248_10054531 | Ga0105248_100545315 | 305 |
| 683 | 3300009177 | Ga0105248_10239066 | Ga0105248_102390662 | 305 |
| 684 | 3300009545 | Ga0105237_10173473 | Ga0105237_101734733 | 305 |
| 685 | 3300009553 | Ga0105249_10134884 | Ga0105249_101348842 | 305 |
| 686 | 3300010375 | Ga0105239_10242934 | Ga0105239_102429341 | 305 |
| 687 | 3300013297 | Ga0157378_10184073 | Ga0157378_101840732 | 305 |
| 688 | 3300013306 | Ga0163162_10086353 | Ga0163162_100863532 | 305 |
| 689 | 3300013306 | Ga0163162_10124049 | Ga0163162_101240492 | 305 |
| 690 | 3300013308 | Ga0157375_10159781 | Ga0157375_101597813 | 305 |
| 691 | 3300014325 | Ga0163163_10040514 | Ga0163163_100405144 | 305 |
| 692 | 3300014325 | Ga0163163_10152034 | Ga0163163_101520342 | 305 |
| 693 | 3300014968 | Ga0157379_10469430 | Ga0157379_104694301 | 305 |
| 694 | 3300014969 | Ga0157376_10354898 | Ga0157376_103548982 | 305 |
| 695 | 3300014969 | Ga0157376_10525925 | Ga0157376_105259252 | 305 |
| 696 | 3300025900 | Ga0207710_10002412 | Ga0207710_100024122 | 305 |
| 697 | 3300025912 | Ga0207707_10007147 | Ga0207707_100071473 | 305 |
| 698 | 3300025913 | Ga0207695_10220905 | Ga0207695_102209051 | 305 |
| 699 | 3300025921 | Ga0207652_10078610 | Ga0207652_100786103 | 305 |
| 700 | 3300025926 | Ga0207659_10149339 | Ga0207659_101493392 | 305 |
| 701 | 3300025940 | Ga0207691_10093132 | Ga0207691_100931322 | 305 |
| 702 | 3300025941 | Ga0207711_10466262 | Ga0207711_104662621 | 305 |
| 703 | 3300025942 | Ga0207689_10025222 | Ga0207689_100252224 | 305 |
| 704 | 3300025961 | Ga0207712_10106426 | Ga0207712_101064262 | 305 |
| 705 | 3300025972 | Ga0207668_10118986 | Ga0207668_101189863 | 305 |
| 706 | 3300026035 | Ga0207703_10026240 | Ga0207703_100262404 | 305 |
| 707 | 3300026035 | Ga0207703_10033766 | Ga0207703_100337662 | 305 |
| 708 | 3300026088 | Ga0207641_10298302 | Ga0207641_102983022 | 305 |
| 709 | 3300026095 | Ga0207676_10120766 | Ga0207676_101207662 | 305 |
| 710 | 3300028381 | Ga0268264_10008000 | Ga0268264_100080005 | 305 |
| 711 | 3300028381 | Ga0268264_10025531 | Ga0268264_100255312 | 305 |
| 712 | 3300031548 | Ga0307408_100015360 | Ga0307408_1000153605 | 305 |
| 713 | 3300031852 | Ga0307410_10243692 | Ga0307410_102436922 | 305 |
| 714 | 3300031901 | Ga0307406_10104875 | Ga0307406_101048752 | 305 |
| 715 | 3300031995 | Ga0307409_100013621 | Ga0307409_1000136213 | 305 |
| 716 | 3300032005 | Ga0307411_10188687 | Ga0307411_101886871 | 305 |
| 717 | 3300032126 | Ga0307415_100139531 | Ga0307415_1001395313 | 305 |
| 718 | 3300035085 | Ga0373929_0000001 | Ga0373929_0000001_387525_388460 | 305 |
| 719 | 3300046616 | Ga0495668_0000277 | Ga0495668_0000277_45892_46821 | 305 |
| 720 | 3300048912 | Ga0496109_0022922 | Ga0496109_0022922_1011_1943 | 305 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF02882
THF_DHG_CYH_C
Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain
149
330
0.98
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3l07-assembly1.cif.gz_A | methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase, putative bifunctional protein fold from francisella tularensis. | 0.9654 | 2 | 303 |
| 2c2y-assembly1.cif.gz_A-2 | three dimensional structure of bifunctional methylenetetrahydrofolate dehydrogenase-cyclohydrolase from mycobacterium tuberculosis | 0.9653 | 3 | 302 |
| 4a5o-assembly2.cif.gz_D | crystal structure of pseudomonas aeruginosa n5, n10- methylenetetrahydrofolate dehydrogenase-cyclohydrolase (fold) | 0.9592 | 3 | 301 |
| 3l07-assembly1.cif.gz_A | methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase, putative bifunctional protein fold from francisella tularensis. | 0.9587 | 2 | 303 |
| 2c2y-assembly1.cif.gz_A-2 | three dimensional structure of bifunctional methylenetetrahydrofolate dehydrogenase-cyclohydrolase from mycobacterium tuberculosis | 0.9552 | 3 | 302 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q0E4G1_111_191_3.40.50.10860 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 | 0.9976 | 34 | 114 | 3.40.50.10860 |
| 3l07A02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 | 0.9911 | 34 | 115 | 3.40.50.10860 |
| af_A0A0R0F3H3_60_174_3.40.50.10860 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 | 0.9908 | 13 | 125 | 3.40.50.10860 |
| af_Q0E4G1_111_191_3.40.50.10860 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 | 0.9855 | 34 | 114 | 3.40.50.10860 |
| 4cjxA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 | 0.9849 | 31 | 115 | 3.40.50.10860 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6N6S1Z9-F1-model_v4 | methenyltetrahydrofolate cyclohydrolase (EC 3.5.4.9) | 0.9989 | 3 | 121 |
GO:0004477
GO:0004488 GO:0005829 GO:0006164 GO:0009086 GO:0035999 |
| AF-A0A2S8LSJ0-F1-model_v4 | deleted | 0.9981 | 40 | 122 |
|
| AF-A0A3C1LSI1-F1-model_v4 | Bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase | 0.9947 | 8 | 105 |
GO:0004477
GO:0004488 GO:0005829 GO:0006164 GO:0009086 GO:0035999 |
| AF-A0A353JZC0-F1-model_v4 | Bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase | 0.9923 | 1 | 107 |
GO:0000105
GO:0004477 GO:0004488 GO:0005829 GO:0006164 GO:0009086 GO:0035999 |
| AF-A0A382NA53-F1-model_v4 | methenyltetrahydrofolate cyclohydrolase (EC 3.5.4.9) | 0.992 | 1 | 109 |
GO:0004477
GO:0004488 GO:0005829 GO:0035999 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar