F477279
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 719 | 375 | 1438 | 555 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2582580736|2583150744 |
| Length | 627 |
| Sequence | AVDGGNAGGGEEFDVVVVGSGAAGMTAALRAAHSGLSTVVVEKAAAFGGSTARSGGGVWVPGNDALRRAGVADTPEEARDYLRTIVGDVADPDRIDAYLERGPEVLRFVERTTPLRLAWVRGYSDYXPEAPGGKVVGRSAEPKPVDARLLGDERARLERPYSAPPLGVPLGQADYRWLSLIARHPRGVLTLLSLGLRWLAGLARGMRQLTMGQAIAAALRVGLLRAGVEVRLERPLVRLHTGPDPGARGSAGRXRXXGXXVXEDGREVLIRARRGVVLAAGGFEHNAELRQRYQRAPIGTEWTVGAKANTGDAITAAMDVGAAVDLMDDAWWGPSIPLPGGPWFALAERSRPGCVMVNDRGRRFGNESAPYVDAVHAMYGGEHGRGDGPGENIPTWLVFDQRYRNRYMFTGLGPRQALPGRWFKHGVVVRADTIAELADRMGVPAENLESTVERFNGFARAGEDLDFGRGRSRYDHYYGDPRNKPNPSLGELNQAPYYAVKMVPGDLGTKGGVRTDPRARVLREDGSVIPGLYAAGNSSAAVMGHTYAGPGATIGPAMVFGYLAAEDAAGRAAADAAEDTPADTVGGPTADTAEHTVGSTAEDTAEDTAGSGPVHTPRNPGTPRVRR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 2 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 37 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 44 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 46 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 47 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 51 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 52 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 53 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 54 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 55 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 56 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 57 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 58 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 60 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 61 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 62 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 63 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 67 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 68 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 69 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 70 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 71 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 72 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 73 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 97 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 98 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 148 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 149 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 150 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 151 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 152 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 153 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 154 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 155 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 156 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 157 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 158 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 159 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 160 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 161 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 162 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 163 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 164 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 165 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 166 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 167 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 168 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 169 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 170 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 171 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 172 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 173 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 174 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 175 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 176 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 177 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 178 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 179 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 180 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 181 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 182 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 183 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 184 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 185 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 186 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 187 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 188 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 189 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 190 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 191 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 192 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 193 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 194 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 195 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 196 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 197 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 198 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 199 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 200 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 201 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 202 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 251 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 252 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 253 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 254 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 255 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 256 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 257 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 258 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 259 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 260 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 261 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 262 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 263 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 264 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 265 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 266 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 267 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 268 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 269 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 270 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 271 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 272 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 273 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 274 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 275 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 276 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 297 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 298 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 299 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 300 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 301 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 302 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 303 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 308 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 309 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 310 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 311 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 312 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 313 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 314 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 315 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 316 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 317 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 318 | 2582580736 | Prauserella sp. Am3 | Isolate | Unclassified |
| 319 | 2523231044 | Gordonia rhizosphera NBRC 16068 | Isolate | Rhizosphere |
| 320 | 2547132424 | Nocardia nova SH22a | Isolate | Unclassified |
| 321 | 2551306166 | Nocardia tenerifensis NBRC 101015 | Isolate | Rhizosphere |
| 322 | 2558860112 | Pseudonocardia acaciae DSM 45401 | Isolate | Unclassified |
| 323 | 2558860280 | Kutzneria sp. 744 | Isolate | Unclassified |
| 324 | 2565956761 | Rhodococcus qingshengii BKS 20-40 | Isolate | Rhizosphere |
| 325 | 2585427649 | Amycolatopsis japonica MG417-CF17, DSM 44213 | Isolate | Unclassified |
| 326 | 2643221561 | Nocardioides sp. Root151 | Isolate | Unclassified |
| 327 | 2643221576 | Nocardioides sp. Root614 | Isolate | Unclassified |
| 328 | 2643221590 | Nocardioides sp. Root682 | Isolate | Unclassified |
| 329 | 2643221615 | Nocardioides sp. Root224 | Isolate | Unclassified |
| 330 | 2643221657 | Nocardioides sp. Root1257 | Isolate | Unclassified |
| 331 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 332 | 2643221692 | Nocardia sp. Root136 | Isolate | Unclassified |
| 333 | 2643221696 | Nocardioides sp. Root140 | Isolate | Unclassified |
| 334 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 335 | 2643221961 | Aeromicrobium sp. Root236 | Isolate | Unclassified |
| 336 | 2643221962 | Aeromicrobium sp. Root344 | Isolate | Unclassified |
| 337 | 2738541264 | Mycobacterium sp. OK889 | Isolate | Unclassified |
| 338 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 339 | 2738541308 | Rhodococcus sp. OK551 | Isolate | Unclassified |
| 340 | 2738541356 | Mycobacterium sp. OK887 | Isolate | Unclassified |
| 341 | 2738543005 | Rhodococcus sp. OK519 | Isolate | Unclassified |
| 342 | 2738543011 | Rhodococcus sp. OK611 | Isolate | Unclassified |
| 343 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 344 | 2738543034 | Rhodococcus sp. OK269 | Isolate | Unclassified |
| 345 | 2744054611 | Aldersonia kunmingensis DSM 45001 | Isolate | Rhizosphere |
