F477304

General Info

Members Datasets Scaffolds Average Seq Length
720 325 677 298

Family's Representative Sequence

Representative Sequence 3300021384|Ga0213876_10071368|Ga0213876_100713683
Length 336
Sequence MWTPSDIAAFGRPAEKIVPLCYPHSYMSGTVLDGKKVSREIRDELRPRIDALRSNKRAPALAVVLVGDNPASQIYVRNKIKACQELGIRSIELRPAQDITTEQLLEQISPLNRDSDVDGILIQMPLPKQIDVNTLNLHLDPMRDVDGFSAYSLGRLVRNEPAPRACTPAGIMELLKRYQISIAGRRAVVVGRSDIVGKPIALMLLHENATVTICHSKTRDLAGECRRADILIAAMGRPAAITADYIKPGAVVVDVGVNRLTNEAEVVRLFPHDTGRLAGYAKNGSTLVGDVEPMAMQEISSAYTPVPGGVGPLTIAMLMANTVKLAEMRLLGKSAG

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2506783011 Frankia datiscae Dg1 Isolate Nodule
3 2508501039 Frankia saprophytica CN3 Isolate Nodule
4 2517572101 Frankia sp. DC12 Isolate Nodule
5 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
6 2527291627 Frankia casuarinae Thr Isolate Nodule
7 2527291629 Frankia sp. BMG5.23 Isolate Nodule
8 2546825537 Frankia sp. CcI6 Isolate Rhizoplane
9 2576861822 Frankia sp. CeD Isolate Nodule
10 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
11 2619618881 Frankia sp. ACN1ag Isolate Unclassified
12 2619619003 Frankia sp. CpI1-P Isolate Nodule
13 2626541554 Frankia sp. AvcI.1 Isolate Nodule
14 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
15 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
16 2684623036 Frankia sp. CgIM4 Isolate Nodule
17 2687453737 Frankia sp. BMG5.36 Isolate Nodule
18 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
19 2710264753 Frankia sp. KB5 Isolate Nodule
20 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
21 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
22 2744054657 Brevibacillus sp. SKDU10 Isolate Unclassified
23 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
24 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
25 2773857924 Frankia sp. CgIS1 Isolate Nodule
26 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
27 2816332336 Brevibacillus laterosporus ZQ2 Isolate Unclassified
28 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
29 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
30 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
31 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
32 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
33 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
34 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
35 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
36 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
37 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
38 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
40 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
41 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
42 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
43 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
44 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
45 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
46 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
47 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
48 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
49 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
50 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
51 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
52 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
53 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
54 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
55 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
56 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
57 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
58 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
59 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
60 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
61 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
62 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
63 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
64 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
65 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
66 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
67 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
68 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
69 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
70 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
71 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
72 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
73 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
74 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
75 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
76 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
77 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
78 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
79 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
80 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
81 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
82 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
83 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
84 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
85 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
86 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
87 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
88 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
89 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
90 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
91 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
92 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
93 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
94 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
95 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
96 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
98 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
99 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
100 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
101 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
102 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
103 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
104 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
105 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
106 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
107 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
108 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
109 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
110 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
111 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
112 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
113 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
114 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
115 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
116 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
117 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
118 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
119 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
120 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
121 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
122 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
123 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
124 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
125 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
126 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
127 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
128 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
129 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
130 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
131 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
132 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
133 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
134 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
135 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
136 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
137 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
138 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
141 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
183 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
187 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
188 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
189 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
190 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
191 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
192 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
193 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
194 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
195 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
196 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
197 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
198 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
199 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
200 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
201 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
202 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
203 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
204 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
205 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
206 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
207 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
208 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
209 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
210 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
211 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
212 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
213 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
214 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
215 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
216 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
217 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
218 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
219 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
220 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
221 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
222 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
223 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
224 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
225 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
226 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
227 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
228 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
229 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
230 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
231 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
232 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
233 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
234 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
235 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
236 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
237 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
238 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
239 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
240 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
241 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
242 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
243 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
244 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
245 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
246 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
247 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
248 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
249 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
250 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
251 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
252 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
253 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
254 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
255 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
256 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
257 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
258 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
259 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
260 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
261 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
262 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
263 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
264 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
265 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
266 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
267 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
268 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
269 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
270 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
271 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
272 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
273 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
274 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
275 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
276 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
277 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
278 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
279 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
280 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
281 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
282 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
290 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
291 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
292 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
293 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
294 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
295 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
296 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
297 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
298 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
299 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
300 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
301 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
302 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
303 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
304 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
305 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
306 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
307 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
308 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
309 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
310 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
311 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
312 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
313 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
314 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
315 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
316 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
317 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
318 637000116 Frankia casuarinae CcI3 Isolate Nodule
319 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
320 8002775197 Frankia nepalensis CN7 Isolate Nodule
321 8002784119 Frankia sp. AgB1.9 Isolate Nodule
322 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
323 8054920844 Frankia tisae Agncl-8 Isolate Nodule
324 8057473075 Paenibacillus endoradicis T3-5-0-4 Isolate Unclassified
325 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.03
Metatranscriptomes 0
Isolates 5.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.56
Nodule 2.78
Rhizoplane 3.47
Rhizosphere 81.53
Stem 0
Stem Tuber 0
Unclassified 11.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_2607737 2162886012 Bacteria 1941
2 LJQas_1000007 3300000549 Bacteria 31319
