F477279

General Info

Members Datasets Scaffolds Average Seq Length
719 375 1438 555

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2582580736|2583150744
Length 627
Sequence AVDGGNAGGGEEFDVVVVGSGAAGMTAALRAAHSGLSTVVVEKAAAFGGSTARSGGGVWVPGNDALRRAGVADTPEEARDYLRTIVGDVADPDRIDAYLERGPEVLRFVERTTPLRLAWVRGYSDYXPEAPGGKVVGRSAEPKPVDARLLGDERARLERPYSAPPLGVPLGQADYRWLSLIARHPRGVLTLLSLGLRWLAGLARGMRQLTMGQAIAAALRVGLLRAGVEVRLERPLVRLHTGPDPGARGSAGRXRXXGXXVXEDGREVLIRARRGVVLAAGGFEHNAELRQRYQRAPIGTEWTVGAKANTGDAITAAMDVGAAVDLMDDAWWGPSIPLPGGPWFALAERSRPGCVMVNDRGRRFGNESAPYVDAVHAMYGGEHGRGDGPGENIPTWLVFDQRYRNRYMFTGLGPRQALPGRWFKHGVVVRADTIAELADRMGVPAENLESTVERFNGFARAGEDLDFGRGRSRYDHYYGDPRNKPNPSLGELNQAPYYAVKMVPGDLGTKGGVRTDPRARVLREDGSVIPGLYAAGNSSAAVMGHTYAGPGATIGPAMVFGYLAAEDAAGRAAADAAEDTPADTVGGPTADTAEHTVGSTAEDTAEDTAGSGPVHTPRNPGTPRVRR

Samples

Sample ID Description Type Environment
1 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
2 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
61 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
67 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
68 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
75 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
97 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
98 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
148 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
149 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
150 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
151 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
152 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
153 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
154 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
155 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
156 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
157 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
158 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
159 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
160 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
161 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
162 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
163 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
164 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
165 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
166 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
167 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
168 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
169 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
170 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
171 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
172 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
173 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
174 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
175 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
176 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
177 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
178 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
179 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
182 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
183 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
184 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
185 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
186 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
187 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
188 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
189 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
190 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
191 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
192 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
193 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
194 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
195 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
196 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
197 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
198 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
199 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
200 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
201 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