| 346 | 2751185725 | Microbispora sp. NRRL B-24597 | Isolate | Unclassified |
| 347 | 2751185792 | Kitasatospora arboriphila NRRL B-24581 | Isolate | Unclassified |
| 348 | 2808606522 | Amycolatopsis sp. BJA-103 | Isolate | Unclassified |
| 349 | 2842134933 | Mycolicibacterium obuense SEMIA 442 | Isolate | Nodule |
| 350 | 2842888712 | Tsukamurella sp. R-71941 | Isolate | Unclassified |
| 351 | 2855386786 | Nocardioides ferulae EGI 63112 | Isolate | Unclassified |
| 352 | 2866612099 | Amycolatopsis suaedae 8-3EHSu | Isolate | Unclassified |
| 353 | 2889300758 | Rhodococcus sp. PvR099 | Isolate | Rhizosphere |
| 354 | 2899359706 | Amycolatopsis anabasis EGI 650086 | Isolate | Unclassified |
| 355 | 2899370129 | Amycolatopsis alkalitolerans SYSUP0005 | Isolate | Stem Tuber |
| 356 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 357 | 2902799365 | Mycolicibacterium sp. P1-5 | Isolate | Unclassified |
| 358 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 359 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 360 | 2904535858 | Rhodococcus erythropolis 2017 | Isolate | Unclassified |
| 361 | 2904765812 | Rhodococcus fascians 1590 | Isolate | Rhizosphere |
| 362 | 2915768154 | Amycolatopsis pittospori PIP199 | Isolate | Unclassified |
| 363 | 2917736166 | Amycolatopsis dendrobii DR6-1 | Isolate | Unclassified |
| 364 | 2919420072 | Rhodococcus fascians 3241 | Isolate | Rhizosphere |
| 365 | 2919432681 | Rhodococcus sp. 3258 | Isolate | Rhizosphere |
| 366 | 2919713450 | Nocardia kruczakiae 4272 | Isolate | Rhizosphere |
| 367 | 2922554459 | Rhodococcus sp. 66b | Isolate | Unclassified |
| 368 | 2928142448 | Prescottella equi DPS 2018 | Isolate | Unclassified |
| 369 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 370 | 2932398195 | Dietzia sp. 2505 | Isolate | Rhizosphere |
| 371 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 372 | 2939743619 | Rhodococcus sp. PvR044 | Isolate | Rhizosphere |
| 373 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 374 | 8003314358 | Amycolatopsis sp. MtRt-6 | Isolate | Unclassified |
| 375 | 8056207758 | Saccharopolyspora indica KCTC 29208 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.99 |
| Metatranscriptomes | 0 |
| Isolates | 10.01 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.54 |
| Nodule | 0.14 |
| Rhizoplane | 6.82 |
| Rhizosphere | 68.01 |
| Stem | 0 |
| Stem Tuber | 0.14 |
| Unclassified | 0.28 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24034J26672_10001838 | 3300002239 | Bacteria | 2861 |
| 2 | Ga0055540_1000129 | 3300003792 | Bacteria | 76241 |
| 3 | Ga0055540_1001745 | 3300003792 | Bacteria | 12460 |
| 4 | Ga0055540_1004105 | 3300003792 | Bacteria | 6743 |
| 5 | Ga0055540_1007649 | 3300003792 | Bacteria | 4034 |
| 6 | Ga0070658_10010848 | 3300005327 | Bacteria | 7306 |
| 7 | Ga0070690_100033772 | 3300005330 | Bacteria | 3204 |
| 8 | Ga0068869_100015173 | 3300005334 | Bacteria | 5161 |
| 9 | Ga0070680_100008494 | 3300005336 | Bacteria | 7865 |
| 10 | Ga0070682_100049204 | 3300005337 | Bacteria | 2627 |
| 11 | Ga0068868_100001236 | 3300005338 | Bacteria | 17545 |
| 12 | Ga0068868_100022508 | 3300005338 | Bacteria | 4757 |
| 13 | Ga0070660_100113103 | 3300005339 | Bacteria | 2161 |
| 14 | Ga0070689_100022950 | 3300005340 | Bacteria | 4666 |
| 15 | Ga0070668_100001358 | 3300005347 | Bacteria | 17516 |
| 16 | Ga0070668_100001665 | 3300005347 | Bacteria | 16122 |
| 17 | Ga0070669_100042620 | 3300005353 | Bacteria | 3303 |
| 18 | Ga0070669_100043302 | 3300005353 | Bacteria | 3278 |
| 19 | Ga0070671_100007331 | 3300005355 | Bacteria | 8807 |
| 20 | Ga0070674_100023411 | 3300005356 | Bacteria | 3997 |
| 21 | Ga0070659_100009893 | 3300005366 | Bacteria | 7014 |
| 22 | Ga0070667_100000220 | 3300005367 | Bacteria | 65980 |
| 23 | Ga0070667_100003332 | 3300005367 | Bacteria | 13718 |
| 24 | Ga0070667_100003781 | 3300005367 | Bacteria | 12869 |
| 25 | Ga0070667_100072985 | 3300005367 | Bacteria | 2925 |
| 26 | Ga0070667_100077809 | 3300005367 | Bacteria | 2833 |
| 27 | Ga0070709_10001154 | 3300005434 | Bacteria | 14514 |
| 28 | Ga0070709_10067826 | 3300005434 | Bacteria | 2292 |
| 29 | Ga0070714_100000205 | 3300005435 | Bacteria | 47895 |
| 30 | Ga0070714_100016392 | 3300005435 | Bacteria | 5981 |
| 31 | Ga0070714_100019490 | 3300005435 | Bacteria | 5529 |
| 32 | Ga0070714_100025647 | 3300005435 | Bacteria | 4866 |
| 33 | Ga0070714_100039528 | 3300005435 | Bacteria | 3972 |
| 34 | Ga0070714_100101343 | 3300005435 | Bacteria | 2537 |
| 35 | Ga0070710_10000331 | 3300005437 | Bacteria | 22606 |
| 36 | Ga0070710_10006316 | 3300005437 | Bacteria | 5684 |
| 37 | Ga0070710_10015488 | 3300005437 | Bacteria | 3862 |
| 38 | Ga0070701_10000560 | 3300005438 | Bacteria | 12897 |
| 39 | Ga0070701_10049552 | 3300005438 | Bacteria | 2172 |
| 40 | Ga0070711_100002890 | 3300005439 | Bacteria | 9897 |
| 41 | Ga0070711_100004061 | 3300005439 | Bacteria | 8602 |
| 42 | Ga0070711_100035360 | 3300005439 | Bacteria | 3339 |
| 43 | Ga0070711_100061901 | 3300005439 | Bacteria | 2607 |
| 44 | Ga0070705_100011492 | 3300005440 | Bacteria | 4468 |
| 45 | Ga0070700_100016555 | 3300005441 | Bacteria | 4202 |
| 46 | Ga0070708_100077797 | 3300005445 | Bacteria | 2998 |
| 47 | Ga0070663_100000346 | 3300005455 | Bacteria | 24250 |
| 48 | Ga0070663_100038266 | 3300005455 | Bacteria | 3346 |
| 49 | Ga0070663_100060219 | 3300005455 | Bacteria | 2730 |
| 50 | Ga0070663_100126482 | 3300005455 | Bacteria | 1936 |
| 51 | Ga0070678_100000614 | 3300005456 | Bacteria | 17487 |
| 52 | Ga0070662_100000432 | 3300005457 | Bacteria | 24786 |
| 53 | Ga0070681_10117046 | 3300005458 | Bacteria | 2601 |
| 54 | Ga0068867_100002257 | 3300005459 | Bacteria | 13556 |
| 55 | Ga0070685_10013806 | 3300005466 | Bacteria | 4270 |
| 56 | Ga0070706_100128503 | 3300005467 | Bacteria | 2364 |
| 57 | Ga0070706_100196661 | 3300005467 | Bacteria | 1883 |
| 58 | Ga0070707_100011425 | 3300005468 | Bacteria | 8279 |
| 59 | Ga0070698_100001196 | 3300005471 | Bacteria | 28804 |
| 60 | Ga0070698_100014214 | 3300005471 | Bacteria | 8415 |
| 61 | Ga0070698_100030911 | 3300005471 | Bacteria | 5553 |
| 62 | Ga0070699_100000764 | 3300005518 | Bacteria | 29736 |
| 63 | Ga0070699_100007678 | 3300005518 | Bacteria | 9379 |
| 64 | Ga0070697_100124722 | 3300005536 | Bacteria | 2157 |
| 65 | Ga0068853_100002578 | 3300005539 | Bacteria | 13618 |
| 66 | Ga0068853_100006403 | 3300005539 | Bacteria | 9354 |
| 67 | Ga0068853_100074589 | 3300005539 | Bacteria | 2960 |
| 68 | Ga0070672_100099511 | 3300005543 | Bacteria | 2357 |
| 69 | Ga0070695_100007910 | 3300005545 | Bacteria | 6296 |
| 70 | Ga0070695_100065667 | 3300005545 | Bacteria | 2363 |
| 71 | Ga0070696_100001571 | 3300005546 | Bacteria | 14959 |
| 72 | Ga0070693_100011593 | 3300005547 | Bacteria | 4442 |
| 73 | Ga0070665_100047016 | 3300005548 | Bacteria | 4332 |
| 74 | Ga0070665_100109951 | 3300005548 | Bacteria | 2758 |
| 75 | Ga0070704_100004159 | 3300005549 | Bacteria | 8350 |
| 76 | Ga0068855_100225392 | 3300005563 | Bacteria | 2101 |
| 77 | Ga0070664_100024907 | 3300005564 | Bacteria | 4957 |
| 78 | Ga0068857_100017181 | 3300005577 | Bacteria | 6338 |
| 79 | Ga0068854_100019634 | 3300005578 | Bacteria | 4557 |
| 80 | Ga0070702_100007259 | 3300005615 | Bacteria | 5298 |
| 81 | Ga0068852_100126526 | 3300005616 | Bacteria | 2347 |
| 82 | Ga0068859_100155012 | 3300005617 | Bacteria | 2367 |
| 83 | Ga0068859_100198532 | 3300005617 | Bacteria | 2090 |
| 84 | Ga0068866_10002878 | 3300005718 | Bacteria | 7088 |
| 85 | Ga0068863_100002923 | 3300005841 | Bacteria | 16925 |
| 86 | Ga0068863_100023008 | 3300005841 | Bacteria | 5957 |
| 87 | Ga0068858_100011053 | 3300005842 | Bacteria | 8533 |
| 88 | Ga0068858_100065364 | 3300005842 | Bacteria | 3365 |
| 89 | Ga0068860_100000150 | 3300005843 | Bacteria | 113021 |
| 90 | Ga0068860_100021823 | 3300005843 | Bacteria | 6194 |
| 91 | Ga0068862_100000078 | 3300005844 | Bacteria | 114008 |
| 92 | Ga0068862_100034339 | 3300005844 | Bacteria | 4290 |
| 93 | Ga0081455_10001381 | 3300005937 | Bacteria | 30015 |
| 94 | Ga0081540_1000526 | 3300005983 | Bacteria | 37391 |
| 95 | Ga0081539_10000086 | 3300005985 | Bacteria | 217801 |
| 96 | Ga0081539_10039003 | 3300005985 | Bacteria | 2808 |
| 97 | Ga0070717_10013919 | 3300006028 | Bacteria | 6179 |
| 98 | Ga0070717_10023864 | 3300006028 | Bacteria | 4853 |
| 99 | Ga0070717_10039626 | 3300006028 | Bacteria | 3834 |
| 100 | Ga0070717_10060550 | 3300006028 | Bacteria | 3135 |
| 101 | Ga0075365_10001375 | 3300006038 | Bacteria | 10939 |
| 102 | Ga0075365_10001792 | 3300006038 | Bacteria | 10019 |
| 103 | Ga0075365_10015399 | 3300006038 | Bacteria | 4626 |
| 104 | Ga0075365_10032660 | 3300006038 | Bacteria | 3348 |
| 105 | Ga0075365_10034620 | 3300006038 | Bacteria | 3262 |
| 106 | Ga0075365_10040470 | 3300006038 | Bacteria | 3039 |
| 107 | Ga0075368_10014777 | 3300006042 | Bacteria | 2888 |
| 108 | Ga0075368_10016679 | 3300006042 | Bacteria | 2739 |
| 109 | Ga0075363_100003651 | 3300006048 | Bacteria | 6605 |
| 110 | Ga0075363_100003717 | 3300006048 | Bacteria | 6561 |
| 111 | Ga0075363_100015312 | 3300006048 | Bacteria | 3768 |
| 112 | Ga0075363_100025561 | 3300006048 | Bacteria | 3013 |
| 113 | Ga0075364_10000763 | 3300006051 | Bacteria | 16886 |
| 114 | Ga0075364_10003008 | 3300006051 | Bacteria | 9522 |
| 115 | Ga0075364_10010592 | 3300006051 | Bacteria | 5577 |
| 116 | Ga0075364_10018772 | 3300006051 | Bacteria | 4335 |
| 117 | Ga0075364_10032895 | 3300006051 | Bacteria | 3335 |
| 118 | Ga0075364_10092036 | 3300006051 | Bacteria | 2013 |
| 119 | Ga0070715_10016039 | 3300006163 | Bacteria | 2807 |
| 120 | Ga0070715_10019773 | 3300006163 | Bacteria | 2588 |
| 121 | Ga0070716_100028562 | 3300006173 | Bacteria | 3006 |
| 122 | Ga0070716_100038713 | 3300006173 | Bacteria | 2641 |
| 123 | Ga0070716_100041261 | 3300006173 | Bacteria | 2570 |
| 124 | Ga0070712_100004853 | 3300006175 | Bacteria | 8316 |
| 125 | Ga0070712_100045597 | 3300006175 | Bacteria | 3028 |
| 126 | Ga0075362_10002955 | 3300006177 | Bacteria | 5837 |
| 127 | Ga0075362_10019260 | 3300006177 | Bacteria | 2835 |