3 JGI25406J46586_10031864 3300003203 Bacteria 1966
4 Ga0055541_1006232 3300003841 Bacteria 2034
5 Ga0065704_10093027 3300005289 Bacteria 2621
6 Ga0065715_10124535 3300005293 Bacteria 2152
7 Ga0070658_10017385 3300005327 Bacteria 5754
8 Ga0070658_10169684 3300005327 Bacteria 1833
9 Ga0070683_100013341 3300005329 Bacteria 7164
10 Ga0070683_100018105 3300005329 Bacteria 6234
11 Ga0070683_100046079 3300005329 Bacteria 4026
12 Ga0070683_100263147 3300005329 Bacteria 1641
13 Ga0070690_100053341 3300005330 Unclassified 2587
14 Ga0070690_100386479 3300005330 Bacteria 1024
15 Ga0068869_100023139 3300005334 Bacteria 4287
16 Ga0070680_100009354 3300005336 Bacteria 7528
17 Ga0070680_100010904 3300005336 Bacteria 7022
18 Ga0070680_100038161 3300005336 Unclassified 3884
19 Ga0070680_100307333 3300005336 Bacteria 1345
20 Ga0068868_100002275 3300005338 Bacteria 13264
21 Ga0070660_100034314 3300005339 Bacteria 3832
22 Ga0070660_100167511 3300005339 Bacteria 1773
23 Ga0070689_100034718 3300005340 Bacteria 3848
24 Ga0070691_10017606 3300005341 Bacteria 3288
25 Ga0070661_100013004 3300005344 Bacteria 5834
26 Ga0070661_100026126 3300005344 Bacteria 4197
27 Ga0070661_100115847 3300005344 Bacteria 2004
28 Ga0070661_100286029 3300005344 Unclassified 1280
29 Ga0070668_100049194 3300005347 Bacteria 3244
30 Ga0070675_100155155 3300005354 Bacteria 1965
31 Ga0070671_100312434 3300005355 Bacteria 1339
32 Ga0070674_100020577 3300005356 Bacteria 4219
33 Ga0070659_100083707 3300005366 Bacteria 2550
34 Ga0070709_10106829 3300005434 Bacteria 1875
35 Ga0070709_10127394 3300005434 Bacteria 1734
36 Ga0070709_10301612 3300005434 Bacteria 1170
37 Ga0070713_100093866 3300005436 Bacteria 2586
38 Ga0070713_100147555 3300005436 Bacteria 2089
39 Ga0070713_100211971 3300005436 Bacteria 1754
40 Ga0070711_100030940 3300005439 Bacteria 3549
41 Ga0070711_100242037 3300005439 Unclassified 1411
42 Ga0070711_100277359 3300005439 Bacteria 1325
43 Ga0070700_100403488 3300005441 Bacteria 1028
44 Ga0070694_100037348 3300005444 Bacteria 3222
45 Ga0070708_100015506 3300005445 Bacteria 6298
46 Ga0070708_100081034 3300005445 Bacteria 2938
47 Ga0070678_100179288 3300005456 Bacteria 1733
48 Ga0070678_100219297 3300005456 Bacteria 1580
49 Ga0070681_10000605 3300005458 Bacteria 29575
50 Ga0070681_10005377 3300005458 Bacteria 12369
51 Ga0070681_10034973 3300005458 Bacteria 5046
52 Ga0070681_10043027 3300005458 Bacteria 4525
53 Ga0070681_10150205 3300005458 Bacteria 2256
54 Ga0070681_10213804 3300005458 Bacteria 1844
55 Ga0070706_100027585 3300005467 Bacteria 5226
56 Ga0070707_100089736 3300005468 Bacteria 2975
57 Ga0070707_100156247 3300005468 Bacteria 2222
58 Ga0070707_100294931 3300005468 Bacteria 1576
59 Ga0070699_100024627 3300005518 Bacteria 5188
60 Ga0070699_100208234 3300005518 Bacteria 1740
61 Ga0070679_100005804 3300005530 Bacteria 11455
62 Ga0070679_100009024 3300005530 Bacteria 9406
63 Ga0070679_100140602 3300005530 Bacteria 2394
64 Ga0070679_100170443 3300005530 Unclassified 2150
65 Ga0070684_100002114 3300005535 Bacteria 14642
66 Ga0070684_100022521 3300005535 Bacteria 5257
67 Ga0070684_100249089 3300005535 Unclassified 1624
68 Ga0070697_100036073 3300005536 Bacteria 3993
69 Ga0070697_100037641 3300005536 Bacteria 3908
70 Ga0070697_100046586 3300005536 Bacteria 3514
71 Ga0068853_100038145 3300005539 Bacteria 4091
72 Ga0068853_100081151 3300005539 Bacteria 2839
73 Ga0068853_100314152 3300005539 Bacteria 1451
74 Ga0070672_100246532 3300005543 Bacteria 1504
75 Ga0070686_100071878 3300005544 Bacteria 2267
76 Ga0070695_100016987 3300005545 Bacteria 4412
77 Ga0070695_100026911 3300005545 Bacteria 3560
78 Ga0070695_100060897 3300005545 Bacteria 2447
79 Ga0070696_100040063 3300005546 Bacteria 3235
80 Ga0070693_100006824 3300005547 Bacteria 5548
81 Ga0070665_100048003 3300005548 Bacteria 4286
82 Ga0070665_100175928 3300005548 Bacteria 2141
83 Ga0070665_100238239 3300005548 Bacteria 1820
84 Ga0070704_100248779 3300005549 Bacteria 1459
85 Ga0068855_100004587 3300005563 Bacteria 16867
86 Ga0068855_100007492 3300005563 Bacteria 13215
87 Ga0068855_100049900 3300005563 Bacteria 4934
88 Ga0068855_100058864 3300005563 Bacteria 4497
89 Ga0068855_100085120 3300005563 Bacteria 3659
90 Ga0068855_100093880 3300005563 Unclassified 3460
91 Ga0068855_100095978 3300005563 Bacteria 3417
92 Ga0068855_100189752 3300005563 Bacteria 2319
93 Ga0070664_100176442 3300005564 Bacteria 1897
94 Ga0070664_100309057 3300005564 Bacteria 1430
95 Ga0070664_100336510 3300005564 Bacteria 1370
96 Ga0068857_100003819 3300005577 Bacteria 12677
97 Ga0068857_100007396 3300005577 Bacteria 9457
98 Ga0068854_100142677 3300005578 Bacteria 1839
99 Ga0068856_100010972 3300005614 Bacteria 8796
100 Ga0068856_100022526 3300005614 Bacteria 6125
101 Ga0068856_100027489 3300005614 Bacteria 5550
102 Ga0068856_100036394 3300005614 Bacteria 4826
103 Ga0068856_100040539 3300005614 Bacteria 4575
104 Ga0068856_100086445 3300005614 Bacteria 3116
105 Ga0068856_100118059 3300005614 Bacteria 2654
106 Ga0068856_100125226 3300005614 Unclassified 2573
107 Ga0068856_100218103 3300005614 Bacteria 1923
108 Ga0068852_100210130 3300005616 Bacteria 1846
109 Ga0068852_100264604 3300005616 Bacteria 1652
110 Ga0068852_100284848 3300005616 Bacteria 1594
111 Ga0068859_100000054 3300005617 Bacteria 123173
112 Ga0068859_100001223 3300005617 Bacteria 26205
113 Ga0068859_100024538 3300005617 Bacteria 6049
114 Ga0068859_100043795 3300005617 Bacteria 4498
115 Ga0068859_100058013 3300005617 Bacteria 3899
116 Ga0068859_100281892 3300005617 Bacteria 1755
117 Ga0068864_100020562 3300005618 Bacteria 5522
118 Ga0068864_100129878 3300005618 Bacteria 2262
119 Ga0068864_100225252 3300005618 Unclassified 1732
120 Ga0068861_100301950 3300005719 Bacteria 1387
121 Ga0068863_100419081 3300005841 Bacteria 1311
122 Ga0068863_100474461 3300005841 Bacteria 1229
123 Ga0068858_100005980 3300005842 Bacteria 11883
124 Ga0068858_100068750 3300005842 Unclassified 3282
125 Ga0068858_100072117 3300005842 Bacteria 3204
126 Ga0068858_100073980 3300005842 Bacteria 3163
127 Ga0068858_100129946 3300005842 Bacteria 2361
128 Ga0068858_100147216 3300005842 Bacteria 2212
129 Ga0068858_100272745 3300005842 Bacteria 1610
130 Ga0068860_100030585 3300005843 Bacteria 5178
131 Ga0068862_100000037 3300005844 Bacteria 172796
132 Ga0068862_100265430 3300005844 Unclassified 1568
133 Ga0081455_10007431 3300005937 Bacteria 11544
134 Ga0081455_10027970 3300005937 Bacteria 5157
135 Ga0081455_10133534 3300005937 Bacteria 1937
136 Ga0081539_10001047 3300005985 Bacteria 50655
137 Ga0081539_10008121 3300005985 Bacteria 9270
138 Ga0070717_10023812 3300006028 Bacteria 4857
139 Ga0070717_10451066 3300006028 Bacteria 1159
140 Ga0070712_100162944 3300006175 Bacteria 1723
141 Ga0070712_100310671 3300006175 Archaea 1279
142 Ga0097621_100012173 3300006237 Bacteria 6367
143 Ga0097621_100059860 3300006237 Bacteria 3120
144 Ga0097621_100454928 3300006237 Bacteria 1154
145 Ga0097621_100456789 3300006237 Bacteria 1151
146 Ga0097621_100629932 3300006237 Bacteria 982
147 Ga0068871_100005987 3300006358 Bacteria 8558
148 Ga0068871_100043122 3300006358 Unclassified 3624
149 Ga0068871_100262525 3300006358 Bacteria 1507
150 Ga0068871_100275505 3300006358 Bacteria 1470
151 Ga0068871_100503766 3300006358 Bacteria 1092
152 Ga0075428_100005577 3300006844 Bacteria 13988
153 Ga0075430_100013130 3300006846 Bacteria 7057
154 Ga0075431_100045761 3300006847 Bacteria 4511
155 Ga0075433_10003719 3300006852 Bacteria 11807
156 Ga0075434_100000069 3300006871 Bacteria 53659
157 Ga0075434_100319193 3300006871 Bacteria 1574
158 Ga0068865_100030146 3300006881 Bacteria 3605
159 Ga0075436_100007970 3300006914 Bacteria 7254
160 Ga0075436_100016687 3300006914 Bacteria 5026
161 Ga0097620_100000054 3300006931 Bacteria 123173
162 Ga0097620_100001223 3300006931 Bacteria 26205
163 Ga0097620_100024538 3300006931 Bacteria 6049
164 Ga0097620_100043791 3300006931 Bacteria 4498
165 Ga0097620_100058013 3300006931 Bacteria 3899
166 Ga0097620_100281880 3300006931 Bacteria 1755
167 Ga0075435_100106627 3300007076 Bacteria 2327
168 Ga0075435_100116985 3300007076 Archaea 2221
169 Ga0099794_10069567 3300007265 Bacteria 1722
170 Ga0105240_10003303 3300009093 Bacteria 25212
171 Ga0105240_10003832 3300009093 Bacteria 23257
172 Ga0105240_10013706 3300009093 Bacteria 11109
173 Ga0105240_10037802 3300009093 Bacteria 6199
174 Ga0105240_10063307 3300009093 Bacteria 4602
175 Ga0105240_10084091 3300009093 Bacteria 3902
176 Ga0105240_10156934 3300009093 Bacteria 2705
177 Ga0105240_10664710 3300009093 Bacteria 1140
178 Ga0105240_10716684 3300009093 Bacteria 1091
179 Ga0111539_10077847 3300009094 Bacteria 3902
180 Ga0111539_10263308 3300009094 Bacteria 2007
181 Ga0111539_10340307 3300009094 Bacteria 1746
182 Ga0105245_10002254 3300009098 Bacteria 17460
183 Ga0105245_10061145 3300009098 Bacteria 3394
184 Ga0105245_10107928 3300009098 Bacteria 2585
185 Ga0105245_10157114 3300009098 Bacteria 2155
186 Ga0105245_10262345 3300009098 Bacteria 1682
187 Ga0105247_10000125 3300009101 Bacteria 74220
188 Ga0105247_10005102 3300009101 Bacteria 8317
189 Ga0105247_10071278 3300009101 Bacteria 2173
190 Ga0114129_10299524 3300009147 Bacteria 2144
191 Ga0114129_10333590 3300009147 Bacteria 2013
192 Ga0105243_10090788 3300009148 Bacteria 2514
193 Ga0105241_10008535 3300009174 Bacteria 7534
194 Ga0105241_10045243 3300009174 Unclassified 3339
195 Ga0105241_10138018 3300009174 Bacteria 1982
196 Ga0105242_10013866 3300009176 Bacteria 6235
197 Ga0105248_10000018 3300009177 Bacteria 294894
198 Ga0105248_10003078 3300009177 Bacteria 18491
199 Ga0105248_10045759 3300009177 Bacteria 4906
200 Ga0105248_10054531 3300009177 Bacteria 4483
201 Ga0105248_10085631 3300009177 Bacteria 3546
202 Ga0105248_10107131 3300009177 Bacteria 3151
203 Ga0105248_10232588 3300009177 Bacteria 2075
204 Ga0105248_10239066 3300009177 Bacteria 2044
205 Ga0105248_10332995 3300009177 Unclassified 1710
206 Ga0105237_10000223 3300009545 Bacteria 79892
207 Ga0105237_10021372 3300009545 Bacteria 6653
208 Ga0105237_10046509 3300009545 Bacteria 4365
209 Ga0105237_10077423 3300009545 Bacteria 3315
210 Ga0105237_10110999 3300009545 Bacteria 2734
211 Ga0105237_10173473 3300009545 Bacteria 2156
212 Ga0105237_10457109 3300009545 Bacteria 1283
213 Ga0105238_10008033 3300009551 Bacteria 10557
214 Ga0105238_10008204 3300009551 Bacteria 10447
215 Ga0105238_10011819 3300009551 Bacteria 8795
216 Ga0105238_10018386 3300009551 Bacteria 7114
217 Ga0105238_10062169 3300009551 Bacteria 3735
218 Ga0105238_10063942 3300009551 Bacteria 3680
219 Ga0105238_10118213 3300009551 Bacteria 2631
220 Ga0105249_10089219 3300009553 Bacteria 2881
221 Ga0105249_10134884 3300009553 Bacteria 2361
222 Ga0105249_10150578 3300009553 Bacteria 2240
223 Ga0105249_10237101 3300009553 Bacteria 1802
224 Ga0105239_10006113 3300010375 Bacteria 14019
225 Ga0105239_10018215 3300010375 Bacteria 7763
226 Ga0105239_10019814 3300010375 Bacteria 7424
227 Ga0105239_10020900 3300010375 Bacteria 7222
228 Ga0105239_10226136 3300010375 Unclassified 2099
229 Ga0105239_10242934 3300010375 Bacteria 2021
230 Ga0105246_10190773 3300011119 Bacteria 1586
231 Ga0157370_10005991 3300013104 Bacteria 13531
232 Ga0157370_10006307 3300013104 Bacteria 13104
233 Ga0157370_10016399 3300013104 Bacteria 7499
234 Ga0157370_10040560 3300013104 Bacteria 4495
235 Ga0157370_10057435 3300013104 Bacteria 3700
236 Ga0157370_10065457 3300013104 Bacteria 3439
237 Ga0157369_10008782 3300013105 Bacteria 11578
238 Ga0157369_10012845 3300013105 Bacteria 9495
239 Ga0157369_10013263 3300013105 Bacteria 9324
240 Ga0157369_10016965 3300013105 Bacteria 8182
241 Ga0157369_10063670 3300013105 Bacteria 3973
242 Ga0157369_10112426 3300013105 Bacteria 2893
243 Ga0157369_10152686 3300013105 Bacteria 2441
244 Ga0157369_10204804 3300013105 Unclassified 2070
245 Ga0157374_10012136 3300013296 Bacteria 7484
246 Ga0157374_10067061 3300013296 Bacteria 3373
247 Ga0157374_10258466 3300013296 Bacteria 1715
248 Ga0157374_10303284 3300013296 Bacteria 1580
249 Ga0157378_10054675 3300013297 Bacteria 3554
250 Ga0157378_10166445 3300013297 Bacteria 2065
251 Ga0157378_10184073 3300013297 Bacteria 1966
252 Ga0157378_10365856 3300013297 Bacteria 1412
253 Ga0163162_10013500 3300013306 Bacteria 7974
254 Ga0163162_10086353 3300013306 Bacteria 3215
255 Ga0163162_10124049 3300013306 Unclassified 2688
256 Ga0163162_10209761 3300013306 Bacteria 2077
257 Ga0163162_10258956 3300013306 Unclassified 1871
258 Ga0163162_10512574 3300013306 Bacteria 1329
259 Ga0163162_10799954 3300013306 Bacteria 1060
260 Ga0157372_10007318 3300013307 Bacteria 11750
261 Ga0157372_10020322 3300013307 Bacteria 7162
262 Ga0157372_10057171 3300013307 Bacteria 4360
263 Ga0157372_10118462 3300013307 Bacteria 3038
264 Ga0157372_10374825 3300013307 Bacteria 1658
265 Ga0157372_10665210 3300013307 Bacteria 1213
266 Ga0157375_10005690 3300013308 Bacteria 10846
267 Ga0157375_10159781 3300013308 Bacteria 2395
268 Ga0157375_10249317 3300013308 Bacteria 1936
269 Ga0157375_10327530 3300013308 Bacteria 1697
270 Ga0157375_10700022 3300013308 Bacteria 1167
271 Ga0163163_10002598 3300014325 Bacteria 15306
272 Ga0163163_10018126 3300014325 Bacteria 6581
273 Ga0163163_10040514 3300014325 Bacteria 4549
274 Ga0163163_10043155 3300014325 Bacteria 4420
275 Ga0163163_10152034 3300014325 Bacteria 2358
276 Ga0163163_10266364 3300014325 Bacteria 1765
277 Ga0163163_10451920 3300014325 Bacteria 1345
278 Ga0163163_10511951 3300014325 Bacteria 1262
279 Ga0163163_10875955 3300014325 Bacteria 961
280 Ga0182008_10078939 3300014497 Bacteria 1619
281 Ga0182008_10080883 3300014497 Bacteria 1599
282 Ga0157379_10050360 3300014968 Bacteria 3718
283 Ga0157379_10065070 3300014968 Bacteria 3259
284 Ga0157379_10269986 3300014968 Bacteria 1547
285 Ga0157379_10469430 3300014968 Bacteria 1164
286 Ga0157376_10096022 3300014969 Bacteria 2579
287 Ga0157376_10182786 3300014969 Unclassified 1918
288 Ga0157376_10354898 3300014969 Bacteria 1404
289 Ga0157376_10525925 3300014969 Bacteria 1166
290 Ga0182006_1057686 3300015261 Bacteria 1475
291 Ga0213872_10000182 3300021361 Bacteria 56427
292 Ga0213874_10011049 3300021377 Unclassified 2277
293 Ga0213874_10061087 3300021377 Bacteria 1180
294 Ga0213876_10003589 3300021384 Bacteria 8828
295 Ga0213876_10014097 3300021384 Bacteria 4238
296 Ga0213876_10025225 3300021384 Bacteria 3137
297 Ga0213876_10071368 3300021384 Bacteria 1834
298 Ga0213875_10000019 3300021388 Bacteria 231333
299 Ga0213875_10000109 3300021388 Bacteria 94035
300 Ga0213875_10000137 3300021388 Bacteria 80801
301 Ga0213875_10001103 3300021388 Bacteria 18734
302 Ga0213875_10003448 3300021388 Bacteria 9003
303 Ga0213875_10059306 3300021388 Bacteria 1791
304 Ga0213875_10091566 3300021388 Bacteria 1418
305 Ga0213875_10092868 3300021388 Bacteria 1407
306 Ga0209566_100108 3300025225 Bacteria 119382
307 Ga0209675_1030371 3300025291 Bacteria 1290
308 Ga0209025_1004716 3300025294 Bacteria 11631
309 Ga0207656_10029760 3300025321 Bacteria 2252
310 Ga0207710_10000149 3300025900 Bacteria 79810
311 Ga0207710_10002412 3300025900 Bacteria 8707
312 Ga0207680_10044635 3300025903 Bacteria 2608
313 Ga0207647_10206988 3300025904 Bacteria 1134
314 Ga0207705_10047594 3300025909 Bacteria 3084
315 Ga0207705_10067567 3300025909 Bacteria 2587
316 Ga0207684_10071762 3300025910 Bacteria 2942
317 Ga0207684_10127316 3300025910 Bacteria 2186
318 Ga0207684_10220381 3300025910 Bacteria 1637
319 Ga0207654_10078752 3300025911 Bacteria 1978
320 Ga0207707_10000372 3300025912 Bacteria 47046
321 Ga0207707_10007147 3300025912 Bacteria 9721
322 Ga0207707_10007166 3300025912 Bacteria 9705
323 Ga0207707_10057693 3300025912 Bacteria 3379
324 Ga0207707_10060292 3300025912 Bacteria 3301
325 Ga0207707_10248489 3300025912 Bacteria 1545
326 Ga0207707_10292634 3300025912 Unclassified 1409
327 Ga0207695_10000563 3300025913 Bacteria 76084
328 Ga0207695_10001447 3300025913 Bacteria 39719
329 Ga0207695_10008730 3300025913 Bacteria 12638
330 Ga0207695_10016938 3300025913 Bacteria 8503
331 Ga0207695_10035763 3300025913 Bacteria 5380
332 Ga0207695_10220905 3300025913 Bacteria 1802
333 Ga0207695_10305061 3300025913 Bacteria 1483
334 Ga0207671_10000256 3300025914 Bacteria 79879
335 Ga0207660_10023863 3300025917 Unclassified 4135
336 Ga0207660_10052210 3300025917 Bacteria 2910
337 Ga0207660_10087896 3300025917 Bacteria 2297
338 Ga0207660_10390683 3300025917 Bacteria 1119