202 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
203 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
204 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
205 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
206 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
207 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
208 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
209 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
210 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
211 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
212 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
213 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
214 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
215 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
216 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
217 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
218 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
219 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
220 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
221 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
222 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
223 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
224 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
225 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
226 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
227 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
228 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
229 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
230 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
231 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
232 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
233 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
234 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
235 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
236 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
237 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
238 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
239 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
240 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
241 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
242 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
243 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
244 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
245 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
246 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
247 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
248 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
249 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
250 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
251 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
252 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
253 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
254 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
255 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
256 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
257 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
258 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
259 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
260 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
261 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
262 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
263 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
264 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
265 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
266 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
267 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
268 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
269 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
270 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
271 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
272 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
273 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
274 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
275 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
276 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
289 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
290 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
291 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
292 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
293 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
296 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
297 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
298 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
299 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
300 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
301 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
302 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
303 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
304 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
305 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
306 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
307 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
308 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
309 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
310 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
311 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
312 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
313 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
314 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
315 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
316 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
317 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
318 2582580736 Prauserella sp. Am3 Isolate Unclassified
319 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
320 2547132424 Nocardia nova SH22a Isolate Unclassified
321 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
322 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
323 2558860280 Kutzneria sp. 744 Isolate Unclassified
324 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
325 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
326 2643221561 Nocardioides sp. Root151 Isolate Unclassified
327 2643221576 Nocardioides sp. Root614 Isolate Unclassified
328 2643221590 Nocardioides sp. Root682 Isolate Unclassified
329 2643221615 Nocardioides sp. Root224 Isolate Unclassified
330 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
331 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
332 2643221692 Nocardia sp. Root136 Isolate Unclassified
333 2643221696 Nocardioides sp. Root140 Isolate Unclassified
334 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
335 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
336 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
337 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
338 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
339 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
340 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
341 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
342 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
343 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
344 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
345 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
346 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
347 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
348 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
349 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
350 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
351 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
352 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
353 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
354 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
355 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
356 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
357 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
358 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
359 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
360 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
361 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
362 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
363 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
364 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