| 128 | Ga0075367_10002381 | 3300006178 | Bacteria | 8561 |
| 129 | Ga0075369_10001355 | 3300006186 | Bacteria | 8324 |
| 130 | Ga0075369_10002007 | 3300006186 | Bacteria | 7167 |
| 131 | Ga0075369_10013536 | 3300006186 | Bacteria | 3240 |
| 132 | Ga0075369_10030506 | 3300006186 | Bacteria | 2271 |
| 133 | Ga0075369_10036556 | 3300006186 | Bacteria | 2090 |
| 134 | Ga0075370_10005609 | 3300006353 | Bacteria | 6259 |
| 135 | Ga0075370_10012487 | 3300006353 | Bacteria | 4490 |
| 136 | Ga0075370_10028313 | 3300006353 | Bacteria | 3114 |
| 137 | Ga0068871_100072623 | 3300006358 | Bacteria | 2834 |
| 138 | Ga0075428_100027391 | 3300006844 | Bacteria | 6305 |
| 139 | Ga0068865_100005626 | 3300006881 | Bacteria | 7608 |
| 140 | Ga0097620_100155020 | 3300006931 | Bacteria | 2367 |
| 141 | Ga0097620_100198537 | 3300006931 | Bacteria | 2090 |
| 142 | Ga0105244_10000510 | 3300009036 | Bacteria | 34754 |
| 143 | Ga0105250_10017879 | 3300009092 | Bacteria | 2879 |
| 144 | Ga0105240_10054668 | 3300009093 | Bacteria | 5002 |
| 145 | Ga0105245_10007729 | 3300009098 | Bacteria | 9417 |
| 146 | Ga0105245_10024506 | 3300009098 | Bacteria | 5299 |
| 147 | Ga0105247_10000074 | 3300009101 | Bacteria | 113207 |
| 148 | Ga0105247_10002062 | 3300009101 | Bacteria | 13920 |
| 149 | Ga0105247_10057815 | 3300009101 | Bacteria | 2398 |
| 150 | Ga0105243_10000289 | 3300009148 | Bacteria | 55479 |
| 151 | Ga0105243_10000320 | 3300009148 | Bacteria | 52858 |
| 152 | Ga0105243_10008584 | 3300009148 | Bacteria | 7839 |
| 153 | Ga0105242_10008449 | 3300009176 | Bacteria | 7911 |
| 154 | Ga0105248_10000077 | 3300009177 | Bacteria | 113148 |
| 155 | Ga0105248_10115368 | 3300009177 | Bacteria | 3029 |
| 156 | Ga0105248_10236653 | 3300009177 | Bacteria | 2056 |
| 157 | Ga0105237_10006473 | 3300009545 | Bacteria | 12981 |
| 158 | Ga0105237_10057364 | 3300009545 | Bacteria | 3897 |
| 159 | Ga0105237_10126396 | 3300009545 | Bacteria | 2551 |
| 160 | Ga0105238_10035966 | 3300009551 | Bacteria | 5035 |
| 161 | Ga0105238_10099172 | 3300009551 | Bacteria | 2896 |
| 162 | Ga0105249_10000111 | 3300009553 | Bacteria | 109164 |
| 163 | Ga0105249_10002996 | 3300009553 | Bacteria | 14570 |
| 164 | Ga0105249_10083599 | 3300009553 | Bacteria | 2972 |
| 165 | Ga0105249_10107890 | 3300009553 | Bacteria | 2628 |
| 166 | Ga0105239_10007577 | 3300010375 | Bacteria | 12444 |
| 167 | Ga0105239_10015124 | 3300010375 | Bacteria | 8553 |
| 168 | Ga0105246_10038935 | 3300011119 | Unclassified | 3199 |
| 169 | Ga0157373_10019867 | 3300013100 | Bacteria | 4887 |
| 170 | Ga0157374_10094027 | 3300013296 | Bacteria | 2864 |
| 171 | Ga0163162_10006863 | 3300013306 | Bacteria | 11047 |
| 172 | Ga0163162_10038718 | 3300013306 | Bacteria | 4759 |
| 173 | Ga0157375_10078279 | 3300013308 | Bacteria | 3339 |
| 174 | Ga0163163_10065264 | 3300014325 | Bacteria | 3613 |
| 175 | Ga0157380_10021060 | 3300014326 | Bacteria | 4886 |
| 176 | Ga0157377_10078632 | 3300014745 | Bacteria | 1923 |
| 177 | Ga0157379_10028802 | 3300014968 | Bacteria | 4939 |
| 178 | Ga0157379_10052990 | 3300014968 | Bacteria | 3624 |
| 179 | Ga0157379_10053557 | 3300014968 | Bacteria | 3604 |
| 180 | Ga0157376_10037696 | 3300014969 | Bacteria | 3928 |
| 181 | Ga0157376_10066049 | 3300014969 | Bacteria | 3057 |
| 182 | Ga0213876_10000704 | 3300021384 | Bacteria | 23476 |
| 183 | Ga0213876_10025841 | 3300021384 | Bacteria | 3096 |
| 184 | Ga0213875_10017719 | 3300021388 | Bacteria | 3436 |
| 185 | Ga0209051_1000034 | 3300025303 | Bacteria | 371498 |
| 186 | Ga0209051_1001216 | 3300025303 | Bacteria | 23170 |
| 187 | Ga0209051_1007995 | 3300025303 | Bacteria | 5678 |
| 188 | Ga0209051_1008529 | 3300025303 | Bacteria | 5414 |
| 189 | Ga0207655_1002085 | 3300025728 | Bacteria | 16785 |
| 190 | Ga0207692_10001536 | 3300025898 | Bacteria | 8669 |
| 191 | Ga0207692_10012129 | 3300025898 | Bacteria | 3692 |
| 192 | Ga0207692_10013100 | 3300025898 | Bacteria | 3588 |
| 193 | Ga0207642_10000893 | 3300025899 | Bacteria | 9359 |
| 194 | Ga0207710_10000086 | 3300025900 | Bacteria | 129918 |
| 195 | Ga0207710_10005728 | 3300025900 | Bacteria | 5335 |
| 196 | Ga0207688_10001044 | 3300025901 | Bacteria | 14204 |
| 197 | Ga0207688_10009239 | 3300025901 | Bacteria | 5372 |
| 198 | Ga0207688_10025886 | 3300025901 | Bacteria | 3225 |
| 199 | Ga0207647_10015380 | 3300025904 | Bacteria | 5247 |
| 200 | Ga0207699_10002700 | 3300025906 | Bacteria | 8386 |
| 201 | Ga0207699_10036795 | 3300025906 | Bacteria | 2793 |
| 202 | Ga0207684_10004936 | 3300025910 | Bacteria | 12444 |
| 203 | Ga0207695_10113758 | 3300025913 | Bacteria | 2682 |
| 204 | Ga0207671_10028233 | 3300025914 | Bacteria | 4194 |
| 205 | Ga0207693_10001709 | 3300025915 | Bacteria | 19320 |
| 206 | Ga0207693_10003694 | 3300025915 | Bacteria | 13054 |
| 207 | Ga0207693_10038811 | 3300025915 | Bacteria | 3749 |
| 208 | Ga0207693_10042912 | 3300025915 | Bacteria | 3560 |
| 209 | Ga0207693_10053199 | 3300025915 | Bacteria | 3177 |
| 210 | Ga0207663_10000984 | 3300025916 | Bacteria | 13026 |
| 211 | Ga0207663_10008447 | 3300025916 | Bacteria | 5383 |
| 212 | Ga0207663_10036880 | 3300025916 | Bacteria | 2943 |
| 213 | Ga0207662_10014442 | 3300025918 | Bacteria | 4433 |
| 214 | Ga0207657_10014838 | 3300025919 | Bacteria | 7584 |
| 215 | Ga0207646_10034486 | 3300025922 | Bacteria | 4573 |
| 216 | Ga0207694_10077616 | 3300025924 | Unclassified | 2603 |
| 217 | Ga0207687_10014059 | 3300025927 | Bacteria | 5233 |
| 218 | Ga0207700_10002848 | 3300025928 | Bacteria | 9949 |
| 219 | Ga0207700_10024776 | 3300025928 | Bacteria | 4157 |
| 220 | Ga0207700_10073387 | 3300025928 | Bacteria | 2642 |
| 221 | Ga0207664_10001897 | 3300025929 | Bacteria | 13745 |
| 222 | Ga0207664_10004784 | 3300025929 | Bacteria | 9201 |
| 223 | Ga0207664_10033281 | 3300025929 | Bacteria | 3958 |
| 224 | Ga0207664_10049593 | 3300025929 | Bacteria | 3306 |
| 225 | Ga0207664_10067999 | 3300025929 | Bacteria | 2860 |
| 226 | Ga0207644_10012148 | 3300025931 | Bacteria | 5714 |
| 227 | Ga0207690_10096583 | 3300025932 | Bacteria | 2101 |
| 228 | Ga0207686_10009036 | 3300025934 | Bacteria | 5396 |
| 229 | Ga0207709_10000326 | 3300025935 | Bacteria | 51484 |
| 230 | Ga0207709_10004680 | 3300025935 | Bacteria | 7872 |
| 231 | Ga0207709_10028933 | 3300025935 | Bacteria | 3208 |
| 232 | Ga0207709_10052392 | 3300025935 | Bacteria | 2506 |
| 233 | Ga0207704_10045872 | 3300025938 | Bacteria | 2600 |
| 234 | Ga0207665_10005509 | 3300025939 | Bacteria | 8449 |
| 235 | Ga0207665_10007441 | 3300025939 | Bacteria | 7241 |
| 236 | Ga0207665_10012962 | 3300025939 | Bacteria | 5481 |
| 237 | Ga0207665_10016807 | 3300025939 | Bacteria | 4805 |
| 238 | Ga0207691_10024114 | 3300025940 | Bacteria | 5721 |
| 239 | Ga0207711_10002507 | 3300025941 | Bacteria | 16367 |
| 240 | Ga0207711_10044465 | 3300025941 | Bacteria | 3791 |
| 241 | Ga0207689_10041452 | 3300025942 | Bacteria | 3810 |
| 242 | Ga0207661_10108706 | 3300025944 | Bacteria | 2342 |
| 243 | Ga0207667_10017308 | 3300025949 | Bacteria | 8117 |
| 244 | Ga0207651_10035848 | 3300025960 | Bacteria | 3232 |
| 245 | Ga0207712_10000359 | 3300025961 | Bacteria | 40273 |
| 246 | Ga0207668_10000928 | 3300025972 | Bacteria | 17586 |
| 247 | Ga0207640_10001743 | 3300025981 | Bacteria | 11668 |
| 248 | Ga0207658_10003085 | 3300025986 | Bacteria | 11913 |
| 249 | Ga0207658_10004646 | 3300025986 | Bacteria | 9519 |
| 250 | Ga0207658_10007205 | 3300025986 | Bacteria | 7580 |
| 251 | Ga0207658_10063236 | 3300025986 | Bacteria | 2773 |
| 252 | Ga0207703_10065116 | 3300026035 | Bacteria | 2994 |
| 253 | Ga0207639_10005623 | 3300026041 | Bacteria | 8483 |
| 254 | Ga0207639_10056639 | 3300026041 | Bacteria | 3005 |
| 255 | Ga0207678_10000470 | 3300026067 | Bacteria | 36474 |
| 256 | Ga0207678_10008317 | 3300026067 | Bacteria | 9144 |
| 257 | Ga0207678_10012535 | 3300026067 | Bacteria | 7446 |
| 258 | Ga0207678_10044269 | 3300026067 | Bacteria | 3850 |
| 259 | Ga0207708_10010031 | 3300026075 | Bacteria | 7035 |
| 260 | Ga0207641_10001160 | 3300026088 | Bacteria | 26484 |
| 261 | Ga0207641_10003664 | 3300026088 | Bacteria | 13534 |
| 262 | Ga0207648_10002259 | 3300026089 | Bacteria | 20841 |
| 263 | Ga0207648_10071264 | 3300026089 | Bacteria | 3029 |
| 264 | Ga0207674_10006266 | 3300026116 | Bacteria | 14017 |
| 265 | Ga0207675_100032367 | 3300026118 | Bacteria | 4870 |
| 266 | Ga0207683_10001470 | 3300026121 | Bacteria | 21244 |
| 267 | Ga0207683_10003942 | 3300026121 | Bacteria | 12878 |
| 268 | Ga0207698_10010836 | 3300026142 | Bacteria | 5884 |
| 269 | Ga0268266_10031218 | 3300028379 | Bacteria | 4523 |
| 270 | Ga0268265_10000012 | 3300028380 | Bacteria | 343132 |
| 271 | Ga0268264_10000104 | 3300028381 | Bacteria | 217837 |
| 272 | Ga0268264_10000155 | 3300028381 | Bacteria | 156029 |
| 273 | Ga0265337_1000189 | 3300028556 | Bacteria | 32471 |
| 274 | Ga0265334_10004354 | 3300028573 | Bacteria | 6295 |
| 275 | Ga0265338_10001286 | 3300028800 | Bacteria | 41166 |
| 276 | Ga0265338_10029310 | 3300028800 | Bacteria | 5457 |
| 277 | Ga0265338_10043965 | 3300028800 | Bacteria | 4131 |
| 278 | Ga0307511_10001088 | 3300030521 | Bacteria | 28882 |
| 279 | Ga0307512_10018221 | 3300030522 | Bacteria | 6418 |
| 280 | Ga0316176_1055854 | 3300030732 | Bacteria | 6325 |
| 281 | Ga0316182_1003641 | 3300030745 | Bacteria | 4332 |
| 282 | Ga0265332_10003210 | 3300031238 | Bacteria | 7960 |
| 283 | Ga0265340_10002821 | 3300031247 | Bacteria | 9890 |
| 284 | Ga0265327_10000004 | 3300031251 | Bacteria | 803973 |
| 285 | Ga0265327_10000274 | 3300031251 | Bacteria | 101723 |
| 286 | Ga0265327_10001702 | 3300031251 | Bacteria | 26264 |
| 287 | Ga0307513_10000198 | 3300031456 | Bacteria | 86436 |
| 288 | Ga0265314_10032628 | 3300031711 | Bacteria | 3828 |
| 289 | Ga0307413_10055223 | 3300031824 | Bacteria | 2415 |
| 290 | Ga0307518_10000486 | 3300031838 | Bacteria | 30309 |
| 291 | Ga0307409_100007560 | 3300031995 | Bacteria | 6512 |
| 292 | Ga0307409_100112138 | 3300031995 | Bacteria | 2289 |
| 293 | Ga0307507_10074129 | 3300033179 | Bacteria | 3055 |
| 294 | Ga0373926_0010197 | 3300035083 | Bacteria | 3145 |