339 Ga0207657_10008514 3300025919 Bacteria 10401
340 Ga0207657_10022801 3300025919 Bacteria 5846
341 Ga0207657_10141762 3300025919 Bacteria 1963
342 Ga0207652_10008525 3300025921 Bacteria 8251
343 Ga0207652_10009178 3300025921 Bacteria 7960
344 Ga0207652_10078610 3300025921 Bacteria 2881
345 Ga0207652_10111378 3300025921 Bacteria 2427
346 Ga0207652_10447328 3300025921 Bacteria 1165
347 Ga0207646_10000447 3300025922 Bacteria 55120
348 Ga0207694_10002271 3300025924 Bacteria 15729
349 Ga0207694_10003426 3300025924 Bacteria 12624
350 Ga0207694_10009451 3300025924 Bacteria 7349
351 Ga0207694_10051476 3300025924 Bacteria 3192
352 Ga0207694_10096390 3300025924 Bacteria 2339
353 Ga0207694_10151685 3300025924 Bacteria 1867
354 Ga0207694_10192305 3300025924 Bacteria 1658
355 Ga0207659_10149339 3300025926 Bacteria 1823
356 Ga0207687_10023621 3300025927 Bacteria 4101
357 Ga0207687_10025790 3300025927 Bacteria 3934
358 Ga0207687_10174634 3300025927 Bacteria 1660
359 Ga0207687_10355395 3300025927 Bacteria 1195
360 Ga0207700_10108197 3300025928 Bacteria 2232
361 Ga0207700_10123466 3300025928 Bacteria 2103
362 Ga0207644_10013253 3300025931 Bacteria 5493
363 Ga0207709_10060594 3300025935 Bacteria 2360
364 Ga0207704_10162165 3300025938 Bacteria 1592
365 Ga0207691_10093132 3300025940 Bacteria 2698
366 Ga0207711_10000062 3300025941 Bacteria 125048
367 Ga0207711_10003507 3300025941 Bacteria 13580
368 Ga0207711_10048173 3300025941 Bacteria 3646
369 Ga0207711_10274577 3300025941 Bacteria 1551
370 Ga0207711_10466262 3300025941 Bacteria 1176
371 Ga0207689_10025222 3300025942 Bacteria 4984
372 Ga0207689_10197476 3300025942 Bacteria 1660
373 Ga0207661_10028768 3300025944 Bacteria 4260
374 Ga0207661_10031447 3300025944 Bacteria 4100
375 Ga0207661_10131306 3300025944 Bacteria 2145
376 Ga0207661_10309717 3300025944 Bacteria 1417
377 Ga0207661_10543208 3300025944 Bacteria 1064
378 Ga0207667_10001746 3300025949 Bacteria 27378
379 Ga0207667_10015000 3300025949 Bacteria 8814
380 Ga0207667_10021589 3300025949 Bacteria 7132
381 Ga0207667_10039308 3300025949 Bacteria 5044
382 Ga0207667_10050214 3300025949 Bacteria 4402
383 Ga0207667_10140890 3300025949 Bacteria 2483
384 Ga0207712_10106426 3300025961 Bacteria 2095
385 Ga0207668_10030442 3300025972 Bacteria 3547
386 Ga0207668_10118986 3300025972 Bacteria 1997
387 Ga0207677_10003453 3300026023 Bacteria 8374
388 Ga0207677_10162637 3300026023 Bacteria 1736
389 Ga0207703_10010141 3300026035 Bacteria 7385
390 Ga0207703_10012257 3300026035 Bacteria 6685
391 Ga0207703_10026240 3300026035 Unclassified 4584
392 Ga0207703_10033766 3300026035 Unclassified 4058
393 Ga0207703_10045889 3300026035 Bacteria 3516
394 Ga0207703_10054895 3300026035 Bacteria 3241
395 Ga0207703_10080867 3300026035 Bacteria 2707
396 Ga0207639_10035103 3300026041 Bacteria 3709
397 Ga0207678_10274679 3300026067 Unclassified 1446
398 Ga0207708_10190444 3300026075 Bacteria 1632
399 Ga0207702_10003891 3300026078 Bacteria 13446
400 Ga0207702_10045510 3300026078 Bacteria 3691
401 Ga0207702_10067007 3300026078 Unclassified 3080
402 Ga0207702_10153726 3300026078 Bacteria 2095
403 Ga0207641_10298302 3300026088 Bacteria 1521
404 Ga0207676_10015283 3300026095 Bacteria 5536
405 Ga0207676_10018647 3300026095 Bacteria 5050
406 Ga0207676_10120766 3300026095 Bacteria 2209
407 Ga0207674_10000503 3300026116 Bacteria 51625
408 Ga0207674_10002123 3300026116 Bacteria 25062
409 Ga0207674_10006162 3300026116 Bacteria 14164
410 Ga0207675_100352431 3300026118 Bacteria 1443
411 Ga0207683_10240206 3300026121 Bacteria 1652
412 Ga0207683_10461022 3300026121 Unclassified 1172
413 Ga0207698_10013952 3300026142 Bacteria 5322
414 Ga0207698_10015980 3300026142 Bacteria 5047
415 Ga0207698_10618425 3300026142 Bacteria 1070
416 Ga0209974_10016501 3300027876 Bacteria 2453
417 Ga0207428_10002460 3300027907 Bacteria 18500
418 Ga0268266_10003198 3300028379 Bacteria 16572
419 Ga0268266_10204867 3300028379 Unclassified 1807
420 Ga0268266_10228066 3300028379 Bacteria 1715
421 Ga0268266_10422514 3300028379 Bacteria 1263
422 Ga0268265_10000008 3300028380 Bacteria 417328
423 Ga0268264_10008000 3300028381 Bacteria 8793
424 Ga0268264_10025531 3300028381 Unclassified 4828
425 Ga0265338_10001562 3300028800 Bacteria 36957
426 Ga0265338_10056535 3300028800 Bacteria 3479
427 Ga0265338_10241884 3300028800 Bacteria 1336
428 Ga0265330_10004925 3300031235 Bacteria 6725
429 Ga0265330_10007010 3300031235 Bacteria 5531
430 Ga0265330_10022903 3300031235 Bacteria 2839
431 Ga0265330_10038588 3300031235 Bacteria 2123
432 Ga0265325_10041187 3300031241 Bacteria 2421
433 Ga0265329_10030458 3300031242 Bacteria 1758
434 Ga0265339_10000166 3300031249 Bacteria 55317
435 Ga0265339_10021965 3300031249 Bacteria 3703
436 Ga0265331_10007181 3300031250 Bacteria 6476
437 Ga0265316_10001544 3300031344 Bacteria 24695
438 Ga0265316_10004170 3300031344 Bacteria 14449
439 Ga0265316_10013362 3300031344 Bacteria 7297
440 Ga0265316_10116486 3300031344 Bacteria 2020
441 Ga0265316_10174139 3300031344 Bacteria 1604
442 Ga0307408_100015360 3300031548 Bacteria 5097
443 Ga0265313_10003840 3300031595 Bacteria 11854
444 Ga0265313_10008990 3300031595 Bacteria 6552
445 Ga0265314_10237486 3300031711 Bacteria 1053
446 Ga0265342_10004295 3300031712 Bacteria 11284
447 Ga0265342_10055883 3300031712 Bacteria 2342
448 Ga0316576_10010783 3300031727 Bacteria 5953
449 Ga0307410_10243692 3300031852 Bacteria 1394
450 Ga0307406_10104875 3300031901 Bacteria 1933
451 Ga0307406_10173181 3300031901 Bacteria 1564
452 Ga0307409_100013621 3300031995 Bacteria 5246
453 Ga0307411_10023799 3300032005 Bacteria 3637
454 Ga0307411_10188687 3300032005 Bacteria 1572
455 Ga0307415_100139531 3300032126 Bacteria 1849
456 Ga0373929_0000001 3300035085 Bacteria 956023
457 Ga0373934_0013316 3300035086 Bacteria 3108
458 Ga0373936_0021787 3300035113 Bacteria 2493
459 Ga0373954_0099487 3300035118 Bacteria 1402
460 Ga0373954_0136727 3300035118 Bacteria 1194
461 Ga0373956_0007033 3300035119 Bacteria 4525
462 Ga0373957_0030295 3300035120 Bacteria 1982
463 Ga0373957_0096527 3300035120 Bacteria 1180
464 Ga0373943_0021984 3300035170 Bacteria 2950
465 Ga0373943_0304227 3300035170 Unclassified 906
466 Ga0373946_0061604 3300035171 Bacteria 1598
467 Ga0373955_0043801 3300035172 Bacteria 2408
468 Ga0373955_0132194 3300035172 Bacteria 1457
469 Ga0316574_0007195 3300035398 Bacteria 6082
470 Ga0373935_0200642 3300035692 Bacteria 1378
471 Ga0373935_0239424 3300035692 Unclassified 1266
472 Ga0373927_0001504 3300035695 Bacteria 17541
473 Ga0373927_0006461 3300035695 Bacteria 7985
474 Ga0373927_0007949 3300035695 Bacteria 7161
475 Ga0373933_0009825 3300035724 Bacteria 5237
476 Ga0373947_0000236 3300035725 Bacteria 31165
477 Ga0373947_0104728 3300035725 Unclassified 1782
478 Ga0373947_0153208 3300035725 Bacteria 1486
479 Ga0373947_0185495 3300035725 Bacteria 1356
480 Ga0373937_0007488 3300036401 Bacteria 9448
481 Ga0373937_0029905 3300036401 Unclassified 4934
482 Ga0373937_0052871 3300036401 Bacteria 3726
483 Ga0373937_0063437 3300036401 Bacteria 3398
484 Ga0373937_0127978 3300036401 Bacteria 2370
485 Ga0373937_0323476 3300036401 Bacteria 1459
486 Ga0373937_0381349 3300036401 Bacteria 1337
487 Ga0373925_0000139 3300037068 Bacteria 77722
488 Ga0373925_0025741 3300037068 Bacteria 4302
489 Ga0373925_0094477 3300037068 Bacteria 2290
490 Ga0373925_0112771 3300037068 Bacteria 2102
491 Ga0373925_0654404 3300037068 Bacteria 866
492 Ga0395900_0334769 3300037418 Unclassified 1491
493 Ga0436364_0082088 3300037853 Bacteria 178031
494 Ga0436364_0096221 3300037853 Bacteria 10527
495 Ga0436364_0197022 3300037853 Bacteria 80312
496 Ga0436364_0199614 3300037853 Unclassified 2306
497 Ga0436364_0313932 3300037853 Bacteria 7755
498 Ga0436364_0366372 3300037853 Bacteria 231753
499 Ga0436364_0452996 3300037853 Bacteria 6077
500 Ga0436364_0472599 3300037853 Bacteria 2421
501 Ga0436364_1023107 3300037853 Bacteria 4470
502 Ga0436364_1046789 3300037853 Bacteria 1565
503 Ga0436364_1239453 3300037853 Bacteria 9049
504 Ga0436364_1247308 3300037853 Unclassified 2502
505 Ga0436364_1265083 3300037853 Bacteria 3197
506 Ga0436364_1326320 3300037853 Bacteria 13298
507 Ga0400483_130213 3300039062 Bacteria 38867
508 Ga0400483_164907 3300039062 Bacteria 38857
509 Ga0436365_0500041 3300039437 Bacteria 2754
510 Ga0436365_0586387 3300039437 Bacteria 1803
511 Ga0436365_1155152 3300039437 Bacteria 27379
512 Ga0436365_1532991 3300039437 Unclassified 1409
513 Ga0436365_1557740 3300039437 Bacteria 2674
514 Ga0436365_1806953 3300039437 Bacteria 11991
515 Ga0436365_1870226 3300039437 Unclassified 2652
516 Ga0436360_0212151 3300039438 Bacteria 1614
517 Ga0436361_0126076 3300039447 Bacteria 97470
518 Ga0436363_0052707 3300039450 Bacteria 4459
519 Ga0436363_0305072 3300039450 Bacteria 3553
520 Ga0436363_0647531 3300039450 Bacteria 1759
521 Ga0436363_1068053 3300039450 Unclassified 1723
522 Ga0436362_0471056 3300039453 Bacteria 3856
523 Ga0436362_0556739 3300039453 Bacteria 2633
524 Ga0436362_0890112 3300039453 Bacteria 1315
525 Ga0436362_0963183 3300039453 Unclassified 2394
526 Ga0439439_0000364 3300041406 Bacteria 7408
527 Ga0439433_0041527 3300041999 Bacteria 1071
528 Ga0439449_0000684 3300042007 Bacteria 12908
529 Ga0439462_0001458 3300042015 Bacteria 5275
530 Ga0450923_021441 3300042125 Bacteria 1260
531 Ga0451577_0553201 3300042876 Unclassified 1045
532 Ga0466961_0050872 3300044693 Bacteria 2646
533 Ga0466963_0003571 3300044694 Bacteria 8933
534 Ga0453684_0037846 3300044712 Bacteria 6614
535 Ga0453684_0061499 3300044712 Bacteria 4820
536 Ga0451576_0000417 3300045051 Bacteria 98902
537 Ga0451576_0140758 3300045051 Bacteria 2516
538 Ga0451576_0224788 3300045051 Bacteria 1960
539 Ga0451576_0659283 3300045051 Bacteria 1100
540 Ga0466967_0018179 3300045976 Bacteria 5610
541 Ga0495592_0041600 3300046454 Bacteria 3444
542 Ga0495592_0149165 3300046454 Bacteria 1619
543 Ga0495651_0059928 3300046462 Bacteria 2917
544 Ga0495651_0118703 3300046462 Bacteria 1946
545 Ga0495580_0004196 3300046472 Bacteria 12119
546 Ga0495580_0015979 3300046472 Bacteria 5646
547 Ga0495580_0026187 3300046472 Bacteria 4255
548 Ga0495580_0029946 3300046472 Bacteria 3946
549 Ga0495580_0048971 3300046472 Bacteria 2990
550 Ga0495580_0080968 3300046472 Bacteria 2263
551 Ga0495580_0114366 3300046472 Bacteria 1874
552 Ga0495580_0139981 3300046472 Bacteria 1677
553 Ga0495582_0076753 3300046473 Bacteria 1852
554 Ga0495582_0083217 3300046473 Bacteria 1778
555 Ga0495639_0064283 3300046475 Bacteria 1686
556 Ga0495664_0074207 3300046477 Bacteria 2035
557 Ga0495594_0017572 3300046499 Bacteria 3781
558 Ga0495628_0118358 3300046516 Unclassified 2034
559 Ga0495628_0529843 3300046516 Bacteria 848
560 Ga0495648_0199001 3300046524 Bacteria 1004
561 Ga0495652_0105876 3300046529 Bacteria 2272
562 Ga0495652_0129100 3300046529 Bacteria 2004
563 Ga0495665_0091083 3300046531 Bacteria 1602
564 Ga0495586_0096141 3300046535 Bacteria 1640
565 Ga0495586_0148444 3300046535 Bacteria 1318
566 Ga0495668_0000277 3300046616 Bacteria 71164
567 Ga0495634_0017369 3300046642 Bacteria 5135
568 Ga0495661_0072108 3300046665 Bacteria 2016
569 Ga0495623_0161155 3300046679 Unclassified 1318
570 Ga0495658_0399063 3300046683 Archaea 877
571 Ga0495624_0169747 3300046690 Unclassified 1331
572 Ga0495680_0107329 3300047322 Bacteria 2074
573 Ga0495675_0242017 3300047444 Bacteria 1086
574 Ga0495684_0223931 3300047471 Unclassified 1378
575 Ga0495602_0182331 3300048088 Bacteria 1618
576 Ga0495626_0015994 3300048091 Bacteria 3824
577 Ga0496102_0361519 3300048905 Bacteria 1367
578 Ga0496102_0376505 3300048905 Bacteria 1336
579 Ga0496104_0068796 3300048907 Bacteria 3364
580 Ga0496105_0011415 3300048908 Bacteria 7017
581 Ga0496105_0168540 3300048908 Bacteria 1796
582 Ga0496107_0195116 3300048910 Bacteria 1505
583 Ga0496108_0028771 3300048911 Bacteria 4597
584 Ga0496108_0186754 3300048911 Bacteria 1796
585 Ga0496109_0000016 3300048912 Bacteria 212455
586 Ga0496109_0011620 3300048912 Bacteria 7571
587 Ga0496109_0018772 3300048912 Bacteria 6082
588 Ga0496109_0022922 3300048912 Bacteria 5535
589 Ga0496109_0105115 3300048912 Bacteria 2622
590 Ga0496109_0121729 3300048912 Bacteria 2431
591 Ga0496109_0134749 3300048912 Bacteria 2307
592 Ga0496109_0582679 3300048912 Bacteria 1054
593 Ga0496110_0033002 3300048913 Bacteria 4475
594 Ga0496111_0037135 3300048914 Bacteria 3486
595 Ga0496111_0120134 3300048914 Bacteria 1941
596 Ga0496112_0100369 3300048915 Bacteria 2864
597 Ga0496112_0396347 3300048915 Bacteria 1320
598 Ga0496113_0301789 3300048916 Bacteria 1282
599 Ga0496115_0062817 3300048918 Bacteria 2997
600 Ga0496115_0083150 3300048918 Bacteria 2609
601 Ga0496116_0000687 3300048919 Bacteria 43932
602 Ga0496116_0003007 3300048919 Bacteria 17088
603 Ga0496116_0018895 3300048919 Bacteria 5292
604 Ga0496116_0043105 3300048919 Bacteria 3077
605 Ga0496117_0000161 3300048920 Bacteria 141379
606 Ga0496117_0034956 3300048920 Bacteria 3780
607 Ga0496118_0007983 3300048921 Bacteria 11063
608 Ga0496118_0035679 3300048921 Bacteria 4034
609 Ga0496118_0064168 3300048921 Bacteria 2697
610 Ga0496118_0126232 3300048921 Bacteria 1655
611 Ga0496119_0000042 3300048922 Bacteria 200701
612 Ga0496119_0024040 3300048922 Bacteria 4300
613 Ga0496119_0169212 3300048922 Bacteria 1155
614 Ga0496120_0000083 3300048923 Bacteria 157876
615 Ga0496120_0000283 3300048923 Bacteria 85428
616 Ga0496120_0002496 3300048923 Bacteria 18464
617 Ga0496120_0005499 3300048923 Bacteria 10087
618 Ga0496121_0048366 3300048924 Bacteria 3618
619 Ga0496121_0089174 3300048924 Bacteria 2415
620 Ga0496121_0169988 3300048924 Bacteria 1585
621 Ga0496122_0000012 3300048925 Bacteria 526837
622 Ga0496122_0009285 3300048925 Bacteria 10399
623 Ga0496122_0025502 3300048925 Bacteria 5131
624 Ga0496123_0001574 3300048926 Bacteria 31186
625 Ga0496123_0005728 3300048926 Bacteria 12374
626 Ga0496123_0011656 3300048926 Bacteria 7588
627 Ga0496125_0000010 3300048928 Bacteria 671167
628 Ga0496125_0000431 3300048928 Bacteria 77252
629 Ga0496125_0001417 3300048928 Bacteria 35011
630 Ga0496126_0000008 3300048929 Bacteria 781752
631 Ga0496126_0000461 3300048929 Bacteria 80907
632 Ga0496126_0017417 3300048929 Bacteria 7158
633 Ga0501031_0027847 3300049568 Bacteria 3683
634 Ga0501032_0015200 3300049569 Bacteria 5434
635 Ga0501038_0003585 3300049574 Bacteria 14445
636 Ga0501039_0042482 3300049575 Bacteria 3513
637 Ga0501041_0156690 3300049577 Bacteria 1423
638 Ga0501046_0390600 3300049580 Bacteria 1006
639 Ga0501047_0001292 3300049581 Bacteria 24708
640 Ga0501047_0221804 3300049581 Bacteria 1747
641 Ga0501067_0040970 3300049583 Bacteria 2572
642 Ga0501068_0000108 3300049584 Bacteria 35756
643 Ga0501069_0001287 3300049585 Bacteria 12294
644 Ga0501070_0350958 3300049586 Bacteria 1197
645 Ga0501072_0000002 3300049588 Bacteria 319523
646 Ga0501073_0004186 3300049589 Bacteria 10819
647 Ga0501074_0002365 3300049590 Bacteria 13131
648 Ga0501074_0410645 3300049590 Bacteria 960
649 Ga0501075_0170278 3300049591 Bacteria 1662
650 Ga0501076_0003889 3300049592 Bacteria 10524
651 Ga0501077_0148822 3300049593 Bacteria 1485
652 Ga0501079_0207833 3300049741 Bacteria 1529
653 Ga0501080_0092520 3300049742 Bacteria 2808
654 Ga0501083_0001967 3300049744 Bacteria 14120
655 Ga0501044_0017299 3300049823 Bacteria 7732
656 nmdc:mga05p37_454675_c1 3300050507 Bacteria 1481
657 nmdc:mga0qj67_92397_c1 3300050509 Bacteria 2433
658 nmdc:mga06r32_66914_c1 3300050510 Bacteria 3468
659 nmdc:mga06r32_722291_c1 3300050510 Bacteria 961
660 nmdc:mga08y16_13302_c1 3300050511 Bacteria 8655
661 nmdc:mga08y16_286600_c1 3300050511 Bacteria 1698
662 nmdc:mga0n895_514_c1 3300050512 Bacteria 26317
663 nmdc:mga0rr50_287013_c1 3300050513 Bacteria 1374
664 nmdc:mga0rr50_8099_c1 3300050513 Bacteria 6523
665 nmdc:mga08x19_12901_c1 3300050514 Bacteria 5042
666 nmdc:mga08x19_827_c2 3300050514 Bacteria 15119
667 Ga0495601_0122703 3300053077 Bacteria 1688
668 Ga0495612_0019411 3300053078 Bacteria 2722
669 Ga0501084_0000054 3300054114 Bacteria 90236
670 Ga0501084_0087935 3300054114 Bacteria 2609
671 Ga0501084_0340003 3300054114 Bacteria 1268
672 Ga0590071_003190 3300059421 Bacteria 4047
673 Ga0590075_011613 3300059424 Bacteria 2131
674 Ga0590077_000882 3300059426 Bacteria 7687
675 Ga0590077_012694 3300059426 Bacteria 1748
676 Ga0501082_0016842 3300060353 Bacteria 6293
677 Ga0530510_0080386 3300061734 Bacteria 2372