365 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
366 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
367 2922554459 Rhodococcus sp. 66b Isolate Unclassified
368 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
369 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
370 2932398195 Dietzia sp. 2505 Isolate Rhizosphere
371 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
372 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
373 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
374 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
375 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.99
Metatranscriptomes 0
Isolates 10.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.54
Nodule 0.14
Rhizoplane 6.82
Rhizosphere 68.01
Stem 0
Stem Tuber 0.14
Unclassified 0.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24034J26672_10001838 3300002239 Bacteria 2861
2 Ga0055540_1000129 3300003792 Bacteria 76241
3 Ga0055540_1001745 3300003792 Bacteria 12460
4 Ga0055540_1004105 3300003792 Bacteria 6743
5 Ga0055540_1007649 3300003792 Bacteria 4034
6 Ga0070658_10010848 3300005327 Bacteria 7306
7 Ga0070690_100033772 3300005330 Bacteria 3204
8 Ga0068869_100015173 3300005334 Bacteria 5161
9 Ga0070680_100008494 3300005336 Bacteria 7865
10 Ga0070682_100049204 3300005337 Bacteria 2627
11 Ga0068868_100001236 3300005338 Bacteria 17545
12 Ga0068868_100022508 3300005338 Bacteria 4757
13 Ga0070660_100113103 3300005339 Bacteria 2161
14 Ga0070689_100022950 3300005340 Bacteria 4666
15 Ga0070668_100001358 3300005347 Bacteria 17516
16 Ga0070668_100001665 3300005347 Bacteria 16122
17 Ga0070669_100042620 3300005353 Bacteria 3303
18 Ga0070669_100043302 3300005353 Bacteria 3278
19 Ga0070671_100007331 3300005355 Bacteria 8807
20 Ga0070674_100023411 3300005356 Bacteria 3997
21 Ga0070659_100009893 3300005366 Bacteria 7014
22 Ga0070667_100000220 3300005367 Bacteria 65980
23 Ga0070667_100003332 3300005367 Bacteria 13718
24 Ga0070667_100003781 3300005367 Bacteria 12869
25 Ga0070667_100072985 3300005367 Bacteria 2925
26 Ga0070667_100077809 3300005367 Bacteria 2833
27 Ga0070709_10001154 3300005434 Bacteria 14514
28 Ga0070709_10067826 3300005434 Bacteria 2292
29 Ga0070714_100000205 3300005435 Bacteria 47895
30 Ga0070714_100016392 3300005435 Bacteria 5981
31 Ga0070714_100019490 3300005435 Bacteria 5529
32 Ga0070714_100025647 3300005435 Bacteria 4866
33 Ga0070714_100039528 3300005435 Bacteria 3972
34 Ga0070714_100101343 3300005435 Bacteria 2537
35 Ga0070710_10000331 3300005437 Bacteria 22606
36 Ga0070710_10006316 3300005437 Bacteria 5684
37 Ga0070710_10015488 3300005437 Bacteria 3862
38 Ga0070701_10000560 3300005438 Bacteria 12897
39 Ga0070701_10049552 3300005438 Bacteria 2172
40 Ga0070711_100002890 3300005439 Bacteria 9897
41 Ga0070711_100004061 3300005439 Bacteria 8602
42 Ga0070711_100035360 3300005439 Bacteria 3339
43 Ga0070711_100061901 3300005439 Bacteria 2607
44 Ga0070705_100011492 3300005440 Bacteria 4468
45 Ga0070700_100016555 3300005441 Bacteria 4202
46 Ga0070708_100077797 3300005445 Bacteria 2998
47 Ga0070663_100000346 3300005455 Bacteria 24250
48 Ga0070663_100038266 3300005455 Bacteria 3346
49 Ga0070663_100060219 3300005455 Bacteria 2730
50 Ga0070663_100126482 3300005455 Bacteria 1936
51 Ga0070678_100000614 3300005456 Bacteria 17487
52 Ga0070662_100000432 3300005457 Bacteria 24786
53 Ga0070681_10117046 3300005458 Bacteria 2601
54 Ga0068867_100002257 3300005459 Bacteria 13556
55 Ga0070685_10013806 3300005466 Bacteria 4270
56 Ga0070706_100128503 3300005467 Bacteria 2364
57 Ga0070706_100196661 3300005467 Bacteria 1883
58 Ga0070707_100011425 3300005468 Bacteria 8279
59 Ga0070698_100001196 3300005471 Bacteria 28804
60 Ga0070698_100014214 3300005471 Bacteria 8415
61 Ga0070698_100030911 3300005471 Bacteria 5553
62 Ga0070699_100000764 3300005518 Bacteria 29736
63 Ga0070699_100007678 3300005518 Bacteria 9379
64 Ga0070697_100124722 3300005536 Bacteria 2157
65 Ga0068853_100002578 3300005539 Bacteria 13618
66 Ga0068853_100006403 3300005539 Bacteria 9354
67 Ga0068853_100074589 3300005539 Bacteria 2960
68 Ga0070672_100099511 3300005543 Bacteria 2357
69 Ga0070695_100007910 3300005545 Bacteria 6296
70 Ga0070695_100065667 3300005545 Bacteria 2363
71 Ga0070696_100001571 3300005546 Bacteria 14959
72 Ga0070693_100011593 3300005547 Bacteria 4442
73 Ga0070665_100047016 3300005548 Bacteria 4332