| 295 | Ga0373934_0004253 | 3300035086 | Bacteria | 5283 |
| 296 | Ga0373934_0022809 | 3300035086 | Bacteria | 2415 |
| 297 | Ga0373940_0013936 | 3300035088 | Bacteria | 1954 |
| 298 | Ga0373944_0000572 | 3300035089 | Bacteria | 8715 |
| 299 | Ga0373944_0003552 | 3300035089 | Bacteria | 4031 |
| 300 | Ga0373923_0013836 | 3300035111 | Bacteria | 3015 |
| 301 | Ga0373923_0024889 | 3300035111 | Bacteria | 2367 |
| 302 | Ga0373936_0001661 | 3300035113 | Bacteria | 8152 |
| 303 | Ga0373945_0000063 | 3300035116 | Bacteria | 23921 |
| 304 | Ga0373953_0008677 | 3300035117 | Bacteria | 3462 |
| 305 | Ga0373953_0028766 | 3300035117 | Bacteria | 2145 |
| 306 | Ga0373956_0007134 | 3300035119 | Bacteria | 4495 |
| 307 | Ga0373943_0000639 | 3300035170 | Bacteria | 15155 |
| 308 | Ga0373943_0003607 | 3300035170 | Bacteria | 7043 |
| 309 | Ga0373946_0000960 | 3300035171 | Bacteria | 9878 |
| 310 | Ga0373924_0009366 | 3300035410 | Bacteria | 3585 |
| 311 | Ga0373935_0000853 | 3300035692 | Bacteria | 16426 |
| 312 | Ga0373927_0001934 | 3300035695 | Bacteria | 15296 |
| 313 | Ga0373927_0025767 | 3300035695 | Bacteria | 3844 |
| 314 | Ga0373933_0004818 | 3300035724 | Bacteria | 7374 |
| 315 | Ga0373947_0000952 | 3300035725 | Bacteria | 17638 |
| 316 | Ga0373937_0026885 | 3300036401 | Bacteria | 5201 |
| 317 | Ga0373937_0080780 | 3300036401 | Bacteria | 3007 |
| 318 | Ga0373925_0000072 | 3300037068 | Bacteria | 106707 |
| 319 | Ga0373925_0002590 | 3300037068 | Bacteria | 14378 |
| 320 | Ga0373925_0007011 | 3300037068 | Bacteria | 8230 |
| 321 | Ga0436364_0410131 | 3300037853 | Bacteria | 3778 |
| 322 | Ga0436364_0591707 | 3300037853 | Bacteria | 7576 |
| 323 | Ga0436364_1438977 | 3300037853 | Bacteria | 7858 |
| 324 | Ga0436365_0341904 | 3300039437 | Bacteria | 7820 |
| 325 | Ga0436365_1870027 | 3300039437 | Bacteria | 50519 |
| 326 | Ga0439461_0000259 | 3300041410 | Bacteria | 7544 |
| 327 | Ga0439465_0000144 | 3300041413 | Bacteria | 17526 |
| 328 | Ga0439465_0001423 | 3300041413 | Bacteria | 7741 |
| 329 | Ga0439465_0004106 | 3300041413 | Bacteria | 4737 |
| 330 | Ga0451837_1277956 | 3300041494 | Bacteria | 1828 |
| 331 | Ga0451843_0112177 | 3300041509 | Bacteria | 2156 |
| 332 | Ga0439431_0001040 | 3300041997 | Bacteria | 6026 |
| 333 | Ga0439448_0018703 | 3300042005 | Bacteria | 2127 |
| 334 | Ga0439434_0007193 | 3300042435 | Bacteria | 3260 |
| 335 | Ga0466972_0001659 | 3300044658 | Bacteria | 10892 |
| 336 | Ga0466972_0009368 | 3300044658 | Bacteria | 4923 |
| 337 | Ga0466972_0018184 | 3300044658 | Bacteria | 3516 |
| 338 | Ga0466972_0047671 | 3300044658 | Bacteria | 2072 |
| 339 | Ga0466965_0000192 | 3300044683 | Bacteria | 18963 |
| 340 | Ga0466965_0009126 | 3300044683 | Bacteria | 4603 |
| 341 | Ga0466965_0036791 | 3300044683 | Bacteria | 2402 |
| 342 | Ga0466966_0009760 | 3300044684 | Bacteria | 6361 |
| 343 | Ga0466966_0018446 | 3300044684 | Bacteria | 4602 |
| 344 | Ga0466966_0023330 | 3300044684 | Bacteria | 4052 |
| 345 | Ga0466966_0062324 | 3300044684 | Bacteria | 2351 |
| 346 | Ga0466961_0001778 | 3300044693 | Bacteria | 13350 |
| 347 | Ga0466961_0004127 | 3300044693 | Bacteria | 9071 |
| 348 | Ga0466961_0029585 | 3300044693 | Bacteria | 3519 |
| 349 | Ga0466963_0018690 | 3300044694 | Bacteria | 4338 |
| 350 | Ga0466963_0022452 | 3300044694 | Bacteria | 3996 |
| 351 | Ga0466963_0129564 | 3300044694 | Bacteria | 1742 |
| 352 | Ga0466971_0019283 | 3300044719 | Bacteria | 3028 |
| 353 | Ga0466971_0026608 | 3300044719 | Bacteria | 2586 |
| 354 | Ga0466968_0001060 | 3300044735 | Bacteria | 9750 |
| 355 | Ga0466968_0006556 | 3300044735 | Bacteria | 4394 |
| 356 | Ga0466968_0022210 | 3300044735 | Bacteria | 2578 |
| 357 | Ga0466970_0004142 | 3300044765 | Bacteria | 7131 |
| 358 | Ga0466970_0016998 | 3300044765 | Bacteria | 3756 |
| 359 | Ga0466970_0049113 | 3300044765 | Bacteria | 2251 |
| 360 | Ga0466960_0000268 | 3300044901 | Bacteria | 17971 |
| 361 | Ga0466960_0000775 | 3300044901 | Bacteria | 11198 |
| 362 | Ga0466960_0002460 | 3300044901 | Bacteria | 6964 |
| 363 | Ga0466960_0002894 | 3300044901 | Bacteria | 6523 |
| 364 | Ga0466959_0003887 | 3300045049 | Bacteria | 9913 |
| 365 | Ga0466959_0009155 | 3300045049 | Bacteria | 7032 |
| 366 | Ga0466959_0014938 | 3300045049 | Bacteria | 5657 |
| 367 | Ga0466959_0025109 | 3300045049 | Bacteria | 4414 |
| 368 | Ga0466959_0070815 | 3300045049 | Bacteria | 2526 |
| 369 | Ga0466958_0001690 | 3300045836 | Bacteria | 10637 |
| 370 | Ga0466958_0017177 | 3300045836 | Bacteria | 4178 |
| 371 | Ga0466958_0044518 | 3300045836 | Bacteria | 2675 |
| 372 | Ga0466958_0053131 | 3300045836 | Bacteria | 2457 |
| 373 | Ga0466967_0002377 | 3300045976 | Bacteria | 11654 |
| 374 | Ga0466967_0004350 | 3300045976 | Bacteria | 9535 |
| 375 | Ga0466967_0006781 | 3300045976 | Bacteria | 8158 |
| 376 | Ga0466967_0007847 | 3300045976 | Bacteria | 7754 |
| 377 | Ga0466967_0032717 | 3300045976 | Bacteria | 4395 |
| 378 | Ga0466967_0037235 | 3300045976 | Bacteria | 4161 |
| 379 | Ga0466967_0088597 | 3300045976 | Bacteria | 2809 |
| 380 | Ga0466967_0108046 | 3300045976 | Bacteria | 2552 |
| 381 | Ga0466967_0139289 | 3300045976 | Bacteria | 2259 |
| 382 | Ga0495592_0000831 | 3300046454 | Bacteria | 21457 |
| 383 | Ga0495592_0007188 | 3300046454 | Bacteria | 8345 |
| 384 | Ga0495603_0014944 | 3300046455 | Bacteria | 4694 |
| 385 | Ga0495603_0091492 | 3300046455 | Bacteria | 1778 |
| 386 | Ga0495629_0026031 | 3300046459 | Bacteria | 4157 |
| 387 | Ga0495629_0092353 | 3300046459 | Bacteria | 2113 |
| 388 | Ga0495638_0055236 | 3300046460 | Bacteria | 2466 |
| 389 | Ga0495641_0007985 | 3300046461 | Bacteria | 6522 |
| 390 | Ga0495641_0012223 | 3300046461 | Bacteria | 4818 |
| 391 | Ga0495641_0013375 | 3300046461 | Bacteria | 4514 |
| 392 | Ga0495651_0003087 | 3300046462 | Bacteria | 12860 |
| 393 | Ga0495651_0010663 | 3300046462 | Bacteria | 7070 |
| 394 | Ga0495651_0037455 | 3300046462 | Bacteria | 3775 |
| 395 | Ga0495653_0002608 | 3300046463 | Bacteria | 14343 |
| 396 | Ga0495653_0012520 | 3300046463 | Bacteria | 6925 |
| 397 | Ga0495580_0017702 | 3300046472 | Bacteria | 5319 |
| 398 | Ga0495582_0002871 | 3300046473 | Bacteria | 9635 |
| 399 | Ga0495582_0086589 | 3300046473 | Bacteria | 1743 |
| 400 | Ga0495639_0026071 | 3300046475 | Bacteria | 2581 |
| 401 | Ga0495662_0014879 | 3300046476 | Bacteria | 3780 |
| 402 | Ga0495662_0021426 | 3300046476 | Bacteria | 3124 |
| 403 | Ga0495664_0000220 | 3300046477 | Bacteria | 27274 |
| 404 | Ga0495664_0023634 | 3300046477 | Bacteria | 3567 |
| 405 | Ga0495664_0032198 | 3300046477 | Bacteria | 3076 |
| 406 | Ga0495608_0023048 | 3300046511 | Bacteria | 4269 |
| 407 | Ga0495608_0031398 | 3300046511 | Bacteria | 3592 |
| 408 | Ga0495608_0039926 | 3300046511 | Bacteria | 3144 |
| 409 | Ga0495608_0047264 | 3300046511 | Bacteria | 2861 |
| 410 | Ga0495608_0064323 | 3300046511 | Bacteria | 2404 |
| 411 | Ga0495618_0017792 | 3300046514 | Bacteria | 4361 |
| 412 | Ga0495618_0029410 | 3300046514 | Bacteria | 3428 |
| 413 | Ga0495628_0071698 | 3300046516 | Bacteria | 2699 |
| 414 | Ga0495630_0027031 | 3300046517 | Bacteria | 4252 |
| 415 | Ga0495666_0005772 | 3300046526 | Bacteria | 6238 |
| 416 | Ga0495652_0109366 | 3300046529 | Bacteria | 2225 |
| 417 | Ga0495665_0004311 | 3300046531 | Bacteria | 7684 |
| 418 | Ga0495665_0035542 | 3300046531 | Bacteria | 2661 |
| 419 | Ga0495640_0006614 | 3300046533 | Bacteria | 9142 |
| 420 | Ga0495640_0023854 | 3300046533 | Bacteria | 4450 |
| 421 | Ga0495640_0024392 | 3300046533 | Bacteria | 4400 |
| 422 | Ga0495586_0006789 | 3300046535 | Bacteria | 6105 |
| 423 | Ga0495586_0025786 | 3300046535 | Bacteria | 3145 |
| 424 | Ga0495587_0014653 | 3300046536 | Bacteria | 4911 |
| 425 | Ga0495587_0022101 | 3300046536 | Bacteria | 3918 |
| 426 | Ga0495587_0023299 | 3300046536 | Bacteria | 3804 |
| 427 | Ga0495645_0070035 | 3300046543 | Bacteria | 2531 |
| 428 | Ga0495667_0003797 | 3300046559 | Bacteria | 10145 |
| 429 | Ga0495667_0008305 | 3300046559 | Bacteria | 7037 |
| 430 | Ga0495667_0029986 | 3300046559 | Bacteria | 3657 |
| 431 | Ga0495668_0027125 | 3300046616 | Bacteria | 3245 |
| 432 | Ga0495668_0039470 | 3300046616 | Bacteria | 2635 |
| 433 | Ga0495634_0024194 | 3300046642 | Bacteria | 4264 |
| 434 | Ga0495635_0001457 | 3300046663 | Bacteria | 15839 |
| 435 | Ga0495635_0009705 | 3300046663 | Bacteria | 6729 |
| 436 | Ga0495588_0043991 | 3300046674 | Bacteria | 2286 |
| 437 | Ga0495657_0008915 | 3300046675 | Bacteria | 7639 |
| 438 | Ga0495657_0012315 | 3300046675 | Bacteria | 6355 |
| 439 | Ga0495599_0033405 | 3300046678 | Bacteria | 3232 |
| 440 | Ga0495623_0007354 | 3300046679 | Bacteria | 7148 |
| 441 | Ga0495646_0003847 | 3300046680 | Bacteria | 9381 |
| 442 | Ga0495646_0012031 | 3300046680 | Bacteria | 5505 |
| 443 | Ga0495658_0002896 | 3300046683 | Bacteria | 8620 |
| 444 | Ga0495624_0006089 | 3300046690 | Bacteria | 8596 |
| 445 | Ga0495624_0053025 | 3300046690 | Bacteria | 2561 |
| 446 | Ga0495600_0029983 | 3300046809 | Bacteria | 3523 |
| 447 | Ga0495600_0041632 | 3300046809 | Bacteria | 2994 |
| 448 | Ga0495581_0004679 | 3300047315 | Bacteria | 7906 |
| 449 | Ga0495581_0024853 | 3300047315 | Bacteria | 3471 |
| 450 | Ga0495604_0022284 | 3300047317 | Bacteria | 5057 |
| 451 | Ga0495674_0003143 | 3300047319 | Bacteria | 16039 |
| 452 | Ga0495674_0080199 | 3300047319 | Bacteria | 2801 |
| 453 | Ga0495674_0085516 | 3300047319 | Bacteria | 2701 |
| 454 | Ga0495672_0002758 | 3300047320 | Bacteria | 15727 |
| 455 | Ga0495672_0021511 | 3300047320 | Bacteria | 4206 |
| 456 | Ga0495676_0006015 | 3300047321 | Bacteria | 11149 |
| 457 | Ga0495676_0023539 | 3300047321 | Bacteria | 5344 |
| 458 | Ga0495680_0013293 | 3300047322 | Bacteria | 7189 |
| 459 | Ga0495680_0014676 | 3300047322 | Bacteria | 6776 |
| 460 | Ga0495680_0026724 | 3300047322 | Bacteria | 4752 |
| 461 | Ga0495680_0031254 | 3300047322 | Bacteria | 4336 |
| 462 | Ga0495680_0034264 | 3300047322 | Bacteria | 4103 |
| 463 | Ga0495683_0000421 | 3300047323 | Bacteria | 33926 |
| 464 | Ga0495675_0030233 | 3300047444 | Bacteria | 3456 |