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049577 Ga0501041_0156690 Ga0501041_0156690_115_948 241
2 3300046516 Ga0495628_0529843 Ga0495628_0529843_23_799 244
3 3300049590 Ga0501074_0410645 Ga0501074_0410645_165_929 244
4 3300025941 Ga0207711_10000062 Ga0207711_1000006248 252
5 3300009101 Ga0105247_10000125 Ga0105247_1000012519 253
6 3300009177 Ga0105248_10003078 Ga0105248_1000307816 253
7 3300014325 Ga0163163_10043155 Ga0163163_100431554 253
8 3300048922 Ga0496119_0024040 Ga0496119_0024040_3402_4208 253
9 3300048923 Ga0496120_0000283 Ga0496120_0000283_28532_29338 253
10 3300048924 Ga0496121_0169988 Ga0496121_0169988_730_1536 253
11 3300009147 Ga0114129_10299524 Ga0114129_102995243 255
12 3300005617 Ga0068859_100000054 Ga0068859_10000005431 260
13 3300005844 Ga0068862_100000037 Ga0068862_100000037146 260
14 3300006931 Ga0097620_100000054 Ga0097620_10000005431 260
15 3300009177 Ga0105248_10000018 Ga0105248_1000001869 260
16 3300028380 Ga0268265_10000008 Ga0268265_10000008191 260
17 3300048920 Ga0496117_0034956 Ga0496117_0034956_251_1087 260
18 3300048921 Ga0496118_0064168 Ga0496118_0064168_878_1714 260
19 3300025900 Ga0207710_10000149 Ga0207710_1000014952 261
20 3300025941 Ga0207711_10048173 Ga0207711_100481733 261
21 3300048912 Ga0496109_0105115 Ga0496109_0105115_807_1646 261
22 3300048926 Ga0496123_0011656 Ga0496123_0011656_1689_2603 261
23 3300048928 Ga0496125_0001417 Ga0496125_0001417_20365_21279 261
24 3300035118 Ga0373954_0136727 Ga0373954_0136727_320_1144 263
25 3300046472 Ga0495580_0114366 Ga0495580_0114366_44_844 263
26 3300047444 Ga0495675_0242017 Ga0495675_0242017_231_1055 263
27 3300037068 Ga0373925_0654404 Ga0373925_0654404_36_854 265
28 iso_pu_bacteria 2675902999 2676198933 265
29 iso_pu_bacteria 2773857921 2774843511 265
30 3300046683 Ga0495658_0399063 Ga0495658_0399063_14_835 266
31 3300009553 Ga0105249_10150578 Ga0105249_101505782 268
32 3300021384 Ga0213876_10014097 Ga0213876_100140973 269
33 iso_pu_bacteria 2506783011 2506866930 270
34 iso_pu_bacteria 2684623035 2686537516 270
35 iso_pu_bacteria 2687453743 2689991307 270
36 iso_pu_bacteria 2895880812 2895890913 270
37 iso_pu_bacteria 2527291627 2528203559 271
38 iso_pu_bacteria 2527291629 2528214317 271
39 iso_pu_bacteria 2546825537 2546948322 271
40 iso_pu_bacteria 2576861822 2579749639 271
41 iso_pu_bacteria 2579778521 2579858163 271
42 iso_pu_bacteria 2619618881 2619859104 271
43 iso_pu_bacteria 2619619003 2620354158 271
44 iso_pu_bacteria 2626541554 2626639121 271
45 iso_pu_bacteria 2684623036 2686544800 271
46 iso_pu_bacteria 2710264753 2710601910 271
47 iso_pu_bacteria 2773857924 2774863645 271
48 iso_pu_bacteria 637000116 637878829 271
49 iso_pu_bacteria 8054913762 8054915258 271
50 iso_pu_bacteria 8054920844 8054922172 271
51 iso_pu_bacteria 2517572101 2517764687 272
52 iso_pu_bacteria 8002775197 8002779324 272
53 iso_pu_bacteria 8002784119 8002784165 272
54 3300059421 Ga0590071_003190 Ga0590071_003190_1674_2525 273
55 3300059424 Ga0590075_011613 Ga0590075_011613_1048_1899 273
56 3300059426 Ga0590077_000882 Ga0590077_000882_875_1726 273
57 iso_pu_bacteria 2508501039 2508674004 273
58 iso_pu_bacteria 2687453737 2689962385 273
59 3300045051 Ga0451576_0224788 Ga0451576_0224788_954_1790 274
60 3300048918 Ga0496115_0083150 Ga0496115_0083150_1136_1987 274
61 3300050510 nmdc:mga06r32_722291_c1 nmdc:mga06r32_722291_c1_91_927 275
62 3300005617 Ga0068859_100001223 Ga0068859_1000012236 276
63 3300005842 Ga0068858_100072117 Ga0068858_1000721172 276
64 3300005937 Ga0081455_10007431 Ga0081455_1000743112 276
65 3300006931 Ga0097620_100001223 Ga0097620_10000122316 276
66 3300009094 Ga0111539_10340307 Ga0111539_103403072 276
67 3300014968 Ga0157379_10269986 Ga0157379_102699862 276
68 3300026035 Ga0207703_10054895 Ga0207703_100548953 276
69 3300046524 Ga0495648_0199001 Ga0495648_0199001_160_993 276
70 3300048919 Ga0496116_0000687 Ga0496116_0000687_3899_4738 276
71 3300048920 Ga0496117_0000161 Ga0496117_0000161_40346_41185 276
72 3300048921 Ga0496118_0035679 Ga0496118_0035679_1214_2053 276
73 3300048921 Ga0496118_0126232 Ga0496118_0126232_786_1619 276
74 3300048922 Ga0496119_0000042 Ga0496119_0000042_76004_76843 276
75 3300048923 Ga0496120_0000083 Ga0496120_0000083_80073_80912 276
76 3300048923 Ga0496120_0005499 Ga0496120_0005499_57_896 276
77 3300048925 Ga0496122_0025502 Ga0496122_0025502_1692_2531 276
78 3300048926 Ga0496123_0001574 Ga0496123_0001574_3401_4240 276
79 3300048928 Ga0496125_0000010 Ga0496125_0000010_559601_560440 276
80 3300048929 Ga0496126_0000461 Ga0496126_0000461_33742_34581 276
81 3300050511 nmdc:mga08y16_286600_c1 nmdc:mga08y16_286600_c1_313_1161 276
82 iso_pu_bacteria 2919414237 2919414511 276
83 3300006844 Ga0075428_100005577 Ga0075428_1000055774 277
84 3300025913 Ga0207695_10001447 Ga0207695_1000144727 277
85 3300039062 Ga0400483_130213 Ga0400483_130213_12158_13018 277
86 3300039062 Ga0400483_164907 Ga0400483_164907_16229_17089 277
87 3300044712 Ga0453684_0037846 Ga0453684_0037846_1237_2112 277
88 3300044712 Ga0453684_0061499 Ga0453684_0061499_2677_3522 277
89 3300045051 Ga0451576_0140758 Ga0451576_0140758_818_1756 277
90 3300048912 Ga0496109_0121729 Ga0496109_0121729_895_1755 277
91 3300048915 Ga0496112_0396347 Ga0496112_0396347_207_1067 277
92 3300048916 Ga0496113_0301789 Ga0496113_0301789_394_1254 277
93 3300048919 Ga0496116_0018895 Ga0496116_0018895_122_976 277
94 3300048919 Ga0496116_0043105 Ga0496116_0043105_2195_3049 277
95 3300048923 Ga0496120_0002496 Ga0496120_0002496_15695_16549 277
96 3300048925 Ga0496122_0000012 Ga0496122_0000012_191702_192553 277
97 3300048926 Ga0496123_0005728 Ga0496123_0005728_4982_5833 277
98 3300048928 Ga0496125_0000431 Ga0496125_0000431_32875_33729 277
99 3300048929 Ga0496126_0000008 Ga0496126_0000008_191697_192548 277
100 3300048929 Ga0496126_0017417 Ga0496126_0017417_820_1674 277
101 3300049568 Ga0501031_0027847 Ga0501031_0027847_161_1021 277
102 3300049741 Ga0501079_0207833 Ga0501079_0207833_351_1208 277
103 3300054114 Ga0501084_0340003 Ga0501084_0340003_85_942 277
104 iso_pu_bacteria 2721755693 2723602272 277
105 iso_pu_bacteria 2728369359 2730138407 277
106 iso_pu_bacteria 2744054657 2745166234 277
107 iso_pu_bacteria 2751185905 2753809140 277
108 iso_pu_bacteria 2802428803 2802439498 277
109 iso_pu_bacteria 2816332336 2817618061 277
110 iso_pu_bacteria 2889276214 2889278356 277
111 iso_pu_bacteria 2904595352 2904600143 277
112 iso_pu_bacteria 2925326138 2925328343 277
113 iso_pu_bacteria 2939702853 2939706290 277
114 iso_pu_bacteria 2996706504 2996709459 277
115 iso_pu_bacteria 3006969106 3006973210 277
116 iso_pu_bacteria 648028048 648168812 277
117 3300005327 Ga0070658_10169684 Ga0070658_101696843 278
118 3300013306 Ga0163162_10512574 Ga0163162_105125741 278
119 3300021384 Ga0213876_10025225 Ga0213876_100252252 278
120 3300039437 Ga0436365_1806953 Ga0436365_1806953_9195_10037 278
121 3300045051 Ga0451576_0659283 Ga0451576_0659283_17_883 278
122 3300048919 Ga0496116_0003007 Ga0496116_0003007_13531_14439 278
123 iso_pu_bacteria 2524023129 2524190811 278
124 iso_pu_bacteria 2904113452 2904118188 278
125 iso_pu_bacteria 8057473075 8057477220 278
126 iso_pu_bacteria 8057977335 8057978998 278
127 3300005336 Ga0070680_100038161 Ga0070680_1000381612 279
128 3300005458 Ga0070681_10005377 Ga0070681_100053777 279
129 3300005530 Ga0070679_100005804 Ga0070679_1000058045 279
130 3300025912 Ga0207707_10007166 Ga0207707_100071665 279
131 3300025917 Ga0207660_10023863 Ga0207660_100238634 279
132 3300025921 Ga0207652_10009178 Ga0207652_100091785 279
133 3300039437 Ga0436365_1532991 Ga0436365_1532991_140_997 279
134 3300039437 Ga0436365_1557740 Ga0436365_1557740_1483_2331 279
135 3300039453 Ga0436362_0890112 Ga0436362_0890112_241_1098 279
136 3300005289 Ga0065704_10093027 Ga0065704_100930272 280
137 3300005617 Ga0068859_100058013 Ga0068859_1000580131 280
138 3300006871 Ga0075434_100319193 Ga0075434_1003191932 280
139 3300006931 Ga0097620_100058013 Ga0097620_1000580134 280
140 3300042876 Ga0451577_0553201 Ga0451577_0553201_141_992 280
141 3300003203 JGI25406J46586_10031864 JGI25406J46586_100318641 281
142 3300003841 Ga0055541_1006232 Ga0055541_10062322 281
143 3300005985 Ga0081539_10001047 Ga0081539_100010472 281
144 3300009094 Ga0111539_10263308 Ga0111539_102633082 281
145 3300025291 Ga0209675_1030371 Ga0209675_10303711 281
146 3300025294 Ga0209025_1004716 Ga0209025_100471612 281
147 3300026075 Ga0207708_10190444 Ga0207708_101904442 281
148 3300027876 Ga0209974_10016501 Ga0209974_100165012 281
149 3300031727 Ga0316576_10010783 Ga0316576_100107835 281
150 3300035398 Ga0316574_0007195 Ga0316574_0007195_968_1816 281
151 3300048921 Ga0496118_0007983 Ga0496118_0007983_8803_9669 281
152 3300048922 Ga0496119_0169212 Ga0496119_0169212_119_985 281
153 3300048924 Ga0496121_0048366 Ga0496121_0048366_2562_3428 281
154 3300048924 Ga0496121_0089174 Ga0496121_0089174_193_1059 281
155 3300048925 Ga0496122_0009285 Ga0496122_0009285_738_1604 281
156 3300049569 Ga0501032_0015200 Ga0501032_0015200_1797_2645 281
157 3300049574 Ga0501038_0003585 Ga0501038_0003585_10842_11690 281
158 3300049575 Ga0501039_0042482 Ga0501039_0042482_690_1538 281
159 3300049581 Ga0501047_0001292 Ga0501047_0001292_20914_21762 281
160 3300049584 Ga0501068_0000108 Ga0501068_0000108_9936_10784 281
161 3300049585 Ga0501069_0001287 Ga0501069_0001287_3559_4407 281
162 3300049586 Ga0501070_0350958 Ga0501070_0350958_189_1037 281
163 3300049588 Ga0501072_0000002 Ga0501072_0000002_208145_208993 281
164 3300049589 Ga0501073_0004186 Ga0501073_0004186_8459_9307 281
165 3300049590 Ga0501074_0002365 Ga0501074_0002365_6761_7609 281
166 3300049591 Ga0501075_0170278 Ga0501075_0170278_385_1233 281
167 3300049592 Ga0501076_0003889 Ga0501076_0003889_7758_8606 281
168 3300049593 Ga0501077_0148822 Ga0501077_0148822_324_1172 281
169 3300049742 Ga0501080_0092520 Ga0501080_0092520_1469_2317 281
170 3300049744 Ga0501083_0001967 Ga0501083_0001967_6650_7498 281
171 3300049823 Ga0501044_0017299 Ga0501044_0017299_4773_5621 281
172 3300054114 Ga0501084_0000054 Ga0501084_0000054_58223_59071 281
173 3300059426 Ga0590077_012694 Ga0590077_012694_773_1624 281
174 3300060353 Ga0501082_0016842 Ga0501082_0016842_4954_5802 281
175 3300061734 Ga0530510_0080386 Ga0530510_0080386_1457_2305 281
176 3300005347 Ga0070668_100049194 Ga0070668_1000491942 282
177 3300005356 Ga0070674_100020577 Ga0070674_1000205772 282
178 3300005444 Ga0070694_100037348 Ga0070694_1000373482 282
179 3300005445 Ga0070708_100015506 Ga0070708_1000155066 282
180 3300005467 Ga0070706_100027585 Ga0070706_1000275852 282
181 3300005468 Ga0070707_100089736 Ga0070707_1000897362 282
182 3300005530 Ga0070679_100170443 Ga0070679_1001704432 282
183 3300005536 Ga0070697_100036073 Ga0070697_1000360734 282
184 3300005536 Ga0070697_100046586 Ga0070697_1000465864 282