74 Ga0070665_100109951 3300005548 Bacteria 2758
75 Ga0070704_100004159 3300005549 Bacteria 8350
76 Ga0068855_100225392 3300005563 Bacteria 2101
77 Ga0070664_100024907 3300005564 Bacteria 4957
78 Ga0068857_100017181 3300005577 Bacteria 6338
79 Ga0068854_100019634 3300005578 Bacteria 4557
80 Ga0070702_100007259 3300005615 Bacteria 5298
81 Ga0068852_100126526 3300005616 Bacteria 2347
82 Ga0068859_100155012 3300005617 Bacteria 2367
83 Ga0068859_100198532 3300005617 Bacteria 2090
84 Ga0068866_10002878 3300005718 Bacteria 7088
85 Ga0068863_100002923 3300005841 Bacteria 16925
86 Ga0068863_100023008 3300005841 Bacteria 5957
87 Ga0068858_100011053 3300005842 Bacteria 8533
88 Ga0068858_100065364 3300005842 Bacteria 3365
89 Ga0068860_100000150 3300005843 Bacteria 113021
90 Ga0068860_100021823 3300005843 Bacteria 6194
91 Ga0068862_100000078 3300005844 Bacteria 114008
92 Ga0068862_100034339 3300005844 Bacteria 4290
93 Ga0081455_10001381 3300005937 Bacteria 30015
94 Ga0081540_1000526 3300005983 Bacteria 37391
95 Ga0081539_10000086 3300005985 Bacteria 217801
96 Ga0081539_10039003 3300005985 Bacteria 2808
97 Ga0070717_10013919 3300006028 Bacteria 6179
98 Ga0070717_10023864 3300006028 Bacteria 4853
99 Ga0070717_10039626 3300006028 Bacteria 3834
100 Ga0070717_10060550 3300006028 Bacteria 3135
101 Ga0075365_10001375 3300006038 Bacteria 10939
102 Ga0075365_10001792 3300006038 Bacteria 10019
103 Ga0075365_10015399 3300006038 Bacteria 4626
104 Ga0075365_10032660 3300006038 Bacteria 3348
105 Ga0075365_10034620 3300006038 Bacteria 3262
106 Ga0075365_10040470 3300006038 Bacteria 3039
107 Ga0075368_10014777 3300006042 Bacteria 2888
108 Ga0075368_10016679 3300006042 Bacteria 2739
109 Ga0075363_100003651 3300006048 Bacteria 6605
110 Ga0075363_100003717 3300006048 Bacteria 6561
111 Ga0075363_100015312 3300006048 Bacteria 3768
112 Ga0075363_100025561 3300006048 Bacteria 3013
113 Ga0075364_10000763 3300006051 Bacteria 16886
114 Ga0075364_10003008 3300006051 Bacteria 9522
115 Ga0075364_10010592 3300006051 Bacteria 5577
116 Ga0075364_10018772 3300006051 Bacteria 4335
117 Ga0075364_10032895 3300006051 Bacteria 3335
118 Ga0075364_10092036 3300006051 Bacteria 2013
119 Ga0070715_10016039 3300006163 Bacteria 2807
120 Ga0070715_10019773 3300006163 Bacteria 2588
121 Ga0070716_100028562 3300006173 Bacteria 3006
122 Ga0070716_100038713 3300006173 Bacteria 2641
123 Ga0070716_100041261 3300006173 Bacteria 2570
124 Ga0070712_100004853 3300006175 Bacteria 8316
125 Ga0070712_100045597 3300006175 Bacteria 3028
126 Ga0075362_10002955 3300006177 Bacteria 5837
127 Ga0075362_10019260 3300006177 Bacteria 2835
128 Ga0075367_10002381 3300006178 Bacteria 8561
129 Ga0075369_10001355 3300006186 Bacteria 8324
130 Ga0075369_10002007 3300006186 Bacteria 7167
131 Ga0075369_10013536 3300006186 Bacteria 3240
132 Ga0075369_10030506 3300006186 Bacteria 2271
133 Ga0075369_10036556 3300006186 Bacteria 2090
134 Ga0075370_10005609 3300006353 Bacteria 6259
135 Ga0075370_10012487 3300006353 Bacteria 4490
136 Ga0075370_10028313 3300006353 Bacteria 3114
137 Ga0068871_100072623 3300006358 Bacteria 2834
138 Ga0075428_100027391 3300006844 Bacteria 6305
139 Ga0068865_100005626 3300006881 Bacteria 7608
140 Ga0097620_100155020 3300006931 Bacteria 2367
141 Ga0097620_100198537 3300006931 Bacteria 2090
142 Ga0105244_10000510 3300009036 Bacteria 34754
143 Ga0105250_10017879 3300009092 Bacteria 2879
144 Ga0105240_10054668 3300009093 Bacteria 5002
145 Ga0105245_10007729 3300009098 Bacteria 9417
146 Ga0105245_10024506 3300009098 Bacteria 5299
147 Ga0105247_10000074 3300009101 Bacteria 113207
148 Ga0105247_10002062 3300009101 Bacteria 13920
149 Ga0105247_10057815 3300009101 Bacteria 2398
150 Ga0105243_10000289 3300009148 Bacteria 55479
151 Ga0105243_10000320 3300009148 Bacteria 52858
152 Ga0105243_10008584 3300009148 Bacteria 7839
153 Ga0105242_10008449 3300009176 Bacteria 7911
154 Ga0105248_10000077 3300009177 Bacteria 113148
155 Ga0105248_10115368 3300009177 Bacteria 3029
156 Ga0105248_10236653 3300009177 Bacteria 2056
157 Ga0105237_10006473 3300009545 Bacteria 12981
158 Ga0105237_10057364 3300009545 Bacteria 3897
159 Ga0105237_10126396 3300009545 Bacteria 2551
160 Ga0105238_10035966 3300009551 Bacteria 5035
161 Ga0105238_10099172 3300009551 Bacteria 2896
162 Ga0105249_10000111 3300009553 Bacteria 109164