| 465 | Ga0495675_0030330 | 3300047444 | Bacteria | 3450 |
| 466 | Ga0495675_0074013 | 3300047444 | Bacteria | 2147 |
| 467 | Ga0495684_0010160 | 3300047471 | Bacteria | 7280 |
| 468 | Ga0495684_0039979 | 3300047471 | Bacteria | 3595 |
| 469 | Ga0495684_0074705 | 3300047471 | Bacteria | 2576 |
| 470 | Ga0495686_0002680 | 3300047472 | Bacteria | 16392 |
| 471 | Ga0495593_0005040 | 3300047673 | Bacteria | 7817 |
| 472 | Ga0495614_0013100 | 3300048089 | Bacteria | 3637 |
| 473 | Ga0496100_0000169 | 3300048903 | Bacteria | 36139 |
| 474 | Ga0496100_0001459 | 3300048903 | Bacteria | 11592 |
| 475 | Ga0496100_0028133 | 3300048903 | Bacteria | 3464 |
| 476 | Ga0496100_0110048 | 3300048903 | Bacteria | 1912 |
| 477 | Ga0496101_0000059 | 3300048904 | Bacteria | 130521 |
| 478 | Ga0496101_0000808 | 3300048904 | Bacteria | 18478 |
| 479 | Ga0496101_0011656 | 3300048904 | Bacteria | 5840 |
| 480 | Ga0496102_0000083 | 3300048905 | Bacteria | 138102 |
| 481 | Ga0496102_0000621 | 3300048905 | Bacteria | 36593 |
| 482 | Ga0496102_0000721 | 3300048905 | Bacteria | 32596 |
| 483 | Ga0496102_0001551 | 3300048905 | Bacteria | 20272 |
| 484 | Ga0496102_0004351 | 3300048905 | Bacteria | 11970 |
| 485 | Ga0496102_0005748 | 3300048905 | Bacteria | 10540 |
| 486 | Ga0496102_0019868 | 3300048905 | Bacteria | 5923 |
| 487 | Ga0496102_0054514 | 3300048905 | Bacteria | 3646 |
| 488 | Ga0496102_0095247 | 3300048905 | Bacteria | 2759 |
| 489 | Ga0496103_0000060 | 3300048906 | Bacteria | 138526 |
| 490 | Ga0496103_0000215 | 3300048906 | Bacteria | 57372 |
| 491 | Ga0496103_0000548 | 3300048906 | Bacteria | 30031 |
| 492 | Ga0496103_0060795 | 3300048906 | Bacteria | 2348 |
| 493 | Ga0496104_0002283 | 3300048907 | Bacteria | 16537 |
| 494 | Ga0496104_0017658 | 3300048907 | Bacteria | 6503 |
| 495 | Ga0496105_0007022 | 3300048908 | Bacteria | 8675 |
| 496 | Ga0496106_0000656 | 3300048909 | Bacteria | 24775 |
| 497 | Ga0496106_0011638 | 3300048909 | Bacteria | 6503 |
| 498 | Ga0496106_0011826 | 3300048909 | Bacteria | 6444 |
| 499 | Ga0496106_0047585 | 3300048909 | Bacteria | 3228 |
| 500 | Ga0496107_0004768 | 3300048910 | Bacteria | 9210 |
| 501 | Ga0496107_0015313 | 3300048910 | Bacteria | 5373 |
| 502 | Ga0496107_0041508 | 3300048910 | Bacteria | 3303 |
| 503 | Ga0496108_0001059 | 3300048911 | Bacteria | 21465 |
| 504 | Ga0496108_0019695 | 3300048911 | Bacteria | 5542 |
| 505 | Ga0496109_0000972 | 3300048912 | Bacteria | 23688 |
| 506 | Ga0496109_0097458 | 3300048912 | Bacteria | 2725 |
| 507 | Ga0496109_0116257 | 3300048912 | Bacteria | 2489 |
| 508 | Ga0496110_0005418 | 3300048913 | Bacteria | 10009 |
| 509 | Ga0496110_0049355 | 3300048913 | Bacteria | 3692 |
| 510 | Ga0496110_0057826 | 3300048913 | Bacteria | 3415 |
| 511 | Ga0496110_0118425 | 3300048913 | Bacteria | 2385 |
| 512 | Ga0496111_0005465 | 3300048914 | Bacteria | 8147 |
| 513 | Ga0496111_0074744 | 3300048914 | Bacteria | 2468 |
| 514 | Ga0496112_0000453 | 3300048915 | Bacteria | 27330 |
| 515 | Ga0496112_0037669 | 3300048915 | Bacteria | 4720 |
| 516 | Ga0496113_0010905 | 3300048916 | Bacteria | 6031 |
| 517 | Ga0496113_0023044 | 3300048916 | Bacteria | 4412 |
| 518 | Ga0496114_0006910 | 3300048917 | Bacteria | 8941 |
| 519 | Ga0496114_0011111 | 3300048917 | Bacteria | 7186 |
| 520 | Ga0496115_0002853 | 3300048918 | Bacteria | 12442 |
| 521 | Ga0496115_0014441 | 3300048918 | Bacteria | 5977 |
| 522 | Ga0496116_0000159 | 3300048919 | Bacteria | 138102 |
| 523 | Ga0496116_0002589 | 3300048919 | Bacteria | 18828 |
| 524 | Ga0496116_0005469 | 3300048919 | Bacteria | 11761 |
| 525 | Ga0496117_0000167 | 3300048920 | Bacteria | 138102 |
| 526 | Ga0496117_0002257 | 3300048920 | Bacteria | 24885 |
| 527 | Ga0496117_0004619 | 3300048920 | Bacteria | 15002 |
| 528 | Ga0496117_0024942 | 3300048920 | Bacteria | 4710 |
| 529 | Ga0496118_0000121 | 3300048921 | Bacteria | 138102 |
| 530 | Ga0496118_0000160 | 3300048921 | Bacteria | 120349 |
| 531 | Ga0496118_0002464 | 3300048921 | Bacteria | 24866 |
| 532 | Ga0496118_0020939 | 3300048921 | Bacteria | 5781 |
| 533 | Ga0496119_0005170 | 3300048922 | Bacteria | 12628 |
| 534 | Ga0496119_0015087 | 3300048922 | Bacteria | 5981 |
| 535 | Ga0496119_0022220 | 3300048922 | Bacteria | 4551 |
| 536 | Ga0496120_0007715 | 3300048923 | Bacteria | 7965 |
| 537 | Ga0496120_0023124 | 3300048923 | Bacteria | 3895 |
| 538 | Ga0496121_0000002 | 3300048924 | Bacteria | 1494588 |
| 539 | Ga0496121_0000690 | 3300048924 | Bacteria | 62907 |
| 540 | Ga0496121_0007408 | 3300048924 | Bacteria | 13261 |
| 541 | Ga0496122_0001116 | 3300048925 | Bacteria | 46294 |
| 542 | Ga0496123_0018847 | 3300048926 | Bacteria | 5467 |
| 543 | Ga0496124_0000002 | 3300048927 | Bacteria | 1494588 |
| 544 | Ga0496124_0039098 | 3300048927 | Bacteria | 4115 |
| 545 | Ga0496125_0000002 | 3300048928 | Bacteria | 1480920 |
| 546 | Ga0496126_0000009 | 3300048929 | Bacteria | 750350 |
| 547 | Ga0496126_0001058 | 3300048929 | Bacteria | 46539 |
| 548 | Ga0496126_0004263 | 3300048929 | Bacteria | 17201 |
| 549 | Ga0496126_0009352 | 3300048929 | Bacteria | 10424 |
| 550 | Ga0496126_0029025 | 3300048929 | Bacteria | 5259 |
| 551 | Ga0496126_0106225 | 3300048929 | Bacteria | 2450 |
| 552 | Ga0501032_0000241 | 3300049569 | Bacteria | 45455 |
| 553 | Ga0501032_0015556 | 3300049569 | Bacteria | 5366 |
| 554 | Ga0501032_0017352 | 3300049569 | Bacteria | 5054 |
| 555 | Ga0501033_0008007 | 3300049570 | Bacteria | 8187 |
| 556 | Ga0501033_0017603 | 3300049570 | Bacteria | 5398 |
| 557 | Ga0501034_0033129 | 3300049571 | Bacteria | 5244 |
| 558 | Ga0501034_0112472 | 3300049571 | Bacteria | 2713 |
| 559 | Ga0501036_0004947 | 3300049572 | Bacteria | 10770 |
| 560 | Ga0501037_0000194 | 3300049573 | Bacteria | 56286 |
| 561 | Ga0501037_0001558 | 3300049573 | Bacteria | 16726 |
| 562 | Ga0501038_0000163 | 3300049574 | Bacteria | 56384 |
| 563 | Ga0501038_0007570 | 3300049574 | Bacteria | 10014 |
| 564 | Ga0501038_0055596 | 3300049574 | Bacteria | 3399 |
| 565 | Ga0501039_0003023 | 3300049575 | Bacteria | 12577 |
| 566 | Ga0501042_0004930 | 3300049578 | Bacteria | 8545 |
| 567 | Ga0501042_0015464 | 3300049578 | Bacteria | 5227 |
| 568 | Ga0501043_0022464 | 3300049579 | Bacteria | 4947 |
| 569 | Ga0501046_0002371 | 3300049580 | Bacteria | 17711 |
| 570 | Ga0501046_0002488 | 3300049580 | Bacteria | 17265 |
| 571 | Ga0501047_0001872 | 3300049581 | Bacteria | 20254 |
| 572 | Ga0501047_0011257 | 3300049581 | Bacteria | 8467 |
| 573 | Ga0501047_0038481 | 3300049581 | Bacteria | 4628 |
| 574 | Ga0501048_0000286 | 3300049582 | Bacteria | 34220 |
| 575 | Ga0501048_0009104 | 3300049582 | Bacteria | 7475 |
| 576 | Ga0501069_0022549 | 3300049585 | Bacteria | 3427 |
| 577 | Ga0501070_0001787 | 3300049586 | Bacteria | 18980 |
| 578 | Ga0501070_0009494 | 3300049586 | Bacteria | 8225 |
| 579 | Ga0501070_0058211 | 3300049586 | Bacteria | 3203 |
| 580 | Ga0501072_0094486 | 3300049588 | Bacteria | 2376 |
| 581 | Ga0501073_0013132 | 3300049589 | Bacteria | 6038 |
| 582 | Ga0501083_0033278 | 3300049744 | Bacteria | 3531 |
| 583 | Ga0501035_0000218 | 3300049822 | Bacteria | 68475 |
| 584 | Ga0501035_0004799 | 3300049822 | Bacteria | 12816 |
| 585 | Ga0501035_0010663 | 3300049822 | Bacteria | 8509 |
| 586 | Ga0501044_0000639 | 3300049823 | Bacteria | 42286 |
| 587 | Ga0501044_0000719 | 3300049823 | Bacteria | 39936 |
| 588 | Ga0501044_0076481 | 3300049823 | Bacteria | 3397 |
| 589 | Ga0501045_0069066 | 3300049824 | Bacteria | 2597 |
| 590 | Ga0501045_0094054 | 3300049824 | Bacteria | 2217 |
| 591 | nmdc:mga03683_10050_c1 | 3300050489 | Bacteria | 3383 |
| 592 | nmdc:mga03n38_15218_c1 | 3300050490 | Bacteria | 2966 |
| 593 | nmdc:mga03n38_19382_c2 | 3300050490 | Bacteria | 2078 |
| 594 | nmdc:mga03n38_2351_c1 | 3300050490 | Bacteria | 5817 |
| 595 | nmdc:mga03n38_3217_c1 | 3300050490 | Bacteria | 5206 |
| 596 | nmdc:mga03n38_3785_c1 | 3300050490 | Bacteria | 4910 |
| 597 | nmdc:mga03n38_449_c1 | 3300050490 | Bacteria | 10277 |
| 598 | nmdc:mga03n38_4691_c1 | 3300050490 | Bacteria | 4562 |
| 599 | nmdc:mga00v17_11628_c1 | 3300050491 | Bacteria | 4839 |
| 600 | nmdc:mga00v17_12920_c1 | 3300050491 | Bacteria | 4622 |
| 601 | nmdc:mga00v17_25153_c1 | 3300050491 | Bacteria | 3458 |
| 602 | nmdc:mga00v17_27433_c1 | 3300050491 | Bacteria | 3325 |
| 603 | nmdc:mga00v17_29376_c1 | 3300050491 | Bacteria | 3227 |
| 604 | nmdc:mga00v17_34946_c1 | 3300050491 | Bacteria | 2687 |
| 605 | nmdc:mga00v17_3754_c1 | 3300050491 | Bacteria | 7841 |
| 606 | nmdc:mga00v17_50049_c1 | 3300050491 | Bacteria | 2537 |
| 607 | nmdc:mga00v17_5063_c1 | 3300050491 | Bacteria | 6919 |
| 608 | nmdc:mga00v17_93385_c1 | 3300050491 | Bacteria | 1892 |
| 609 | nmdc:mga0yw44_13504_c1 | 3300050492 | Bacteria | 4304 |
| 610 | nmdc:mga0yw44_33739_c1 | 3300050492 | Bacteria | 2993 |
| 611 | nmdc:mga0yw44_34254_c1 | 3300050492 | Bacteria | 2974 |
| 612 | nmdc:mga0yw44_4742_c1 | 3300050492 | Bacteria | 6298 |
| 613 | nmdc:mga0yw44_71469_c1 | 3300050492 | Bacteria | 2155 |
| 614 | nmdc:mga0yw44_72833_c1 | 3300050492 | Bacteria | 2136 |
| 615 | nmdc:mga0yw44_88268_c1 | 3300050492 | Bacteria | 1955 |
| 616 | nmdc:mga06z11_70924_c1 | 3300050494 | Bacteria | 1843 |
| 617 | nmdc:mga06z11_8231_c1 | 3300050494 | Bacteria | 4335 |
| 618 | nmdc:mga07m45_27632_c1 | 3300050496 | Bacteria | 3127 |
| 619 | nmdc:mga07m45_3475_c2 | 3300050496 | Bacteria | 4399 |
| 620 | nmdc:mga07m45_43342_c1 | 3300050496 | Bacteria | 2522 |
| 621 | nmdc:mga07m45_49672_c1 | 3300050496 | Bacteria | 2362 |
| 622 | nmdc:mga0sz30_1386_c1 | 3300050516 | Bacteria | 8253 |
| 623 | nmdc:mga0sz30_1946_c1 | 3300050516 | Bacteria | 7380 |
| 624 | nmdc:mga0sz30_5861_c2 | 3300050516 | Bacteria | 2796 |
| 625 | Ga0495601_0042091 | 3300053077 | Bacteria | 2864 |
| 626 | Ga0495601_0083069 | 3300053077 | Bacteria | 2057 |
| 627 | Ga0495612_0018932 | 3300053078 | Bacteria | 2756 |
| 628 | Ga0495595_0004652 | 3300053084 | Bacteria | 5519 |
| 629 | Ga0495595_0045336 | 3300053084 | Bacteria | 2022 |
| 630 | Ga0495619_0018188 | 3300053085 | Bacteria | 4457 |
| 631 | Ga0495619_0068887 | 3300053085 | Bacteria | 2364 |