185 3300005544 Ga0070686_100071878 Ga0070686_1000718781 282
186 3300005545 Ga0070695_100016987 Ga0070695_1000169873 282
187 3300005545 Ga0070695_100026911 Ga0070695_1000269112 282
188 3300005546 Ga0070696_100040063 Ga0070696_1000400634 282
189 3300005549 Ga0070704_100248779 Ga0070704_1002487792 282
190 3300005618 Ga0068864_100129878 Ga0068864_1001298782 282
191 3300005719 Ga0068861_100301950 Ga0068861_1003019502 282
192 3300005842 Ga0068858_100272745 Ga0068858_1002727452 282
193 3300005937 Ga0081455_10133534 Ga0081455_101335341 282
194 3300005985 Ga0081539_10008121 Ga0081539_100081213 282
195 3300009553 Ga0105249_10089219 Ga0105249_100892192 282
196 3300013297 Ga0157378_10054675 Ga0157378_100546753 282
197 3300013306 Ga0163162_10799954 Ga0163162_107999541 282
198 3300014325 Ga0163163_10451920 Ga0163163_104519202 282
199 3300014497 Ga0182008_10078939 Ga0182008_100789391 282
200 3300021388 Ga0213875_10000137 Ga0213875_1000013756 282
201 3300025225 Ga0209566_100108 Ga0209566_10010850 282
202 3300025910 Ga0207684_10071762 Ga0207684_100717622 282
203 3300025910 Ga0207684_10220381 Ga0207684_102203812 282
204 3300025972 Ga0207668_10030442 Ga0207668_100304423 282
205 3300026023 Ga0207677_10162637 Ga0207677_101626372 282
206 3300026118 Ga0207675_100352431 Ga0207675_1003524312 282
207 3300031241 Ga0265325_10041187 Ga0265325_100411872 282
208 3300031249 Ga0265339_10021965 Ga0265339_100219652 282
209 3300031595 Ga0265313_10008990 Ga0265313_100089906 282
210 3300035170 Ga0373943_0304227 Ga0373943_0304227_28_885 282
211 3300035725 Ga0373947_0153208 Ga0373947_0153208_294_1289 282
212 3300037068 Ga0373925_0112771 Ga0373925_0112771_100_1095 282
213 3300037853 Ga0436364_0082088 Ga0436364_0082088_17975_18907 282
214 3300041406 Ga0439439_0000364 Ga0439439_0000364_2719_3579 282
215 3300041999 Ga0439433_0041527 Ga0439433_0041527_160_1020 282
216 3300042007 Ga0439449_0000684 Ga0439449_0000684_9158_10018 282
217 3300042015 Ga0439462_0001458 Ga0439462_0001458_2549_3409 282
218 3300042125 Ga0450923_021441 Ga0450923_021441_217_1149 282
219 3300045976 Ga0466967_0018179 Ga0466967_0018179_2912_3820 282
220 3300046454 Ga0495592_0149165 Ga0495592_0149165_536_1435 282
221 3300046462 Ga0495651_0059928 Ga0495651_0059928_257_1156 282
222 3300046665 Ga0495661_0072108 Ga0495661_0072108_39_905 282
223 3300047322 Ga0495680_0107329 Ga0495680_0107329_731_1630 282
224 3300048088 Ga0495602_0182331 Ga0495602_0182331_323_1222 282
225 3300048091 Ga0495626_0015994 Ga0495626_0015994_500_1366 282
226 3300048905 Ga0496102_0361519 Ga0496102_0361519_401_1294 282
227 3300048907 Ga0496104_0068796 Ga0496104_0068796_98_1066 282
228 3300048908 Ga0496105_0011415 Ga0496105_0011415_2946_3914 282
229 3300048908 Ga0496105_0168540 Ga0496105_0168540_222_1211 282
230 3300048910 Ga0496107_0195116 Ga0496107_0195116_171_1112 282
231 3300048911 Ga0496108_0028771 Ga0496108_0028771_853_1821 282
232 3300048911 Ga0496108_0186754 Ga0496108_0186754_723_1652 282
233 3300048912 Ga0496109_0011620 Ga0496109_0011620_5135_6103 282
234 3300048912 Ga0496109_0018772 Ga0496109_0018772_1320_2306 282
235 3300048912 Ga0496109_0134749 Ga0496109_0134749_1144_2139 282
236 3300048912 Ga0496109_0582679 Ga0496109_0582679_49_978 282
237 3300048913 Ga0496110_0033002 Ga0496110_0033002_760_1728 282
238 3300048914 Ga0496111_0037135 Ga0496111_0037135_847_1815 282
239 3300048915 Ga0496112_0100369 Ga0496112_0100369_882_1811 282
240 3300049583 Ga0501067_0040970 Ga0501067_0040970_1452_2444 282
241 3300053077 Ga0495601_0122703 Ga0495601_0122703_70_969 282
242 3300053078 Ga0495612_0019411 Ga0495612_0019411_1365_2264 282
243 3300035725 Ga0373947_0104728 Ga0373947_0104728_653_1513 283
244 3300037068 Ga0373925_0094477 Ga0373925_0094477_1014_1874 283
245 3300046472 Ga0495580_0004196 Ga0495580_0004196_3391_4251 283
246 3300009545 Ga0105237_10000223 Ga0105237_1000022355 284
247 3300009551 Ga0105238_10063942 Ga0105238_100639423 284
248 3300013296 Ga0157374_10258466 Ga0157374_102584662 284
249 3300025914 Ga0207671_10000256 Ga0207671_1000025657 284
250 3300025924 Ga0207694_10192305 Ga0207694_101923052 284
251 3300046472 Ga0495580_0015979 Ga0495580_0015979_1978_2919 284
252 3300006914 Ga0075436_100016687 Ga0075436_1000166875 285
253 3300025910 Ga0207684_10127316 Ga0207684_101273163 285
254 3300028800 Ga0265338_10001562 Ga0265338_1000156239 285
255 3300045051 Ga0451576_0000417 Ga0451576_0000417_39664_40527 285
256 3300050514 nmdc:mga08x19_827_c2 nmdc:mga08x19_827_c2_7898_8830 285
257 3300005434 Ga0070709_10127394 Ga0070709_101273942 286
258 3300006175 Ga0070712_100162944 Ga0070712_1001629444 286
259 3300028800 Ga0265338_10056535 Ga0265338_100565353 286
260 3300031235 Ga0265330_10004925 Ga0265330_100049259 286
261 3300031250 Ga0265331_10007181 Ga0265331_100071819 286
262 3300031344 Ga0265316_10013362 Ga0265316_1001336210 286
263 3300031344 Ga0265316_10174139 Ga0265316_101741392 286
264 3300000549 LJQas_1000007 LJQas_100000721 287
265 3300005458 Ga0070681_10034973 Ga0070681_100349734 287
266 3300005468 Ga0070707_100294931 Ga0070707_1002949312 287
267 3300025912 Ga0207707_10060292 Ga0207707_100602922 287
268 3300005338 Ga0068868_100002275 Ga0068868_1000022754 288
269 3300005548 Ga0070665_100048003 Ga0070665_1000480033 288
270 3300005563 Ga0068855_100004587 Ga0068855_1000045874 288
271 3300005617 Ga0068859_100024538 Ga0068859_1000245387 288
272 3300006237 Ga0097621_100059860 Ga0097621_1000598604 288
273 3300006358 Ga0068871_100005987 Ga0068871_1000059878 288
274 3300006931 Ga0097620_100024538 Ga0097620_1000245387 288
275 3300009176 Ga0105242_10013866 Ga0105242_100138663 288
276 3300009545 Ga0105237_10046509 Ga0105237_100465094 288
277 3300009551 Ga0105238_10008204 Ga0105238_100082048 288
278 3300010375 Ga0105239_10019814 Ga0105239_100198146 288
279 3300013297 Ga0157378_10365856 Ga0157378_103658562 288
280 3300014325 Ga0163163_10266364 Ga0163163_102663642 288
281 3300025913 Ga0207695_10016938 Ga0207695_100169383 288
282 3300025924 Ga0207694_10003426 Ga0207694_100034266 288
283 3300025927 Ga0207687_10174634 Ga0207687_101746341 288
284 3300025949 Ga0207667_10021589 Ga0207667_100215892 288
285 3300026023 Ga0207677_10003453 Ga0207677_100034534 288
286 3300028379 Ga0268266_10003198 Ga0268266_1000319813 288
287 3300046472 Ga0495580_0139981 Ga0495580_0139981_486_1373 288
288 3300021377 Ga0213874_10061087 Ga0213874_100610871 289
289 3300025913 Ga0207695_10305061 Ga0207695_103050612 289
290 3300039450 Ga0436363_0305072 Ga0436363_0305072_135_1067 289
291 3300005445 Ga0070708_100081034 Ga0070708_1000810342 290
292 3300013297 Ga0157378_10166445 Ga0157378_101664453 290
293 3300031901 Ga0307406_10173181 Ga0307406_101731811 291
294 3300032005 Ga0307411_10023799 Ga0307411_100237992 291
295 3300007265 Ga0099794_10069567 Ga0099794_100695671 292
296 3300035119 Ga0373956_0007033 Ga0373956_0007033_667_1596 292
297 3300036401 Ga0373937_0063437 Ga0373937_0063437_1521_2450 292
298 3300031249 Ga0265339_10000166 Ga0265339_100001666 293
299 3300031344 Ga0265316_10001544 Ga0265316_1000154420 293
300 3300031712 Ga0265342_10055883 Ga0265342_100558832 293
301 3300005439 Ga0070711_100030940 Ga0070711_1000309402 294
302 3300006175 Ga0070712_100310671 Ga0070712_1003106712 294
303 3300005327 Ga0070658_10017385 Ga0070658_100173856 295
304 3300005329 Ga0070683_100013341 Ga0070683_1000133418 295
305 3300005329 Ga0070683_100018105 Ga0070683_1000181057 295
306 3300005329 Ga0070683_100046079 Ga0070683_1000460794 295
307 3300005329 Ga0070683_100263147 Ga0070683_1002631472 295
308 3300005336 Ga0070680_100009354 Ga0070680_1000093549 295
309 3300005339 Ga0070660_100034314 Ga0070660_1000343144 295
310 3300005339 Ga0070660_100167511 Ga0070660_1001675112 295
311 3300005341 Ga0070691_10017606 Ga0070691_100176063 295
312 3300005344 Ga0070661_100026126 Ga0070661_1000261264 295
313 3300005434 Ga0070709_10106829 Ga0070709_101068292 295
314 3300005436 Ga0070713_100093866 Ga0070713_1000938663 295
315 3300005436 Ga0070713_100147555 Ga0070713_1001475554 295
316 3300005439 Ga0070711_100242037 Ga0070711_1002420371 295
317 3300005439 Ga0070711_100277359 Ga0070711_1002773592 295
318 3300005441 Ga0070700_100403488 Ga0070700_1004034881 295
319 3300005458 Ga0070681_10000605 Ga0070681_1000060522 295
320 3300005458 Ga0070681_10043027 Ga0070681_100430274 295
321 3300005530 Ga0070679_100009024 Ga0070679_1000090245 295
322 3300005530 Ga0070679_100140602 Ga0070679_1001406023 295
323 3300005535 Ga0070684_100002114 Ga0070684_10000211413 295
324 3300005535 Ga0070684_100022521 Ga0070684_1000225213 295
325 3300005535 Ga0070684_100249089 Ga0070684_1002490891 295
326 3300005539 Ga0068853_100038145 Ga0068853_1000381453 295
327 3300005545 Ga0070695_100060897 Ga0070695_1000608973 295
328 3300005547 Ga0070693_100006824 Ga0070693_1000068243 295
329 3300005563 Ga0068855_100007492 Ga0068855_10000749211 295
330 3300005563 Ga0068855_100049900 Ga0068855_1000499003 295
331 3300005563 Ga0068855_100085120 Ga0068855_1000851203 295
332 3300005563 Ga0068855_100093880 Ga0068855_1000938803 295
333 3300005577 Ga0068857_100003819 Ga0068857_1000038199 295
334 3300005577 Ga0068857_100007396 Ga0068857_1000073964 295
335 3300005614 Ga0068856_100010972 Ga0068856_1000109725 295
336 3300005614 Ga0068856_100022526 Ga0068856_1000225264 295
337 3300005614 Ga0068856_100036394 Ga0068856_1000363943 295
338 3300005614 Ga0068856_100086445 Ga0068856_1000864452 295
339 3300005614 Ga0068856_100118059 Ga0068856_1001180592 295
340 3300005616 Ga0068852_100264604 Ga0068852_1002646042 295
341 3300005616 Ga0068852_100284848 Ga0068852_1002848482 295
342 3300005617 Ga0068859_100281892 Ga0068859_1002818922 295
343 3300005618 Ga0068864_100020562 Ga0068864_1000205623 295
344 3300005842 Ga0068858_100005980 Ga0068858_1000059808 295
345 3300005842 Ga0068858_100129946 Ga0068858_1001299462 295
346 3300005842 Ga0068858_100147216 Ga0068858_1001472162 295
347 3300006237 Ga0097621_100012173 Ga0097621_1000121733 295
348 3300006237 Ga0097621_100454928 Ga0097621_1004549282 295
349 3300006358 Ga0068871_100262525 Ga0068871_1002625252 295
350 3300006881 Ga0068865_100030146 Ga0068865_1000301462 295
351 3300006931 Ga0097620_100281880 Ga0097620_1002818803 295
352 3300009093 Ga0105240_10003303 Ga0105240_100033035 295
353 3300009093 Ga0105240_10003832 Ga0105240_1000383210 295
354 3300009093 Ga0105240_10037802 Ga0105240_100378024 295
355 3300009093 Ga0105240_10063307 Ga0105240_100633073 295
356 3300009093 Ga0105240_10084091 Ga0105240_100840914 295
357 3300009093 Ga0105240_10664710 Ga0105240_106647102 295
358 3300009098 Ga0105245_10002254 Ga0105245_100022547 295
359 3300009098 Ga0105245_10061145 Ga0105245_100611452 295
360 3300009098 Ga0105245_10107928 Ga0105245_101079283 295
361 3300009098 Ga0105245_10262345 Ga0105245_102623452 295
362 3300009101 Ga0105247_10071278 Ga0105247_100712783 295
363 3300009148 Ga0105243_10090788 Ga0105243_100907881 295