163 Ga0105249_10002996 3300009553 Bacteria 14570
164 Ga0105249_10083599 3300009553 Bacteria 2972
165 Ga0105249_10107890 3300009553 Bacteria 2628
166 Ga0105239_10007577 3300010375 Bacteria 12444
167 Ga0105239_10015124 3300010375 Bacteria 8553
168 Ga0105246_10038935 3300011119 Unclassified 3199
169 Ga0157373_10019867 3300013100 Bacteria 4887
170 Ga0157374_10094027 3300013296 Bacteria 2864
171 Ga0163162_10006863 3300013306 Bacteria 11047
172 Ga0163162_10038718 3300013306 Bacteria 4759
173 Ga0157375_10078279 3300013308 Bacteria 3339
174 Ga0163163_10065264 3300014325 Bacteria 3613
175 Ga0157380_10021060 3300014326 Bacteria 4886
176 Ga0157377_10078632 3300014745 Bacteria 1923
177 Ga0157379_10028802 3300014968 Bacteria 4939
178 Ga0157379_10052990 3300014968 Bacteria 3624
179 Ga0157379_10053557 3300014968 Bacteria 3604
180 Ga0157376_10037696 3300014969 Bacteria 3928
181 Ga0157376_10066049 3300014969 Bacteria 3057
182 Ga0213876_10000704 3300021384 Bacteria 23476
183 Ga0213876_10025841 3300021384 Bacteria 3096
184 Ga0213875_10017719 3300021388 Bacteria 3436
185 Ga0209051_1000034 3300025303 Bacteria 371498
186 Ga0209051_1001216 3300025303 Bacteria 23170
187 Ga0209051_1007995 3300025303 Bacteria 5678
188 Ga0209051_1008529 3300025303 Bacteria 5414
189 Ga0207655_1002085 3300025728 Bacteria 16785
190 Ga0207692_10001536 3300025898 Bacteria 8669
191 Ga0207692_10012129 3300025898 Bacteria 3692
192 Ga0207692_10013100 3300025898 Bacteria 3588
193 Ga0207642_10000893 3300025899 Bacteria 9359
194 Ga0207710_10000086 3300025900 Bacteria 129918
195 Ga0207710_10005728 3300025900 Bacteria 5335
196 Ga0207688_10001044 3300025901 Bacteria 14204
197 Ga0207688_10009239 3300025901 Bacteria 5372
198 Ga0207688_10025886 3300025901 Bacteria 3225
199 Ga0207647_10015380 3300025904 Bacteria 5247
200 Ga0207699_10002700 3300025906 Bacteria 8386
201 Ga0207699_10036795 3300025906 Bacteria 2793
202 Ga0207684_10004936 3300025910 Bacteria 12444
203 Ga0207695_10113758 3300025913 Bacteria 2682
204 Ga0207671_10028233 3300025914 Bacteria 4194
205 Ga0207693_10001709 3300025915 Bacteria 19320
206 Ga0207693_10003694 3300025915 Bacteria 13054
207 Ga0207693_10038811 3300025915 Bacteria 3749
208 Ga0207693_10042912 3300025915 Bacteria 3560
209 Ga0207693_10053199 3300025915 Bacteria 3177
210 Ga0207663_10000984 3300025916 Bacteria 13026
211 Ga0207663_10008447 3300025916 Bacteria 5383
212 Ga0207663_10036880 3300025916 Bacteria 2943
213 Ga0207662_10014442 3300025918 Bacteria 4433
214 Ga0207657_10014838 3300025919 Bacteria 7584
215 Ga0207646_10034486 3300025922 Bacteria 4573
216 Ga0207694_10077616 3300025924 Unclassified 2603
217 Ga0207687_10014059 3300025927 Bacteria 5233
218 Ga0207700_10002848 3300025928 Bacteria 9949
219 Ga0207700_10024776 3300025928 Bacteria 4157
220 Ga0207700_10073387 3300025928 Bacteria 2642
221 Ga0207664_10001897 3300025929 Bacteria 13745
222 Ga0207664_10004784 3300025929 Bacteria 9201
223 Ga0207664_10033281 3300025929 Bacteria 3958
224 Ga0207664_10049593 3300025929 Bacteria 3306
225 Ga0207664_10067999 3300025929 Bacteria 2860
226 Ga0207644_10012148 3300025931 Bacteria 5714
227 Ga0207690_10096583 3300025932 Bacteria 2101
228 Ga0207686_10009036 3300025934 Bacteria 5396
229 Ga0207709_10000326 3300025935 Bacteria 51484
230 Ga0207709_10004680 3300025935 Bacteria 7872
231 Ga0207709_10028933 3300025935 Bacteria 3208
232 Ga0207709_10052392 3300025935 Bacteria 2506
233 Ga0207704_10045872 3300025938 Bacteria 2600
234 Ga0207665_10005509 3300025939 Bacteria 8449
235 Ga0207665_10007441 3300025939 Bacteria 7241
236 Ga0207665_10012962 3300025939 Bacteria 5481
237 Ga0207665_10016807 3300025939 Bacteria 4805
238 Ga0207691_10024114 3300025940 Bacteria 5721
239 Ga0207711_10002507 3300025941 Bacteria 16367
240 Ga0207711_10044465 3300025941 Bacteria 3791
241 Ga0207689_10041452 3300025942 Bacteria 3810
242 Ga0207661_10108706 3300025944 Bacteria 2342
243 Ga0207667_10017308 3300025949 Bacteria 8117
244 Ga0207651_10035848 3300025960 Bacteria 3232
245 Ga0207712_10000359 3300025961 Bacteria 40273
246 Ga0207668_10000928 3300025972 Bacteria 17586
247 Ga0207640_10001743 3300025981 Bacteria 11668
248 Ga0207658_10003085 3300025986 Bacteria 11913
249 Ga0207658_10004646 3300025986 Bacteria 9519
250 Ga0207658_10007205 3300025986 Bacteria 7580
251 Ga0207658_10063236 3300025986 Bacteria 2773
252 Ga0207703_10065116 3300026035 Bacteria 2994