| 632 | Ga0495619_0100804 | 3300053085 | Bacteria | 1965 |
| 633 | Ga0500643_009094 | 3300053087 | Bacteria | 3827 |
| 634 | Ga0500644_0000067 | 3300053088 | Bacteria | 61703 |
| 635 | Ga0500556_0003191 | 3300053104 | Bacteria | 4884 |
| 636 | Ga0500556_0012709 | 3300053104 | Bacteria | 2524 |
| 637 | Ga0500562_003774 | 3300053108 | Bacteria | 3811 |
| 638 | Ga0500593_000139 | 3300053117 | Bacteria | 28985 |
| 639 | Ga0500652_002153 | 3300053131 | Bacteria | 5924 |
| 640 | Ga0500573_0004302 | 3300053140 | Bacteria | 7473 |
| 641 | Ga0500577_0017911 | 3300053142 | Bacteria | 2266 |
| 642 | Ga0500616_0000060 | 3300053153 | Bacteria | 252252 |
| 643 | Ga0500616_0007654 | 3300053153 | Bacteria | 6823 |
| 644 | Ga0500645_000020 | 3300053730 | Bacteria | 134162 |
| 645 | Ga0466962_0009146 | 3300061719 | Bacteria | 4745 |
| 646 | Ga0466962_0038878 | 3300061719 | Bacteria | 2279 |
| 647 | Ga0466962_0048769 | 3300061719 | Bacteria | 2023 |
| 648 | 2583150744 | 2582580736 | Bacteria | 5325865 |
| 649 | 2523387750 | 2523231044 | Bacteria | 6434991 |
| 650 | 2548692754 | 2547132424 | Bacteria | 8348532 |
| 651 | 2548698159 | 2547132424 | Bacteria | 8348532 |
| 652 | 2552105338 | 2551306166 | Bacteria | 9731570 |
| 653 | 2558905613 | 2558860112 | Bacteria | 9931328 |
| 654 | 2559431283 | 2558860280 | Bacteria | 11429938 |
| 655 | 2566992425 | 2565956761 | Bacteria | 6601618 |
| 656 | 2566995953 | 2565956761 | Bacteria | 6601618 |
| 657 | 2586062592 | 2585427649 | Bacteria | 9053857 |
| 658 | 2643825948 | 2643221561 | Bacteria | 4984412 |
| 659 | 2643891700 | 2643221576 | Bacteria | 5214352 |
| 660 | 2643960748 | 2643221590 | Bacteria | 5214697 |
| 661 | 2644089278 | 2643221615 | Bacteria | 5487866 |
| 662 | 2644319123 | 2643221657 | Bacteria | 5490246 |
| 663 | 2644491372 | 2643221687 | Bacteria | 6500351 |
| 664 | 2644512008 | 2643221692 | Bacteria | 7282860 |
| 665 | 2644515707 | 2643221692 | Bacteria | 7282860 |
| 666 | 2644531939 | 2643221696 | Bacteria | 5431823 |
| 667 | 2644636886 | 2643221715 | Bacteria | 6671032 |
| 668 | 2645721709 | 2643221961 | Bacteria | 3919167 |
| 669 | 2645724341 | 2643221962 | Bacteria | 3874254 |
| 670 | 2738669210 | 2738541264 | Bacteria | 5935393 |
| 671 | 2738703572 | 2738541274 | Bacteria | 6909446 |
| 672 | 2738891603 | 2738541308 | Bacteria | 7020677 |
| 673 | 2739148306 | 2738541356 | Bacteria | 5935017 |
| 674 | 2739204056 | 2738543005 | Bacteria | 5278128 |
| 675 | 2739204758 | 2738543005 | Bacteria | 5278128 |
| 676 | 2739239567 | 2738543011 | Bacteria | 5731169 |
| 677 | 2739240449 | 2738543011 | Bacteria | 5731169 |
| 678 | 2739328967 | 2738543028 | Bacteria | 6917070 |
| 679 | 2739362418 | 2738543034 | Bacteria | 6084756 |
| 680 | 2744954463 | 2744054611 | Bacteria | 5611514 |
| 681 | 2753038783 | 2751185725 | Bacteria | 5740550 |
| 682 | 2753039675 | 2751185725 | Bacteria | 5740550 |
| 683 | 2753327431 | 2751185792 | Bacteria | 5739090 |
| 684 | 2753328184 | 2751185792 | Bacteria | 5739090 |
| 685 | 2809588227 | 2808606522 | Bacteria | 9488490 |
| 686 | 2842140273 | 2842134933 | Bacteria | 5847019 |
| 687 | 2842889784 | 2842888712 | Bacteria | 4279094 |
| 688 | 2855387016 | 2855386786 | Bacteria | 4752232 |
| 689 | 2866618472 | 2866612099 | Bacteria | 7543886 |
| 690 | 2889303786 | 2889300758 | Bacteria | 5690814 |
| 691 | 2889304755 | 2889300758 | Bacteria | 5690814 |
| 692 | 2899367063 | 2899359706 | Bacteria | 10940472 |
| 693 | 2899372298 | 2899370129 | Bacteria | 6781179 |
| 694 | 2902795735 | 2902792274 | Bacteria | 7270173 |
| 695 | 2902804251 | 2902799365 | Bacteria | 5419524 |
| 696 | 2902814392 | 2902810491 | Bacteria | 6794147 |
| 697 | 2902842525 | 2902837492 | Bacteria | 6697721 |
| 698 | 2904539323 | 2904535858 | Bacteria | 6308016 |
| 699 | 2904540589 | 2904535858 | Bacteria | 6308016 |
| 700 | 2904770365 | 2904765812 | Bacteria | 5369154 |
| 701 | 2915771288 | 2915768154 | Bacteria | 8424322 |
| 702 | 2917741680 | 2917736166 | Bacteria | 9690793 |
| 703 | 2919422374 | 2919420072 | Bacteria | 5390363 |
| 704 | 2919435373 | 2919432681 | Bacteria | 5390474 |
| 705 | 2919715643 | 2919713450 | Bacteria | 7431245 |
| 706 | 2919718018 | 2919713450 | Bacteria | 7431245 |
| 707 | 2922554673 | 2922554459 | Bacteria | 6683962 |
| 708 | 2922555597 | 2922554459 | Bacteria | 6683962 |
| 709 | 2928145781 | 2928142448 | Bacteria | 5288925 |
| 710 | 2928147334 | 2928142448 | Bacteria | 5288925 |
| 711 | 2929218016 | 2929212328 | Bacteria | 7708288 |
| 712 | 2932400349 | 2932398195 | Bacteria | 3847976 |
| 713 | 2939584112 | 2939582691 | Bacteria | 7088898 |
| 714 | 2939587718 | 2939582691 | Bacteria | 7088898 |
| 715 | 2939744858 | 2939743619 | Bacteria | 5762299 |
| 716 | 2939747570 | 2939743619 | Bacteria | 5762299 |
| 717 | 3006501202 | 3006493962 | Bacteria | 8825450 |
| 718 | 8003316825 | 8003314358 | Bacteria | 10575343 |
| 719 | 8056210802 | 8056207758 | Bacteria | 8639239 |
| 720 | JGI24034J26672_10001838 | |||
| 721 | Ga0055540_1000129 | |||
| 722 | Ga0055540_1001745 | |||
| 723 | Ga0055540_1004105 | |||
| 724 | Ga0055540_1007649 | |||
| 725 | Ga0070658_10010848 | |||
| 726 | Ga0070690_100033772 | |||
| 727 | Ga0068869_100015173 | |||
| 728 | Ga0070680_100008494 | |||
| 729 | Ga0070682_100049204 | |||
| 730 | Ga0068868_100001236 | |||
| 731 | Ga0068868_100022508 | |||
| 732 | Ga0070660_100113103 | |||
| 733 | Ga0070689_100022950 | |||
| 734 | Ga0070668_100001358 | |||
| 735 | Ga0070668_100001665 | |||
| 736 | Ga0070669_100042620 | |||
| 737 | Ga0070669_100043302 | |||
| 738 | Ga0070671_100007331 | |||
| 739 | Ga0070674_100023411 | |||
| 740 | Ga0070659_100009893 | |||
| 741 | Ga0070667_100000220 | |||
| 742 | Ga0070667_100003332 | |||
| 743 | Ga0070667_100003781 | |||
| 744 | Ga0070667_100072985 | |||
| 745 | Ga0070667_100077809 | |||
| 746 | Ga0070709_10001154 | |||
| 747 | Ga0070709_10067826 | |||
| 748 | Ga0070714_100000205 | |||
| 749 | Ga0070714_100016392 | |||
| 750 | Ga0070714_100019490 | |||
| 751 | Ga0070714_100025647 | |||
| 752 | Ga0070714_100039528 | |||
| 753 | Ga0070714_100101343 | |||
| 754 | Ga0070710_10000331 | |||
| 755 | Ga0070710_10006316 | |||
| 756 | Ga0070710_10015488 | |||
| 757 | Ga0070701_10000560 | |||
| 758 | Ga0070701_10049552 | |||
| 759 | Ga0070711_100002890 | |||
| 760 | Ga0070711_100004061 | |||
| 761 | Ga0070711_100035360 | |||
| 762 | Ga0070711_100061901 | |||
| 763 | Ga0070705_100011492 | |||
| 764 | Ga0070700_100016555 | |||
| 765 | Ga0070708_100077797 | |||
| 766 | Ga0070663_100000346 | |||
| 767 | Ga0070663_100038266 | |||
| 768 | Ga0070663_100060219 | |||
| 769 | Ga0070663_100126482 | |||
| 770 | Ga0070678_100000614 | |||
| 771 | Ga0070662_100000432 | |||
| 772 | Ga0070681_10117046 | |||
| 773 | Ga0068867_100002257 | |||
| 774 | Ga0070685_10013806 | |||
| 775 | Ga0070706_100128503 | |||
| 776 | Ga0070706_100196661 | |||
| 777 | Ga0070707_100011425 | |||
| 778 | Ga0070698_100001196 | |||
| 779 | Ga0070698_100014214 | |||
| 780 | Ga0070698_100030911 | |||
| 781 | Ga0070699_100000764 | |||
| 782 | Ga0070699_100007678 | |||
| 783 | Ga0070697_100124722 | |||
| 784 | Ga0068853_100002578 | |||
| 785 | Ga0068853_100006403 | |||
| 786 | Ga0068853_100074589 | |||
| 787 | Ga0070672_100099511 | |||
| 788 | Ga0070695_100007910 | |||
| 789 | Ga0070695_100065667 | |||
| 790 | Ga0070696_100001571 | |||
| 791 | Ga0070693_100011593 | |||
| 792 | Ga0070665_100047016 | |||
| 793 | Ga0070665_100109951 | |||
| 794 | Ga0070704_100004159 | |||
| 795 | Ga0068855_100225392 | |||
| 796 | Ga0070664_100024907 | |||
| 797 | Ga0068857_100017181 | |||
| 798 | Ga0068854_100019634 | |||
| 799 | Ga0070702_100007259 | |||
| 800 | Ga0068852_100126526 | |||
| 801 | Ga0068859_100155012 | |||
| 802 | Ga0068859_100198532 | |||
| 803 | Ga0068866_10002878 | |||
| 804 | Ga0068863_100002923 | |||
| 805 | Ga0068863_100023008 | |||
| 806 | Ga0068858_100011053 | |||
| 807 | Ga0068858_100065364 | |||
| 808 | Ga0068860_100000150 | |||
| 809 | Ga0068860_100021823 | |||
| 810 | Ga0068862_100000078 | |||
| 811 | Ga0068862_100034339 | |||
| 812 | Ga0081455_10001381 | |||
| 813 | Ga0081540_1000526 | |||
| 814 | Ga0081539_10000086 | |||
| 815 | Ga0081539_10039003 | |||
| 816 | Ga0070717_10013919 | |||
| 817 | Ga0070717_10023864 | |||
| 818 | Ga0070717_10039626 | |||
| 819 | Ga0070717_10060550 | |||
| 820 | Ga0075365_10001375 | |||
| 821 | Ga0075365_10001792 | |||
| 822 | Ga0075365_10015399 | |||
| 823 | Ga0075365_10032660 | |||
| 824 | Ga0075365_10034620 | |||
| 825 | Ga0075365_10040470 | |||
| 826 | Ga0075368_10014777 | |||
| 827 | Ga0075368_10016679 | |||
| 828 | Ga0075363_100003651 | |||
| 829 | Ga0075363_100003717 | |||
| 830 | Ga0075363_100015312 | |||
| 831 | Ga0075363_100025561 | |||
| 832 | Ga0075364_10000763 | |||
| 833 | Ga0075364_10003008 | |||
| 834 | Ga0075364_10010592 | |||
| 835 | Ga0075364_10018772 | |||
| 836 | Ga0075364_10032895 | |||
| 837 | Ga0075364_10092036 | |||
| 838 | Ga0070715_10016039 | |||
| 839 | Ga0070715_10019773 | |||
| 840 | Ga0070716_100028562 | |||
| 841 | Ga0070716_100038713 | |||
| 842 | Ga0070716_100041261 | |||
| 843 | Ga0070712_100004853 | |||
| 844 | Ga0070712_100045597 | |||
| 845 | Ga0075362_10002955 | |||
| 846 | Ga0075362_10019260 | |||
| 847 | Ga0075367_10002381 | |||
| 848 | Ga0075369_10001355 | |||
| 849 | Ga0075369_10002007 | |||
| 850 | Ga0075369_10013536 | |||
| 851 | Ga0075369_10030506 | |||
| 852 | Ga0075369_10036556 | |||
| 853 | Ga0075370_10005609 | |||
| 854 | Ga0075370_10012487 | |||
| 855 | Ga0075370_10028313 | |||
| 856 | Ga0068871_100072623 | |||
| 857 | Ga0075428_100027391 | |||
| 858 | Ga0068865_100005626 | |||
| 859 | Ga0097620_100155020 | |||
| 860 | Ga0097620_100198537 | |||
| 861 | Ga0105244_10000510 | |||
| 862 | Ga0105250_10017879 | |||
| 863 | Ga0105240_10054668 | |||
| 864 | Ga0105245_10007729 | |||
| 865 | Ga0105245_10024506 | |||
| 866 | Ga0105247_10000074 | |||
| 867 | Ga0105247_10002062 | |||
| 868 | Ga0105247_10057815 | |||
| 869 | Ga0105243_10000289 | |||
| 870 | Ga0105243_10000320 | |||
| 871 | Ga0105243_10008584 | |||
| 872 | Ga0105242_10008449 | |||
| 873 | Ga0105248_10000077 | |||