364 3300009174 Ga0105241_10008535 Ga0105241_100085354 295
365 3300009174 Ga0105241_10138018 Ga0105241_101380182 295
366 3300009177 Ga0105248_10045759 Ga0105248_100457593 295
367 3300009177 Ga0105248_10085631 Ga0105248_100856311 295
368 3300009177 Ga0105248_10107131 Ga0105248_101071313 295
369 3300009177 Ga0105248_10332995 Ga0105248_103329952 295
370 3300009545 Ga0105237_10021372 Ga0105237_100213725 295
371 3300009545 Ga0105237_10077423 Ga0105237_100774233 295
372 3300009545 Ga0105237_10110999 Ga0105237_101109992 295
373 3300009551 Ga0105238_10008033 Ga0105238_100080339 295
374 3300009551 Ga0105238_10011819 Ga0105238_100118197 295
375 3300009551 Ga0105238_10018386 Ga0105238_100183862 295
376 3300009551 Ga0105238_10062169 Ga0105238_100621693 295
377 3300009553 Ga0105249_10237101 Ga0105249_102371012 295
378 3300010375 Ga0105239_10006113 Ga0105239_1000611311 295
379 3300010375 Ga0105239_10018215 Ga0105239_100182152 295
380 3300010375 Ga0105239_10020900 Ga0105239_100209004 295
381 3300011119 Ga0105246_10190773 Ga0105246_101907731 295
382 3300013104 Ga0157370_10005991 Ga0157370_1000599112 295
383 3300013104 Ga0157370_10006307 Ga0157370_1000630711 295
384 3300013104 Ga0157370_10057435 Ga0157370_100574353 295
385 3300013105 Ga0157369_10008782 Ga0157369_100087825 295
386 3300013105 Ga0157369_10013263 Ga0157369_100132633 295
387 3300013105 Ga0157369_10016965 Ga0157369_100169658 295
388 3300013105 Ga0157369_10112426 Ga0157369_101124263 295
389 3300013296 Ga0157374_10012136 Ga0157374_100121362 295
390 3300013306 Ga0163162_10013500 Ga0163162_100135004 295
391 3300013306 Ga0163162_10209761 Ga0163162_102097613 295
392 3300013306 Ga0163162_10258956 Ga0163162_102589562 295
393 3300013307 Ga0157372_10007318 Ga0157372_100073185 295
394 3300013307 Ga0157372_10057171 Ga0157372_100571712 295
395 3300013307 Ga0157372_10374825 Ga0157372_103748252 295
396 3300013307 Ga0157372_10665210 Ga0157372_106652102 295
397 3300013308 Ga0157375_10005690 Ga0157375_100056906 295
398 3300013308 Ga0157375_10700022 Ga0157375_107000221 295
399 3300014325 Ga0163163_10002598 Ga0163163_1000259814 295
400 3300014325 Ga0163163_10018126 Ga0163163_100181264 295
401 3300014325 Ga0163163_10875955 Ga0163163_108759551 295
402 3300014968 Ga0157379_10050360 Ga0157379_100503602 295
403 3300014968 Ga0157379_10065070 Ga0157379_100650702 295
404 3300014969 Ga0157376_10096022 Ga0157376_100960222 295
405 3300014969 Ga0157376_10182786 Ga0157376_101827862 295
406 3300025903 Ga0207680_10044635 Ga0207680_100446352 295
407 3300025909 Ga0207705_10067567 Ga0207705_100675672 295
408 3300025911 Ga0207654_10078752 Ga0207654_100787522 295
409 3300025912 Ga0207707_10000372 Ga0207707_100003723 295
410 3300025912 Ga0207707_10248489 Ga0207707_102484892 295
411 3300025913 Ga0207695_10000563 Ga0207695_1000056332 295
412 3300025913 Ga0207695_10008730 Ga0207695_100087306 295
413 3300025913 Ga0207695_10035763 Ga0207695_100357634 295
414 3300025917 Ga0207660_10052210 Ga0207660_100522103 295
415 3300025917 Ga0207660_10087896 Ga0207660_100878962 295
416 3300025919 Ga0207657_10008514 Ga0207657_100085143 295
417 3300025919 Ga0207657_10141762 Ga0207657_101417623 295
418 3300025921 Ga0207652_10008525 Ga0207652_100085253 295
419 3300025921 Ga0207652_10111378 Ga0207652_101113783 295
420 3300025924 Ga0207694_10002271 Ga0207694_1000227111 295
421 3300025924 Ga0207694_10009451 Ga0207694_100094515 295
422 3300025924 Ga0207694_10051476 Ga0207694_100514762 295
423 3300025924 Ga0207694_10096390 Ga0207694_100963902 295
424 3300025927 Ga0207687_10023621 Ga0207687_100236212 295
425 3300025927 Ga0207687_10025790 Ga0207687_100257903 295
426 3300025927 Ga0207687_10355395 Ga0207687_103553952 295
427 3300025928 Ga0207700_10108197 Ga0207700_101081973 295
428 3300025928 Ga0207700_10123466 Ga0207700_101234662 295
429 3300025931 Ga0207644_10013253 Ga0207644_100132535 295
430 3300025935 Ga0207709_10060594 Ga0207709_100605943 295
431 3300025938 Ga0207704_10162165 Ga0207704_101621652 295
432 3300025941 Ga0207711_10003507 Ga0207711_100035073 295
433 3300025941 Ga0207711_10274577 Ga0207711_102745771 295
434 3300025942 Ga0207689_10197476 Ga0207689_101974762 295
435 3300025944 Ga0207661_10028768 Ga0207661_100287684 295
436 3300025944 Ga0207661_10031447 Ga0207661_100314474 295
437 3300025944 Ga0207661_10131306 Ga0207661_101313062 295
438 3300025944 Ga0207661_10309717 Ga0207661_103097172 295
439 3300025944 Ga0207661_10543208 Ga0207661_105432081 295
440 3300025949 Ga0207667_10001746 Ga0207667_1000174624 295
441 3300025949 Ga0207667_10015000 Ga0207667_100150005 295
442 3300025949 Ga0207667_10039308 Ga0207667_100393084 295
443 3300026035 Ga0207703_10010141 Ga0207703_100101413 295
444 3300026035 Ga0207703_10012257 Ga0207703_100122575 295
445 3300026035 Ga0207703_10045889 Ga0207703_100458893 295
446 3300026035 Ga0207703_10080867 Ga0207703_100808673 295
447 3300026041 Ga0207639_10035103 Ga0207639_100351034 295
448 3300026078 Ga0207702_10003891 Ga0207702_100038915 295
449 3300026078 Ga0207702_10045510 Ga0207702_100455102 295
450 3300026095 Ga0207676_10015283 Ga0207676_100152835 295
451 3300026095 Ga0207676_10018647 Ga0207676_100186474 295
452 3300026116 Ga0207674_10000503 Ga0207674_1000050354 295
453 3300026116 Ga0207674_10002123 Ga0207674_100021239 295
454 3300026116 Ga0207674_10006162 Ga0207674_100061628 295
455 3300026142 Ga0207698_10015980 Ga0207698_100159805 295
456 3300026142 Ga0207698_10618425 Ga0207698_106184251 295
457 3300028379 Ga0268266_10228066 Ga0268266_102280662 295
458 3300028800 Ga0265338_10241884 Ga0265338_102418842 295
459 3300031595 Ga0265313_10003840 Ga0265313_100038405 295
460 3300031711 Ga0265314_10237486 Ga0265314_102374861 295
461 3300035086 Ga0373934_0013316 Ga0373934_0013316_1996_2916 295
462 3300035113 Ga0373936_0021787 Ga0373936_0021787_114_1010 295
463 3300035118 Ga0373954_0099487 Ga0373954_0099487_388_1281 295
464 3300035120 Ga0373957_0030295 Ga0373957_0030295_149_1054 295
465 3300035120 Ga0373957_0096527 Ga0373957_0096527_152_1069 295
466 3300035171 Ga0373946_0061604 Ga0373946_0061604_279_1175 295
467 3300035172 Ga0373955_0043801 Ga0373955_0043801_1084_2004 295
468 3300035172 Ga0373955_0132194 Ga0373955_0132194_154_1059 295
469 3300035692 Ga0373935_0200642 Ga0373935_0200642_118_1038 295
470 3300035695 Ga0373927_0007949 Ga0373927_0007949_5992_6900 295
471 3300035724 Ga0373933_0009825 Ga0373933_0009825_327_1232 295
472 3300035725 Ga0373947_0185495 Ga0373947_0185495_290_1198 295
473 3300036401 Ga0373937_0007488 Ga0373937_0007488_8063_8968 295
474 3300036401 Ga0373937_0029905 Ga0373937_0029905_3371_4282 295
475 3300036401 Ga0373937_0052871 Ga0373937_0052871_1099_1992 295
476 3300036401 Ga0373937_0127978 Ga0373937_0127978_377_1297 295
477 3300036401 Ga0373937_0323476 Ga0373937_0323476_518_1438 295
478 3300037068 Ga0373925_0025741 Ga0373925_0025741_989_1894 295
479 3300046454 Ga0495592_0041600 Ga0495592_0041600_340_1233 295
480 3300046462 Ga0495651_0118703 Ga0495651_0118703_265_1185 295
481 3300046472 Ga0495580_0029946 Ga0495580_0029946_129_1049 295
482 3300046472 Ga0495580_0080968 Ga0495580_0080968_1194_2099 295
483 3300046473 Ga0495582_0076753 Ga0495582_0076753_415_1308 295
484 3300046473 Ga0495582_0083217 Ga0495582_0083217_501_1397 295
485 3300046475 Ga0495639_0064283 Ga0495639_0064283_339_1232 295
486 3300046477 Ga0495664_0074207 Ga0495664_0074207_1047_1967 295
487 3300046499 Ga0495594_0017572 Ga0495594_0017572_1189_2082 295
488 3300046516 Ga0495628_0118358 Ga0495628_0118358_363_1280 295
489 3300046529 Ga0495652_0105876 Ga0495652_0105876_1162_2067 295
490 3300046529 Ga0495652_0129100 Ga0495652_0129100_11_931 295
491 3300046531 Ga0495665_0091083 Ga0495665_0091083_607_1503 295
492 3300046535 Ga0495586_0096141 Ga0495586_0096141_446_1339 295
493 3300046535 Ga0495586_0148444 Ga0495586_0148444_266_1171 295
494 3300046642 Ga0495634_0017369 Ga0495634_0017369_3845_4738 295
495 3300046679 Ga0495623_0161155 Ga0495623_0161155_227_1120 295
496 3300048905 Ga0496102_0376505 Ga0496102_0376505_205_1125 295
497 3300009545 Ga0105237_10457109 Ga0105237_104571091 297
498 3300014325 Ga0163163_10511951 Ga0163163_105119511 297
499 3300025321 Ga0207656_10029760 Ga0207656_100297603 297
500 3300009093 Ga0105240_10156934 Ga0105240_101569342 298
501 3300009177 Ga0105248_10232588 Ga0105248_102325882 298
502 3300009551 Ga0105238_10118213 Ga0105238_101182133 298
503 3300013307 Ga0157372_10118462 Ga0157372_101184623 298
504 3300014497 Ga0182008_10080883 Ga0182008_100808831 298
505 3300015261 Ga0182006_1057686 Ga0182006_10576861 298
506 3300025919 Ga0207657_10022801 Ga0207657_100228015 298
507 3300025924 Ga0207694_10151685 Ga0207694_101516852 298
508 3300039453 Ga0436362_0963183 Ga0436362_0963183_1163_2062 298
509 3300048914 Ga0496111_0120134 Ga0496111_0120134_963_1910 298
510 3300005330 Ga0070690_100386479 Ga0070690_1003864791 300
511 3300005434 Ga0070709_10301612 Ga0070709_103016121 300
512 3300005518 Ga0070699_100208234 Ga0070699_1002082342 300
513 3300013308 Ga0157375_10327530 Ga0157375_103275302 300
514 3300035170 Ga0373943_0021984 Ga0373943_0021984_1259_2185 300
515 3300035692 Ga0373935_0239424 Ga0373935_0239424_232_1158 300
516 3300035695 Ga0373927_0001504 Ga0373927_0001504_11993_12919 300
517 3300035725 Ga0373947_0000236 Ga0373947_0000236_9938_10864 300
518 3300036401 Ga0373937_0381349 Ga0373937_0381349_355_1260 300
519 3300037068 Ga0373925_0000139 Ga0373925_0000139_34369_35295 300
520 3300046690 Ga0495624_0169747 Ga0495624_0169747_286_1212 300
521 3300050507 nmdc:mga05p37_454675_c1 nmdc:mga05p37_454675_c1_14_922 300
522 3300005456 Ga0070678_100179288 Ga0070678_1001792881 301
523 3300005458 Ga0070681_10213804 Ga0070681_102138043 301
524 3300005614 Ga0068856_100218103 Ga0068856_1002181032 301
525 3300013104 Ga0157370_10040560 Ga0157370_100405606 301
526 3300013308 Ga0157375_10249317 Ga0157375_102493171 301
527 3300025909 Ga0207705_10047594 Ga0207705_100475943 301
528 3300025912 Ga0207707_10057693 Ga0207707_100576934 301
529 3300026121 Ga0207683_10240206 Ga0207683_102402061 301
530 3300049580 Ga0501046_0390600 Ga0501046_0390600_76_984 301
531 3300049581 Ga0501047_0221804 Ga0501047_0221804_187_1095 301
532 3300005336 Ga0070680_100010904 Ga0070680_1000109046 302
533 3300005548 Ga0070665_100238239 Ga0070665_1002382391 302
534 3300005563 Ga0068855_100058864 Ga0068855_1000588643 302
535 3300005614 Ga0068856_100125226 Ga0068856_1001252263 302
536 3300006028 Ga0070717_10451066 Ga0070717_104510661 302
537 3300009093 Ga0105240_10013706 Ga0105240_100137064 302
538 3300013104 Ga0157370_10065457 Ga0157370_100654572 302
539 3300013105 Ga0157369_10012845 Ga0157369_100128453 302
540 3300013296 Ga0157374_10303284 Ga0157374_103032842 302
541 3300025949 Ga0207667_10050214 Ga0207667_100502143 302
542 3300026142 Ga0207698_10013952 Ga0207698_100139523 302
543 3300028379 Ga0268266_10422514 Ga0268266_104225141 302