253 Ga0207639_10005623 3300026041 Bacteria 8483
254 Ga0207639_10056639 3300026041 Bacteria 3005
255 Ga0207678_10000470 3300026067 Bacteria 36474
256 Ga0207678_10008317 3300026067 Bacteria 9144
257 Ga0207678_10012535 3300026067 Bacteria 7446
258 Ga0207678_10044269 3300026067 Bacteria 3850
259 Ga0207708_10010031 3300026075 Bacteria 7035
260 Ga0207641_10001160 3300026088 Bacteria 26484
261 Ga0207641_10003664 3300026088 Bacteria 13534
262 Ga0207648_10002259 3300026089 Bacteria 20841
263 Ga0207648_10071264 3300026089 Bacteria 3029
264 Ga0207674_10006266 3300026116 Bacteria 14017
265 Ga0207675_100032367 3300026118 Bacteria 4870
266 Ga0207683_10001470 3300026121 Bacteria 21244
267 Ga0207683_10003942 3300026121 Bacteria 12878
268 Ga0207698_10010836 3300026142 Bacteria 5884
269 Ga0268266_10031218 3300028379 Bacteria 4523
270 Ga0268265_10000012 3300028380 Bacteria 343132
271 Ga0268264_10000104 3300028381 Bacteria 217837
272 Ga0268264_10000155 3300028381 Bacteria 156029
273 Ga0265337_1000189 3300028556 Bacteria 32471
274 Ga0265334_10004354 3300028573 Bacteria 6295
275 Ga0265338_10001286 3300028800 Bacteria 41166
276 Ga0265338_10029310 3300028800 Bacteria 5457
277 Ga0265338_10043965 3300028800 Bacteria 4131
278 Ga0307511_10001088 3300030521 Bacteria 28882
279 Ga0307512_10018221 3300030522 Bacteria 6418
280 Ga0316176_1055854 3300030732 Bacteria 6325
281 Ga0316182_1003641 3300030745 Bacteria 4332
282 Ga0265332_10003210 3300031238 Bacteria 7960
283 Ga0265340_10002821 3300031247 Bacteria 9890
284 Ga0265327_10000004 3300031251 Bacteria 803973
285 Ga0265327_10000274 3300031251 Bacteria 101723
286 Ga0265327_10001702 3300031251 Bacteria 26264
287 Ga0307513_10000198 3300031456 Bacteria 86436
288 Ga0265314_10032628 3300031711 Bacteria 3828
289 Ga0307413_10055223 3300031824 Bacteria 2415
290 Ga0307518_10000486 3300031838 Bacteria 30309
291 Ga0307409_100007560 3300031995 Bacteria 6512
292 Ga0307409_100112138 3300031995 Bacteria 2289
293 Ga0307507_10074129 3300033179 Bacteria 3055
294 Ga0373926_0010197 3300035083 Bacteria 3145
295 Ga0373934_0004253 3300035086 Bacteria 5283
296 Ga0373934_0022809 3300035086 Bacteria 2415
297 Ga0373940_0013936 3300035088 Bacteria 1954
298 Ga0373944_0000572 3300035089 Bacteria 8715
299 Ga0373944_0003552 3300035089 Bacteria 4031
300 Ga0373923_0013836 3300035111 Bacteria 3015
301 Ga0373923_0024889 3300035111 Bacteria 2367
302 Ga0373936_0001661 3300035113 Bacteria 8152
303 Ga0373945_0000063 3300035116 Bacteria 23921
304 Ga0373953_0008677 3300035117 Bacteria 3462
305 Ga0373953_0028766 3300035117 Bacteria 2145
306 Ga0373956_0007134 3300035119 Bacteria 4495
307 Ga0373943_0000639 3300035170 Bacteria 15155
308 Ga0373943_0003607 3300035170 Bacteria 7043
309 Ga0373946_0000960 3300035171 Bacteria 9878
310 Ga0373924_0009366 3300035410 Bacteria 3585
311 Ga0373935_0000853 3300035692 Bacteria 16426
312 Ga0373927_0001934 3300035695 Bacteria 15296
313 Ga0373927_0025767 3300035695 Bacteria 3844
314 Ga0373933_0004818 3300035724 Bacteria 7374
315 Ga0373947_0000952 3300035725 Bacteria 17638
316 Ga0373937_0026885 3300036401 Bacteria 5201
317 Ga0373937_0080780 3300036401 Bacteria 3007
318 Ga0373925_0000072 3300037068 Bacteria 106707
319 Ga0373925_0002590 3300037068 Bacteria 14378
320 Ga0373925_0007011 3300037068 Bacteria 8230
321 Ga0436364_0410131 3300037853 Bacteria 3778
322 Ga0436364_0591707 3300037853 Bacteria 7576
323 Ga0436364_1438977 3300037853 Bacteria 7858
324 Ga0436365_0341904 3300039437 Bacteria 7820
325 Ga0436365_1870027 3300039437 Bacteria 50519
326 Ga0439461_0000259 3300041410 Bacteria 7544
327 Ga0439465_0000144 3300041413 Bacteria 17526
328 Ga0439465_0001423 3300041413 Bacteria 7741
329 Ga0439465_0004106 3300041413 Bacteria 4737
330 Ga0451837_1277956 3300041494 Bacteria 1828
331 Ga0451843_0112177 3300041509 Bacteria 2156
332 Ga0439431_0001040 3300041997 Bacteria 6026
333 Ga0439448_0018703 3300042005 Bacteria 2127
334 Ga0439434_0007193 3300042435 Bacteria 3260
335 Ga0466972_0001659 3300044658 Bacteria 10892
336 Ga0466972_0009368 3300044658 Bacteria 4923
337 Ga0466972_0018184 3300044658 Bacteria 3516
338 Ga0466972_0047671 3300044658 Bacteria 2072
339 Ga0466965_0000192 3300044683 Bacteria 18963
340 Ga0466965_0009126 3300044683 Bacteria 4603
341 Ga0466965_0036791 3300044683 Bacteria 2402
342 Ga0466966_0009760 3300044684 Bacteria 6361