| 874 | Ga0105248_10115368 | |||
| 875 | Ga0105248_10236653 | |||
| 876 | Ga0105237_10006473 | |||
| 877 | Ga0105237_10057364 | |||
| 878 | Ga0105237_10126396 | |||
| 879 | Ga0105238_10035966 | |||
| 880 | Ga0105238_10099172 | |||
| 881 | Ga0105249_10000111 | |||
| 882 | Ga0105249_10002996 | |||
| 883 | Ga0105249_10083599 | |||
| 884 | Ga0105249_10107890 | |||
| 885 | Ga0105239_10007577 | |||
| 886 | Ga0105239_10015124 | |||
| 887 | Ga0105246_10038935 | |||
| 888 | Ga0157373_10019867 | |||
| 889 | Ga0157374_10094027 | |||
| 890 | Ga0163162_10006863 | |||
| 891 | Ga0163162_10038718 | |||
| 892 | Ga0157375_10078279 | |||
| 893 | Ga0163163_10065264 | |||
| 894 | Ga0157380_10021060 | |||
| 895 | Ga0157377_10078632 | |||
| 896 | Ga0157379_10028802 | |||
| 897 | Ga0157379_10052990 | |||
| 898 | Ga0157379_10053557 | |||
| 899 | Ga0157376_10037696 | |||
| 900 | Ga0157376_10066049 | |||
| 901 | Ga0213876_10000704 | |||
| 902 | Ga0213876_10025841 | |||
| 903 | Ga0213875_10017719 | |||
| 904 | Ga0209051_1000034 | |||
| 905 | Ga0209051_1001216 | |||
| 906 | Ga0209051_1007995 | |||
| 907 | Ga0209051_1008529 | |||
| 908 | Ga0207655_1002085 | |||
| 909 | Ga0207692_10001536 | |||
| 910 | Ga0207692_10012129 | |||
| 911 | Ga0207692_10013100 | |||
| 912 | Ga0207642_10000893 | |||
| 913 | Ga0207710_10000086 | |||
| 914 | Ga0207710_10005728 | |||
| 915 | Ga0207688_10001044 | |||
| 916 | Ga0207688_10009239 | |||
| 917 | Ga0207688_10025886 | |||
| 918 | Ga0207647_10015380 | |||
| 919 | Ga0207699_10002700 | |||
| 920 | Ga0207699_10036795 | |||
| 921 | Ga0207684_10004936 | |||
| 922 | Ga0207695_10113758 | |||
| 923 | Ga0207671_10028233 | |||
| 924 | Ga0207693_10001709 | |||
| 925 | Ga0207693_10003694 | |||
| 926 | Ga0207693_10038811 | |||
| 927 | Ga0207693_10042912 | |||
| 928 | Ga0207693_10053199 | |||
| 929 | Ga0207663_10000984 | |||
| 930 | Ga0207663_10008447 | |||
| 931 | Ga0207663_10036880 | |||
| 932 | Ga0207662_10014442 | |||
| 933 | Ga0207657_10014838 | |||
| 934 | Ga0207646_10034486 | |||
| 935 | Ga0207694_10077616 | |||
| 936 | Ga0207687_10014059 | |||
| 937 | Ga0207700_10002848 | |||
| 938 | Ga0207700_10024776 | |||
| 939 | Ga0207700_10073387 | |||
| 940 | Ga0207664_10001897 | |||
| 941 | Ga0207664_10004784 | |||
| 942 | Ga0207664_10033281 | |||
| 943 | Ga0207664_10049593 | |||
| 944 | Ga0207664_10067999 | |||
| 945 | Ga0207644_10012148 | |||
| 946 | Ga0207690_10096583 | |||
| 947 | Ga0207686_10009036 | |||
| 948 | Ga0207709_10000326 | |||
| 949 | Ga0207709_10004680 | |||
| 950 | Ga0207709_10028933 | |||
| 951 | Ga0207709_10052392 | |||
| 952 | Ga0207704_10045872 | |||
| 953 | Ga0207665_10005509 | |||
| 954 | Ga0207665_10007441 | |||
| 955 | Ga0207665_10012962 | |||
| 956 | Ga0207665_10016807 | |||
| 957 | Ga0207691_10024114 | |||
| 958 | Ga0207711_10002507 | |||
| 959 | Ga0207711_10044465 | |||
| 960 | Ga0207689_10041452 | |||
| 961 | Ga0207661_10108706 | |||
| 962 | Ga0207667_10017308 | |||
| 963 | Ga0207651_10035848 | |||
| 964 | Ga0207712_10000359 | |||
| 965 | Ga0207668_10000928 | |||
| 966 | Ga0207640_10001743 | |||
| 967 | Ga0207658_10003085 | |||
| 968 | Ga0207658_10004646 | |||
| 969 | Ga0207658_10007205 | |||
| 970 | Ga0207658_10063236 | |||
| 971 | Ga0207703_10065116 | |||
| 972 | Ga0207639_10005623 | |||
| 973 | Ga0207639_10056639 | |||
| 974 | Ga0207678_10000470 | |||
| 975 | Ga0207678_10008317 | |||
| 976 | Ga0207678_10012535 | |||
| 977 | Ga0207678_10044269 | |||
| 978 | Ga0207708_10010031 | |||
| 979 | Ga0207641_10001160 | |||
| 980 | Ga0207641_10003664 | |||
| 981 | Ga0207648_10002259 | |||
| 982 | Ga0207648_10071264 | |||
| 983 | Ga0207674_10006266 | |||
| 984 | Ga0207675_100032367 | |||
| 985 | Ga0207683_10001470 | |||
| 986 | Ga0207683_10003942 | |||
| 987 | Ga0207698_10010836 | |||
| 988 | Ga0268266_10031218 | |||
| 989 | Ga0268265_10000012 | |||
| 990 | Ga0268264_10000104 | |||
| 991 | Ga0268264_10000155 | |||
| 992 | Ga0265337_1000189 | |||
| 993 | Ga0265334_10004354 | |||
| 994 | Ga0265338_10001286 | |||
| 995 | Ga0265338_10029310 | |||
| 996 | Ga0265338_10043965 | |||
| 997 | Ga0307511_10001088 | |||
| 998 | Ga0307512_10018221 | |||
| 999 | Ga0316176_1055854 | |||
| 1000 | Ga0316182_1003641 | |||
| 1001 | Ga0265332_10003210 | |||
| 1002 | Ga0265340_10002821 | |||
| 1003 | Ga0265327_10000004 | |||
| 1004 | Ga0265327_10000274 | |||
| 1005 | Ga0265327_10001702 | |||
| 1006 | Ga0307513_10000198 | |||
| 1007 | Ga0265314_10032628 | |||
| 1008 | Ga0307413_10055223 | |||
| 1009 | Ga0307518_10000486 | |||
| 1010 | Ga0307409_100007560 | |||
| 1011 | Ga0307409_100112138 | |||
| 1012 | Ga0307507_10074129 | |||
| 1013 | Ga0373926_0010197 | |||
| 1014 | Ga0373934_0004253 | |||
| 1015 | Ga0373934_0022809 | |||
| 1016 | Ga0373940_0013936 | |||
| 1017 | Ga0373944_0000572 | |||
| 1018 | Ga0373944_0003552 | |||
| 1019 | Ga0373923_0013836 | |||
| 1020 | Ga0373923_0024889 | |||
| 1021 | Ga0373936_0001661 | |||
| 1022 | Ga0373945_0000063 | |||
| 1023 | Ga0373953_0008677 | |||
| 1024 | Ga0373953_0028766 | |||
| 1025 | Ga0373956_0007134 | |||
| 1026 | Ga0373943_0000639 | |||
| 1027 | Ga0373943_0003607 | |||
| 1028 | Ga0373946_0000960 | |||
| 1029 | Ga0373924_0009366 | |||
| 1030 | Ga0373935_0000853 | |||
| 1031 | Ga0373927_0001934 | |||
| 1032 | Ga0373927_0025767 | |||
| 1033 | Ga0373933_0004818 | |||
| 1034 | Ga0373947_0000952 | |||
| 1035 | Ga0373937_0026885 | |||
| 1036 | Ga0373937_0080780 | |||
| 1037 | Ga0373925_0000072 | |||
| 1038 | Ga0373925_0002590 | |||
| 1039 | Ga0373925_0007011 | |||
| 1040 | Ga0436364_0410131 | |||
| 1041 | Ga0436364_0591707 | |||
| 1042 | Ga0436364_1438977 | |||
| 1043 | Ga0436365_0341904 | |||
| 1044 | Ga0436365_1870027 | |||
| 1045 | Ga0439461_0000259 | |||
| 1046 | Ga0439465_0000144 | |||
| 1047 | Ga0439465_0001423 | |||
| 1048 | Ga0439465_0004106 | |||
| 1049 | Ga0451837_1277956 | |||
| 1050 | Ga0451843_0112177 | |||
| 1051 | Ga0439431_0001040 | |||
| 1052 | Ga0439448_0018703 | |||
| 1053 | Ga0439434_0007193 | |||
| 1054 | Ga0466972_0001659 | |||
| 1055 | Ga0466972_0009368 | |||
| 1056 | Ga0466972_0018184 | |||
| 1057 | Ga0466972_0047671 | |||
| 1058 | Ga0466965_0000192 | |||
| 1059 | Ga0466965_0009126 | |||
| 1060 | Ga0466965_0036791 | |||
| 1061 | Ga0466966_0009760 | |||
| 1062 | Ga0466966_0018446 | |||
| 1063 | Ga0466966_0023330 | |||
| 1064 | Ga0466966_0062324 | |||
| 1065 | Ga0466961_0001778 | |||
| 1066 | Ga0466961_0004127 | |||
| 1067 | Ga0466961_0029585 | |||
| 1068 | Ga0466963_0018690 | |||
| 1069 | Ga0466963_0022452 | |||
| 1070 | Ga0466963_0129564 | |||
| 1071 | Ga0466971_0019283 | |||
| 1072 | Ga0466971_0026608 | |||
| 1073 | Ga0466968_0001060 | |||
| 1074 | Ga0466968_0006556 | |||
| 1075 | Ga0466968_0022210 | |||
| 1076 | Ga0466970_0004142 | |||
| 1077 | Ga0466970_0016998 | |||
| 1078 | Ga0466970_0049113 | |||
| 1079 | Ga0466960_0000268 | |||
| 1080 | Ga0466960_0000775 | |||
| 1081 | Ga0466960_0002460 | |||
| 1082 | Ga0466960_0002894 | |||
| 1083 | Ga0466959_0003887 | |||
| 1084 | Ga0466959_0009155 | |||
| 1085 | Ga0466959_0014938 | |||
| 1086 | Ga0466959_0025109 | |||
| 1087 | Ga0466959_0070815 | |||
| 1088 | Ga0466958_0001690 | |||
| 1089 | Ga0466958_0017177 | |||
| 1090 | Ga0466958_0044518 | |||
| 1091 | Ga0466958_0053131 | |||
| 1092 | Ga0466967_0002377 | |||
| 1093 | Ga0466967_0004350 | |||
| 1094 | Ga0466967_0006781 | |||
| 1095 | Ga0466967_0007847 | |||
| 1096 | Ga0466967_0032717 | |||
| 1097 | Ga0466967_0037235 | |||
| 1098 | Ga0466967_0088597 | |||
| 1099 | Ga0466967_0108046 | |||
| 1100 | Ga0466967_0139289 | |||
| 1101 | Ga0495592_0000831 | |||
| 1102 | Ga0495592_0007188 | |||
| 1103 | Ga0495603_0014944 | |||
| 1104 | Ga0495603_0091492 | |||
| 1105 | Ga0495629_0026031 | |||
| 1106 | Ga0495629_0092353 | |||
| 1107 | Ga0495638_0055236 | |||
| 1108 | Ga0495641_0007985 | |||
| 1109 | Ga0495641_0012223 | |||
| 1110 | Ga0495641_0013375 | |||
| 1111 | Ga0495651_0003087 | |||
| 1112 | Ga0495651_0010663 | |||
| 1113 | Ga0495651_0037455 | |||
| 1114 | Ga0495653_0002608 | |||
| 1115 | Ga0495653_0012520 | |||
| 1116 | Ga0495580_0017702 | |||
| 1117 | Ga0495582_0002871 | |||
| 1118 | Ga0495582_0086589 | |||
| 1119 | Ga0495639_0026071 | |||
| 1120 | Ga0495662_0014879 | |||
| 1121 | Ga0495662_0021426 | |||
| 1122 | Ga0495664_0000220 | |||
| 1123 | Ga0495664_0023634 | |||
| 1124 | Ga0495664_0032198 | |||
| 1125 | Ga0495608_0023048 | |||
| 1126 | Ga0495608_0031398 | |||
| 1127 | Ga0495608_0039926 | |||
| 1128 | Ga0495608_0047264 | |||
| 1129 | Ga0495608_0064323 | |||
| 1130 | Ga0495618_0017792 | |||
| 1131 | Ga0495618_0029410 | |||
| 1132 | Ga0495628_0071698 | |||
| 1133 | Ga0495630_0027031 | |||
| 1134 | Ga0495666_0005772 | |||
| 1135 | Ga0495652_0109366 | |||
| 1136 | Ga0495665_0004311 | |||
| 1137 | Ga0495665_0035542 | |||
| 1138 | Ga0495640_0006614 | |||
| 1139 | Ga0495640_0023854 | |||
| 1140 | Ga0495640_0024392 | |||
| 1141 | Ga0495586_0006789 | |||
| 1142 | Ga0495586_0025786 | |||
| 1143 | Ga0495587_0014653 | |||
| 1144 | Ga0495587_0022101 | |||
| 1145 | Ga0495587_0023299 | |||
| 1146 | Ga0495645_0070035 | |||
| 1147 | Ga0495667_0003797 | |||
| 1148 | Ga0495667_0008305 | |||
| 1149 | Ga0495667_0029986 | |||
| 1150 | Ga0495668_0027125 | |||
| 1151 | Ga0495668_0039470 | |||
| 1152 | Ga0495634_0024194 | |||
| 1153 | Ga0495635_0001457 | |||
| 1154 | Ga0495635_0009705 | |||
| 1155 | Ga0495588_0043991 | |||
| 1156 | Ga0495657_0008915 | |||
| 1157 | Ga0495657_0012315 | |||
| 1158 | Ga0495599_0033405 | |||
| 1159 | Ga0495623_0007354 | |||
| 1160 | Ga0495646_0003847 | |||
| 1161 | Ga0495646_0012031 | |||
| 1162 | Ga0495658_0002896 | |||
| 1163 | Ga0495624_0006089 | |||
| 1164 | Ga0495624_0053025 | |||
| 1165 | Ga0495600_0029983 | |||
| 1166 | Ga0495600_0041632 | |||
| 1167 | Ga0495581_0004679 | |||
| 1168 | Ga0495581_0024853 | |||
| 1169 | Ga0495604_0022284 | |||
| 1170 | Ga0495674_0003143 | |||
| 1171 | Ga0495674_0080199 | |||
| 1172 | Ga0495674_0085516 | |||
| 1173 | Ga0495672_0002758 | |||
| 1174 | Ga0495672_0021511 | |||
| 1175 | Ga0495676_0006015 | |||
| 1176 | Ga0495676_0023539 | |||
| 1177 | Ga0495680_0013293 | |||
| 1178 | Ga0495680_0014676 | |||