544 3300037418 Ga0395900_0334769 Ga0395900_0334769_221_1138 302
545 3300046472 Ga0495580_0026187 Ga0495580_0026187_1400_2329 302
546 3300005336 Ga0070680_100307333 Ga0070680_1003073331 303
547 3300005344 Ga0070661_100013004 Ga0070661_1000130041 303
548 3300005344 Ga0070661_100115847 Ga0070661_1001158472 303
549 3300005344 Ga0070661_100286029 Ga0070661_1002860292 303
550 3300005366 Ga0070659_100083707 Ga0070659_1000837072 303
551 3300005436 Ga0070713_100211971 Ga0070713_1002119711 303
552 3300005456 Ga0070678_100219297 Ga0070678_1002192972 303
553 3300005468 Ga0070707_100156247 Ga0070707_1001562472 303
554 3300005536 Ga0070697_100037641 Ga0070697_1000376413 303
555 3300005539 Ga0068853_100081151 Ga0068853_1000811512 303
556 3300005563 Ga0068855_100095978 Ga0068855_1000959783 303
557 3300005563 Ga0068855_100189752 Ga0068855_1001897521 303
558 3300005564 Ga0070664_100309057 Ga0070664_1003090571 303
559 3300005564 Ga0070664_100336510 Ga0070664_1003365102 303
560 3300005614 Ga0068856_100027489 Ga0068856_1000274894 303
561 3300005614 Ga0068856_100040539 Ga0068856_1000405392 303
562 3300005937 Ga0081455_10027970 Ga0081455_100279703 303
563 3300006028 Ga0070717_10023812 Ga0070717_100238124 303
564 3300006846 Ga0075430_100013130 Ga0075430_1000131307 303
565 3300006847 Ga0075431_100045761 Ga0075431_1000457613 303
566 3300009098 Ga0105245_10157114 Ga0105245_101571143 303
567 3300010375 Ga0105239_10226136 Ga0105239_102261362 303
568 3300013104 Ga0157370_10016399 Ga0157370_100163992 303
569 3300013105 Ga0157369_10063670 Ga0157369_100636704 303
570 3300013105 Ga0157369_10152686 Ga0157369_101526863 303
571 3300013296 Ga0157374_10067061 Ga0157374_100670612 303
572 3300013307 Ga0157372_10020322 Ga0157372_100203223 303
573 3300021388 Ga0213875_10059306 Ga0213875_100593062 303
574 3300025912 Ga0207707_10292634 Ga0207707_102926342 303
575 3300025917 Ga0207660_10390683 Ga0207660_103906831 303
576 3300025921 Ga0207652_10447328 Ga0207652_104473281 303
577 3300025949 Ga0207667_10140890 Ga0207667_101408903 303
578 3300026078 Ga0207702_10067007 Ga0207702_100670073 303
579 3300026078 Ga0207702_10153726 Ga0207702_101537263 303
580 3300026121 Ga0207683_10461022 Ga0207683_104610221 303
581 3300031235 Ga0265330_10007010 Ga0265330_100070104 303
582 3300031235 Ga0265330_10022903 Ga0265330_100229032 303
583 3300031235 Ga0265330_10038588 Ga0265330_100385882 303
584 3300031242 Ga0265329_10030458 Ga0265329_100304582 303
585 3300031344 Ga0265316_10004170 Ga0265316_1000417010 303
586 3300031344 Ga0265316_10116486 Ga0265316_101164863 303
587 3300031712 Ga0265342_10004295 Ga0265342_100042957 303
588 3300035695 Ga0373927_0006461 Ga0373927_0006461_6235_7167 303
589 3300037853 Ga0436364_1046789 Ga0436364_1046789_436_1392 303
590 3300037853 Ga0436364_1265083 Ga0436364_1265083_671_1591 303
591 3300044693 Ga0466961_0050872 Ga0466961_0050872_1581_2495 303
592 3300044694 Ga0466963_0003571 Ga0466963_0003571_3190_4104 303
593 3300046472 Ga0495580_0048971 Ga0495580_0048971_1754_2686 303
594 3300047471 Ga0495684_0223931 Ga0495684_0223931_47_979 303
595 3300048918 Ga0496115_0062817 Ga0496115_0062817_370_1293 303
596 3300050509 nmdc:mga0qj67_92397_c1 nmdc:mga0qj67_92397_c1_1115_2044 303
597 3300005518 Ga0070699_100024627 Ga0070699_1000246276 304
598 3300005548 Ga0070665_100175928 Ga0070665_1001759282 304
599 3300005616 Ga0068852_100210130 Ga0068852_1002101302 304
600 3300006852 Ga0075433_10003719 Ga0075433_1000371914 304
601 3300006871 Ga0075434_100000069 Ga0075434_1000000697 304
602 3300006914 Ga0075436_100007970 Ga0075436_1000079704 304
603 3300007076 Ga0075435_100106627 Ga0075435_1001066272 304
604 3300007076 Ga0075435_100116985 Ga0075435_1001169853 304
605 3300009093 Ga0105240_10716684 Ga0105240_107166841 304
606 3300009094 Ga0111539_10077847 Ga0111539_100778472 304
607 3300009147 Ga0114129_10333590 Ga0114129_103335902 304
608 3300013105 Ga0157369_10204804 Ga0157369_102048042 304
609 3300021361 Ga0213872_10000182 Ga0213872_1000018249 304
610 3300021377 Ga0213874_10011049 Ga0213874_100110492 304
611 3300021384 Ga0213876_10003589 Ga0213876_100035897 304
612 3300021384 Ga0213876_10071368 Ga0213876_100713683 304
613 3300021388 Ga0213875_10000019 Ga0213875_10000019100 304
614 3300021388 Ga0213875_10000109 Ga0213875_1000010955 304
615 3300021388 Ga0213875_10001103 Ga0213875_100011034 304
616 3300021388 Ga0213875_10003448 Ga0213875_100034486 304
617 3300021388 Ga0213875_10091566 Ga0213875_100915662 304
618 3300021388 Ga0213875_10092868 Ga0213875_100928682 304
619 3300025904 Ga0207647_10206988 Ga0207647_102069882 304
620 3300025922 Ga0207646_10000447 Ga0207646_1000044711 304
621 3300026067 Ga0207678_10274679 Ga0207678_102746792 304
622 3300027907 Ga0207428_10002460 Ga0207428_100024604 304
623 3300028379 Ga0268266_10204867 Ga0268266_102048672 304
624 3300037853 Ga0436364_0096221 Ga0436364_0096221_214_1134 304
625 3300037853 Ga0436364_0197022 Ga0436364_0197022_11811_12743 304
626 3300037853 Ga0436364_0199614 Ga0436364_0199614_1181_2101 304
627 3300037853 Ga0436364_0313932 Ga0436364_0313932_3478_4413 304
628 3300037853 Ga0436364_0366372 Ga0436364_0366372_127252_128187 304
629 3300037853 Ga0436364_0452996 Ga0436364_0452996_5079_5999 304
630 3300037853 Ga0436364_0472599 Ga0436364_0472599_1118_2047 304
631 3300037853 Ga0436364_1023107 Ga0436364_1023107_1078_1998 304
632 3300037853 Ga0436364_1239453 Ga0436364_1239453_1540_2460 304
633 3300037853 Ga0436364_1247308 Ga0436364_1247308_299_1219 304
634 3300037853 Ga0436364_1326320 Ga0436364_1326320_2499_3425 304
635 3300039437 Ga0436365_0500041 Ga0436365_0500041_1710_2639 304
636 3300039437 Ga0436365_0586387 Ga0436365_0586387_110_1042 304
637 3300039437 Ga0436365_1155152 Ga0436365_1155152_20015_20935 304
638 3300039437 Ga0436365_1870226 Ga0436365_1870226_1069_1989 304
639 3300039438 Ga0436360_0212151 Ga0436360_0212151_295_1212 304
640 3300039447 Ga0436361_0126076 Ga0436361_0126076_58013_58948 304
641 3300039450 Ga0436363_0052707 Ga0436363_0052707_1328_2254 304
642 3300039450 Ga0436363_0647531 Ga0436363_0647531_323_1243 304
643 3300039450 Ga0436363_1068053 Ga0436363_1068053_185_1108 304
644 3300039453 Ga0436362_0471056 Ga0436362_0471056_1971_2903 304
645 3300039453 Ga0436362_0556739 Ga0436362_0556739_1561_2484 304
646 3300048912 Ga0496109_0000016 Ga0496109_0000016_17497_18420 304
647 3300050510 nmdc:mga06r32_66914_c1 nmdc:mga06r32_66914_c1_1059_1982 304
648 3300050511 nmdc:mga08y16_13302_c1 nmdc:mga08y16_13302_c1_2075_2998 304
649 3300050512 nmdc:mga0n895_514_c1 nmdc:mga0n895_514_c1_15372_16313 304
650 3300050513 nmdc:mga0rr50_287013_c1 nmdc:mga0rr50_287013_c1_12_935 304
651 3300050513 nmdc:mga0rr50_8099_c1 nmdc:mga0rr50_8099_c1_92_1033 304
652 3300050514 nmdc:mga08x19_12901_c1 nmdc:mga08x19_12901_c1_3505_4446 304
653 3300054114 Ga0501084_0087935 Ga0501084_0087935_1617_2540 304
654 2162886012 MBSR1b_contig_2607737 MBSR1b_0494.00003840 305
655 3300005293 Ga0065715_10124535 Ga0065715_101245352 305
656 3300005330 Ga0070690_100053341 Ga0070690_1000533413 305
657 3300005334 Ga0068869_100023139 Ga0068869_1000231394 305
658 3300005340 Ga0070689_100034718 Ga0070689_1000347182 305
659 3300005354 Ga0070675_100155155 Ga0070675_1001551553 305
660 3300005355 Ga0070671_100312434 Ga0070671_1003124341 305
661 3300005458 Ga0070681_10150205 Ga0070681_101502052 305
662 3300005539 Ga0068853_100314152 Ga0068853_1003141521 305
663 3300005543 Ga0070672_100246532 Ga0070672_1002465322 305
664 3300005564 Ga0070664_100176442 Ga0070664_1001764422 305
665 3300005578 Ga0068854_100142677 Ga0068854_1001426772 305
666 3300005617 Ga0068859_100043795 Ga0068859_1000437952 305
667 3300005618 Ga0068864_100225252 Ga0068864_1002252522 305
668 3300005841 Ga0068863_100419081 Ga0068863_1004190812 305
669 3300005841 Ga0068863_100474461 Ga0068863_1004744611 305
670 3300005842 Ga0068858_100068750 Ga0068858_1000687502 305
671 3300005842 Ga0068858_100073980 Ga0068858_1000739802 305
672 3300005843 Ga0068860_100030585 Ga0068860_1000305851 305
673 3300005844 Ga0068862_100265430 Ga0068862_1002654302 305
674 3300006237 Ga0097621_100456789 Ga0097621_1004567891 305
675 3300006237 Ga0097621_100629932 Ga0097621_1006299321 305
676 3300006358 Ga0068871_100043122 Ga0068871_1000431222 305
677 3300006358 Ga0068871_100275505 Ga0068871_1002755051 305
678 3300006358 Ga0068871_100503766 Ga0068871_1005037661 305
679 3300006931 Ga0097620_100043791 Ga0097620_1000437912 305
680 3300009101 Ga0105247_10005102 Ga0105247_100051026 305
681 3300009174 Ga0105241_10045243 Ga0105241_100452434 305
682 3300009177 Ga0105248_10054531 Ga0105248_100545315 305
683 3300009177 Ga0105248_10239066 Ga0105248_102390662 305
684 3300009545 Ga0105237_10173473 Ga0105237_101734733 305
685 3300009553 Ga0105249_10134884 Ga0105249_101348842 305
686 3300010375 Ga0105239_10242934 Ga0105239_102429341 305
687 3300013297 Ga0157378_10184073 Ga0157378_101840732 305
688 3300013306 Ga0163162_10086353 Ga0163162_100863532 305
689 3300013306 Ga0163162_10124049 Ga0163162_101240492 305
690 3300013308 Ga0157375_10159781 Ga0157375_101597813 305
691 3300014325 Ga0163163_10040514 Ga0163163_100405144 305
692 3300014325 Ga0163163_10152034 Ga0163163_101520342 305
693 3300014968 Ga0157379_10469430 Ga0157379_104694301 305
694 3300014969 Ga0157376_10354898 Ga0157376_103548982 305
695 3300014969 Ga0157376_10525925 Ga0157376_105259252 305
696 3300025900 Ga0207710_10002412 Ga0207710_100024122 305
697 3300025912 Ga0207707_10007147 Ga0207707_100071473 305
698 3300025913 Ga0207695_10220905 Ga0207695_102209051 305
699 3300025921 Ga0207652_10078610 Ga0207652_100786103 305
700 3300025926 Ga0207659_10149339 Ga0207659_101493392 305
701 3300025940 Ga0207691_10093132 Ga0207691_100931322 305
702 3300025941 Ga0207711_10466262 Ga0207711_104662621 305
703 3300025942 Ga0207689_10025222 Ga0207689_100252224 305
704 3300025961 Ga0207712_10106426 Ga0207712_101064262 305
705 3300025972 Ga0207668_10118986 Ga0207668_101189863 305
706 3300026035 Ga0207703_10026240 Ga0207703_100262404 305
707 3300026035 Ga0207703_10033766 Ga0207703_100337662 305
708 3300026088 Ga0207641_10298302 Ga0207641_102983022 305
709 3300026095 Ga0207676_10120766 Ga0207676_101207662 305
710 3300028381 Ga0268264_10008000 Ga0268264_100080005 305
711 3300028381 Ga0268264_10025531 Ga0268264_100255312 305
712 3300031548 Ga0307408_100015360 Ga0307408_1000153605 305
713 3300031852 Ga0307410_10243692 Ga0307410_102436922 305
714 3300031901 Ga0307406_10104875 Ga0307406_101048752 305
715 3300031995 Ga0307409_100013621 Ga0307409_1000136213 305
716 3300032005 Ga0307411_10188687 Ga0307411_101886871 305
717 3300032126 Ga0307415_100139531 Ga0307415_1001395313 305
718 3300035085 Ga0373929_0000001 Ga0373929_0000001_387525_388460 305
719 3300046616 Ga0495668_0000277 Ga0495668_0000277_45892_46821 305
720 3300048912 Ga0496109_0022922 Ga0496109_0022922_1011_1943 305