| 1179 | Ga0495680_0026724 | |||
| 1180 | Ga0495680_0031254 | |||
| 1181 | Ga0495680_0034264 | |||
| 1182 | Ga0495683_0000421 | |||
| 1183 | Ga0495675_0030233 | |||
| 1184 | Ga0495675_0030330 | |||
| 1185 | Ga0495675_0074013 | |||
| 1186 | Ga0495684_0010160 | |||
| 1187 | Ga0495684_0039979 | |||
| 1188 | Ga0495684_0074705 | |||
| 1189 | Ga0495686_0002680 | |||
| 1190 | Ga0495593_0005040 | |||
| 1191 | Ga0495614_0013100 | |||
| 1192 | Ga0496100_0000169 | |||
| 1193 | Ga0496100_0001459 | |||
| 1194 | Ga0496100_0028133 | |||
| 1195 | Ga0496100_0110048 | |||
| 1196 | Ga0496101_0000059 | |||
| 1197 | Ga0496101_0000808 | |||
| 1198 | Ga0496101_0011656 | |||
| 1199 | Ga0496102_0000083 | |||
| 1200 | Ga0496102_0000621 | |||
| 1201 | Ga0496102_0000721 | |||
| 1202 | Ga0496102_0001551 | |||
| 1203 | Ga0496102_0004351 | |||
| 1204 | Ga0496102_0005748 | |||
| 1205 | Ga0496102_0019868 | |||
| 1206 | Ga0496102_0054514 | |||
| 1207 | Ga0496102_0095247 | |||
| 1208 | Ga0496103_0000060 | |||
| 1209 | Ga0496103_0000215 | |||
| 1210 | Ga0496103_0000548 | |||
| 1211 | Ga0496103_0060795 | |||
| 1212 | Ga0496104_0002283 | |||
| 1213 | Ga0496104_0017658 | |||
| 1214 | Ga0496105_0007022 | |||
| 1215 | Ga0496106_0000656 | |||
| 1216 | Ga0496106_0011638 | |||
| 1217 | Ga0496106_0011826 | |||
| 1218 | Ga0496106_0047585 | |||
| 1219 | Ga0496107_0004768 | |||
| 1220 | Ga0496107_0015313 | |||
| 1221 | Ga0496107_0041508 | |||
| 1222 | Ga0496108_0001059 | |||
| 1223 | Ga0496108_0019695 | |||
| 1224 | Ga0496109_0000972 | |||
| 1225 | Ga0496109_0097458 | |||
| 1226 | Ga0496109_0116257 | |||
| 1227 | Ga0496110_0005418 | |||
| 1228 | Ga0496110_0049355 | |||
| 1229 | Ga0496110_0057826 | |||
| 1230 | Ga0496110_0118425 | |||
| 1231 | Ga0496111_0005465 | |||
| 1232 | Ga0496111_0074744 | |||
| 1233 | Ga0496112_0000453 | |||
| 1234 | Ga0496112_0037669 | |||
| 1235 | Ga0496113_0010905 | |||
| 1236 | Ga0496113_0023044 | |||
| 1237 | Ga0496114_0006910 | |||
| 1238 | Ga0496114_0011111 | |||
| 1239 | Ga0496115_0002853 | |||
| 1240 | Ga0496115_0014441 | |||
| 1241 | Ga0496116_0000159 | |||
| 1242 | Ga0496116_0002589 | |||
| 1243 | Ga0496116_0005469 | |||
| 1244 | Ga0496117_0000167 | |||
| 1245 | Ga0496117_0002257 | |||
| 1246 | Ga0496117_0004619 | |||
| 1247 | Ga0496117_0024942 | |||
| 1248 | Ga0496118_0000121 | |||
| 1249 | Ga0496118_0000160 | |||
| 1250 | Ga0496118_0002464 | |||
| 1251 | Ga0496118_0020939 | |||
| 1252 | Ga0496119_0005170 | |||
| 1253 | Ga0496119_0015087 | |||
| 1254 | Ga0496119_0022220 | |||
| 1255 | Ga0496120_0007715 | |||
| 1256 | Ga0496120_0023124 | |||
| 1257 | Ga0496121_0000002 | |||
| 1258 | Ga0496121_0000690 | |||
| 1259 | Ga0496121_0007408 | |||
| 1260 | Ga0496122_0001116 | |||
| 1261 | Ga0496123_0018847 | |||
| 1262 | Ga0496124_0000002 | |||
| 1263 | Ga0496124_0039098 | |||
| 1264 | Ga0496125_0000002 | |||
| 1265 | Ga0496126_0000009 | |||
| 1266 | Ga0496126_0001058 | |||
| 1267 | Ga0496126_0004263 | |||
| 1268 | Ga0496126_0009352 | |||
| 1269 | Ga0496126_0029025 | |||
| 1270 | Ga0496126_0106225 | |||
| 1271 | Ga0501032_0000241 | |||
| 1272 | Ga0501032_0015556 | |||
| 1273 | Ga0501032_0017352 | |||
| 1274 | Ga0501033_0008007 | |||
| 1275 | Ga0501033_0017603 | |||
| 1276 | Ga0501034_0033129 | |||
| 1277 | Ga0501034_0112472 | |||
| 1278 | Ga0501036_0004947 | |||
| 1279 | Ga0501037_0000194 | |||
| 1280 | Ga0501037_0001558 | |||
| 1281 | Ga0501038_0000163 | |||
| 1282 | Ga0501038_0007570 | |||
| 1283 | Ga0501038_0055596 | |||
| 1284 | Ga0501039_0003023 | |||
| 1285 | Ga0501042_0004930 | |||
| 1286 | Ga0501042_0015464 | |||
| 1287 | Ga0501043_0022464 | |||
| 1288 | Ga0501046_0002371 | |||
| 1289 | Ga0501046_0002488 | |||
| 1290 | Ga0501047_0001872 | |||
| 1291 | Ga0501047_0011257 | |||
| 1292 | Ga0501047_0038481 | |||
| 1293 | Ga0501048_0000286 | |||
| 1294 | Ga0501048_0009104 | |||
| 1295 | Ga0501069_0022549 | |||
| 1296 | Ga0501070_0001787 | |||
| 1297 | Ga0501070_0009494 | |||
| 1298 | Ga0501070_0058211 | |||
| 1299 | Ga0501072_0094486 | |||
| 1300 | Ga0501073_0013132 | |||
| 1301 | Ga0501083_0033278 | |||
| 1302 | Ga0501035_0000218 | |||
| 1303 | Ga0501035_0004799 | |||
| 1304 | Ga0501035_0010663 | |||
| 1305 | Ga0501044_0000639 | |||
| 1306 | Ga0501044_0000719 | |||
| 1307 | Ga0501044_0076481 | |||
| 1308 | Ga0501045_0069066 | |||
| 1309 | Ga0501045_0094054 | |||
| 1310 | nmdc:mga03683_10050_c1 | |||
| 1311 | nmdc:mga03n38_15218_c1 | |||
| 1312 | nmdc:mga03n38_19382_c2 | |||
| 1313 | nmdc:mga03n38_2351_c1 | |||
| 1314 | nmdc:mga03n38_3217_c1 | |||
| 1315 | nmdc:mga03n38_3785_c1 | |||
| 1316 | nmdc:mga03n38_449_c1 | |||
| 1317 | nmdc:mga03n38_4691_c1 | |||
| 1318 | nmdc:mga00v17_11628_c1 | |||
| 1319 | nmdc:mga00v17_12920_c1 | |||
| 1320 | nmdc:mga00v17_25153_c1 | |||
| 1321 | nmdc:mga00v17_27433_c1 | |||
| 1322 | nmdc:mga00v17_29376_c1 | |||
| 1323 | nmdc:mga00v17_34946_c1 | |||
| 1324 | nmdc:mga00v17_3754_c1 | |||
| 1325 | nmdc:mga00v17_50049_c1 | |||
| 1326 | nmdc:mga00v17_5063_c1 | |||
| 1327 | nmdc:mga00v17_93385_c1 | |||
| 1328 | nmdc:mga0yw44_13504_c1 | |||
| 1329 | nmdc:mga0yw44_33739_c1 | |||
| 1330 | nmdc:mga0yw44_34254_c1 | |||
| 1331 | nmdc:mga0yw44_4742_c1 | |||
| 1332 | nmdc:mga0yw44_71469_c1 | |||
| 1333 | nmdc:mga0yw44_72833_c1 | |||
| 1334 | nmdc:mga0yw44_88268_c1 | |||
| 1335 | nmdc:mga06z11_70924_c1 | |||
| 1336 | nmdc:mga06z11_8231_c1 | |||
| 1337 | nmdc:mga07m45_27632_c1 | |||
| 1338 | nmdc:mga07m45_3475_c2 | |||
| 1339 | nmdc:mga07m45_43342_c1 | |||
| 1340 | nmdc:mga07m45_49672_c1 | |||
| 1341 | nmdc:mga0sz30_1386_c1 | |||
| 1342 | nmdc:mga0sz30_1946_c1 | |||
| 1343 | nmdc:mga0sz30_5861_c2 | |||
| 1344 | Ga0495601_0042091 | |||
| 1345 | Ga0495601_0083069 | |||
| 1346 | Ga0495612_0018932 | |||
| 1347 | Ga0495595_0004652 | |||
| 1348 | Ga0495595_0045336 | |||
| 1349 | Ga0495619_0018188 | |||
| 1350 | Ga0495619_0068887 | |||
| 1351 | Ga0495619_0100804 | |||
| 1352 | Ga0500643_009094 | |||
| 1353 | Ga0500644_0000067 | |||
| 1354 | Ga0500556_0003191 | |||
| 1355 | Ga0500556_0012709 | |||
| 1356 | Ga0500562_003774 | |||
| 1357 | Ga0500593_000139 | |||
| 1358 | Ga0500652_002153 | |||
| 1359 | Ga0500573_0004302 | |||
| 1360 | Ga0500577_0017911 | |||
| 1361 | Ga0500616_0000060 | |||
| 1362 | Ga0500616_0007654 | |||
| 1363 | Ga0500645_000020 | |||
| 1364 | Ga0466962_0009146 | |||
| 1365 | Ga0466962_0038878 | |||
| 1366 | Ga0466962_0048769 | |||
| 1367 | 2583150744 | |||
| 1368 | 2523387750 | |||
| 1369 | 2548692754 | |||
| 1370 | 2548698159 | |||
| 1371 | 2552105338 | |||
| 1372 | 2558905613 | |||
| 1373 | 2559431283 | |||
| 1374 | 2566992425 | |||
| 1375 | 2566995953 | |||
| 1376 | 2586062592 | |||
| 1377 | 2643825948 | |||
| 1378 | 2643891700 | |||
| 1379 | 2643960748 | |||
| 1380 | 2644089278 | |||
| 1381 | 2644319123 | |||
| 1382 | 2644491372 | |||
| 1383 | 2644512008 | |||
| 1384 | 2644515707 | |||
| 1385 | 2644531939 | |||
| 1386 | 2644636886 | |||
| 1387 | 2645721709 | |||
| 1388 | 2645724341 | |||
| 1389 | 2738669210 | |||
| 1390 | 2738703572 | |||
| 1391 | 2738891603 | |||
| 1392 | 2739148306 | |||
| 1393 | 2739204056 | |||
| 1394 | 2739204758 | |||
| 1395 | 2739239567 | |||
| 1396 | 2739240449 | |||
| 1397 | 2739328967 | |||
| 1398 | 2739362418 | |||
| 1399 | 2744954463 | |||
| 1400 | 2753038783 | |||
| 1401 | 2753039675 | |||
| 1402 | 2753327431 | |||
| 1403 | 2753328184 | |||
| 1404 | 2809588227 | |||
| 1405 | 2842140273 | |||
| 1406 | 2842889784 | |||
| 1407 | 2855387016 | |||
| 1408 | 2866618472 | |||
| 1409 | 2889303786 | |||
| 1410 | 2889304755 | |||
| 1411 | 2899367063 | |||
| 1412 | 2899372298 | |||
| 1413 | 2902795735 | |||
| 1414 | 2902804251 | |||
| 1415 | 2902814392 | |||
| 1416 | 2902842525 | |||
| 1417 | 2904539323 | |||
| 1418 | 2904540589 | |||
| 1419 | 2904770365 | |||
| 1420 | 2915771288 | |||
| 1421 | 2917741680 | |||
| 1422 | 2919422374 | |||
| 1423 | 2919435373 | |||
| 1424 | 2919715643 | |||
| 1425 | 2919718018 | |||
| 1426 | 2922554673 | |||
| 1427 | 2922555597 | |||
| 1428 | 2928145781 | |||
| 1429 | 2928147334 | |||
| 1430 | 2929218016 | |||
| 1431 | 2932400349 | |||
| 1432 | 2939584112 | |||
| 1433 | 2939587718 | |||
| 1434 | 2939744858 | |||
| 1435 | 2939747570 | |||
| 1436 | 3006501202 | |||
| 1437 | 8003316825 | |||
| 1438 | 8056210802 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7p18-assembly2.cif.gz_B | crystal structure of 3-ketosteroid delta1-dehydrogenase from sterolibacterium denitrificans in complex with 1,4-androstadiene-3,17-dione | 0.922 | 4 | 547 |
| 7p18-assembly2.cif.gz_B | crystal structure of 3-ketosteroid delta1-dehydrogenase from sterolibacterium denitrificans in complex with 1,4-androstadiene-3,17-dione | 0.9157 | 4 | 547 |
| 2cvj-assembly1.cif.gz_A | crystal structure of thioredoxin reductase-related protein ttha0370 from thermus thermophilus hb8 | 0.9009 | 6 | 33 |
| 5m5j-assembly1.cif.gz_A | thioredoxin reductase from giardia duodenalis | 0.8957 | 4 | 33 |
| 1vdc-assembly1.cif.gz_A-2 | structure of nadph dependent thioredoxin reductase | 0.8933 | 4 | 33 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P71864_2_395_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.989 | 2 | 382 | 3.50.50.60 |
| af_P71864_2_395_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9541 | 2 | 382 | 3.50.50.60 |
| 4zn0A01 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.901 | 5 | 33 | 3.50.50.60 |
| 2cvjA01 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9009 | 6 | 33 | 3.50.50.60 |
| af_Q4CQD9_26_141_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.8841 | 6 | 33 | 3.50.50.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2S8MPB8-F1-model_v4 | deleted | 0.995 | 327 | 461 |
|
| AF-A0A2S8M960-F1-model_v4 | deleted | 0.9938 | 116 | 461 |
|
| AF-P71864-F1-model_v4 | 3-oxosteroid 1-dehydrogenase (EC 1.3.99.4) (3-keto-Delta(4)-steroid Delta(1)-dehydrogenase) (KSDD) (3-oxo-Delta(4)-steroid 1-dehydrogenase) (KSTD) | 0.9936 | 1 | 544 |
GO:0005737
GO:0005886 GO:0006694 GO:0006707 GO:0047571 |
| AF-A0A433CD35-F1-model_v4 | deleted | 0.9934 | 327 | 542 |
|
| AF-A0A7M3S8T6-F1-model_v4 | deleted | 0.9913 | 86 | 408 |
|