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00763

THF_DHG_CYH

Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain

32

146

0.99

PF02882

THF_DHG_CYH_C

Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain

149

330

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3l07-assembly1.cif.gz_A methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase, putative bifunctional protein fold from francisella tularensis. 0.9654 2 303
2c2y-assembly1.cif.gz_A-2 three dimensional structure of bifunctional methylenetetrahydrofolate dehydrogenase-cyclohydrolase from mycobacterium tuberculosis 0.9653 3 302
4a5o-assembly2.cif.gz_D crystal structure of pseudomonas aeruginosa n5, n10- methylenetetrahydrofolate dehydrogenase-cyclohydrolase (fold) 0.9592 3 301
3l07-assembly1.cif.gz_A methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase, putative bifunctional protein fold from francisella tularensis. 0.9587 2 303
2c2y-assembly1.cif.gz_A-2 three dimensional structure of bifunctional methylenetetrahydrofolate dehydrogenase-cyclohydrolase from mycobacterium tuberculosis 0.9552 3 302
ID Description Score Start End Superfamily
af_Q0E4G1_111_191_3.40.50.10860 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9976 34 114 3.40.50.10860
3l07A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9911 34 115 3.40.50.10860
af_A0A0R0F3H3_60_174_3.40.50.10860 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9908 13 125 3.40.50.10860
af_Q0E4G1_111_191_3.40.50.10860 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9855 34 114 3.40.50.10860
4cjxA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9849 31 115 3.40.50.10860
ID Description Score Start End GO Terms
AF-A0A6N6S1Z9-F1-model_v4 methenyltetrahydrofolate cyclohydrolase (EC 3.5.4.9) 0.9989 3 121 GO:0004477
GO:0004488
GO:0005829
GO:0006164
GO:0009086
GO:0035999
AF-A0A2S8LSJ0-F1-model_v4 deleted 0.9981 40 122
AF-A0A3C1LSI1-F1-model_v4 Bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase 0.9947 8 105 GO:0004477
GO:0004488
GO:0005829
GO:0006164
GO:0009086
GO:0035999
AF-A0A353JZC0-F1-model_v4 Bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase 0.9923 1 107 GO:0000105
GO:0004477
GO:0004488
GO:0005829
GO:0006164
GO:0009086
GO:0035999
AF-A0A382NA53-F1-model_v4 methenyltetrahydrofolate cyclohydrolase (EC 3.5.4.9) 0.992 1 109 GO:0004477
GO:0004488
GO:0005829
GO:0035999

Feature Viewer

pLDDT pTM Quality
95.52 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map