343 Ga0466966_0018446 3300044684 Bacteria 4602
344 Ga0466966_0023330 3300044684 Bacteria 4052
345 Ga0466966_0062324 3300044684 Bacteria 2351
346 Ga0466961_0001778 3300044693 Bacteria 13350
347 Ga0466961_0004127 3300044693 Bacteria 9071
348 Ga0466961_0029585 3300044693 Bacteria 3519
349 Ga0466963_0018690 3300044694 Bacteria 4338
350 Ga0466963_0022452 3300044694 Bacteria 3996
351 Ga0466963_0129564 3300044694 Bacteria 1742
352 Ga0466971_0019283 3300044719 Bacteria 3028
353 Ga0466971_0026608 3300044719 Bacteria 2586
354 Ga0466968_0001060 3300044735 Bacteria 9750
355 Ga0466968_0006556 3300044735 Bacteria 4394
356 Ga0466968_0022210 3300044735 Bacteria 2578
357 Ga0466970_0004142 3300044765 Bacteria 7131
358 Ga0466970_0016998 3300044765 Bacteria 3756
359 Ga0466970_0049113 3300044765 Bacteria 2251
360 Ga0466960_0000268 3300044901 Bacteria 17971
361 Ga0466960_0000775 3300044901 Bacteria 11198
362 Ga0466960_0002460 3300044901 Bacteria 6964
363 Ga0466960_0002894 3300044901 Bacteria 6523
364 Ga0466959_0003887 3300045049 Bacteria 9913
365 Ga0466959_0009155 3300045049 Bacteria 7032
366 Ga0466959_0014938 3300045049 Bacteria 5657
367 Ga0466959_0025109 3300045049 Bacteria 4414
368 Ga0466959_0070815 3300045049 Bacteria 2526
369 Ga0466958_0001690 3300045836 Bacteria 10637
370 Ga0466958_0017177 3300045836 Bacteria 4178
371 Ga0466958_0044518 3300045836 Bacteria 2675
372 Ga0466958_0053131 3300045836 Bacteria 2457
373 Ga0466967_0002377 3300045976 Bacteria 11654
374 Ga0466967_0004350 3300045976 Bacteria 9535
375 Ga0466967_0006781 3300045976 Bacteria 8158
376 Ga0466967_0007847 3300045976 Bacteria 7754
377 Ga0466967_0032717 3300045976 Bacteria 4395
378 Ga0466967_0037235 3300045976 Bacteria 4161
379 Ga0466967_0088597 3300045976 Bacteria 2809
380 Ga0466967_0108046 3300045976 Bacteria 2552
381 Ga0466967_0139289 3300045976 Bacteria 2259
382 Ga0495592_0000831 3300046454 Bacteria 21457
383 Ga0495592_0007188 3300046454 Bacteria 8345
384 Ga0495603_0014944 3300046455 Bacteria 4694
385 Ga0495603_0091492 3300046455 Bacteria 1778
386 Ga0495629_0026031 3300046459 Bacteria 4157
387 Ga0495629_0092353 3300046459 Bacteria 2113
388 Ga0495638_0055236 3300046460 Bacteria 2466
389 Ga0495641_0007985 3300046461 Bacteria 6522
390 Ga0495641_0012223 3300046461 Bacteria 4818
391 Ga0495641_0013375 3300046461 Bacteria 4514
392 Ga0495651_0003087 3300046462 Bacteria 12860
393 Ga0495651_0010663 3300046462 Bacteria 7070
394 Ga0495651_0037455 3300046462 Bacteria 3775
395 Ga0495653_0002608 3300046463 Bacteria 14343
396 Ga0495653_0012520 3300046463 Bacteria 6925
397 Ga0495580_0017702 3300046472 Bacteria 5319
398 Ga0495582_0002871 3300046473 Bacteria 9635
399 Ga0495582_0086589 3300046473 Bacteria 1743
400 Ga0495639_0026071 3300046475 Bacteria 2581
401 Ga0495662_0014879 3300046476 Bacteria 3780
402 Ga0495662_0021426 3300046476 Bacteria 3124
403 Ga0495664_0000220 3300046477 Bacteria 27274
404 Ga0495664_0023634 3300046477 Bacteria 3567
405 Ga0495664_0032198 3300046477 Bacteria 3076
406 Ga0495608_0023048 3300046511 Bacteria 4269
407 Ga0495608_0031398 3300046511 Bacteria 3592
408 Ga0495608_0039926 3300046511 Bacteria 3144
409 Ga0495608_0047264 3300046511 Bacteria 2861
410 Ga0495608_0064323 3300046511 Bacteria 2404
411 Ga0495618_0017792 3300046514 Bacteria 4361
412 Ga0495618_0029410 3300046514 Bacteria 3428
413 Ga0495628_0071698 3300046516 Bacteria 2699
414 Ga0495630_0027031 3300046517 Bacteria 4252
415 Ga0495666_0005772 3300046526 Bacteria 6238
416 Ga0495652_0109366 3300046529 Bacteria 2225
417 Ga0495665_0004311 3300046531 Bacteria 7684
418 Ga0495665_0035542 3300046531 Bacteria 2661
419 Ga0495640_0006614 3300046533 Bacteria 9142
420 Ga0495640_0023854 3300046533 Bacteria 4450
421 Ga0495640_0024392 3300046533 Bacteria 4400
422 Ga0495586_0006789 3300046535 Bacteria 6105
423 Ga0495586_0025786 3300046535 Bacteria 3145
424 Ga0495587_0014653 3300046536 Bacteria 4911
425 Ga0495587_0022101 3300046536 Bacteria 3918
426 Ga0495587_0023299 3300046536 Bacteria 3804
427 Ga0495645_0070035 3300046543 Bacteria 2531
428 Ga0495667_0003797 3300046559 Bacteria 10145
429 Ga0495667_0008305 3300046559 Bacteria 7037
430 Ga0495667_0029986 3300046559 Bacteria 3657
431 Ga0495668_0027125 3300046616 Bacteria 3245
432 Ga0495668_0039470 3300046616 Bacteria 2635
433 Ga0495634_0024194 3300046642 Bacteria 4264
434 Ga0495635_0001457 3300046663 Bacteria 15839
435 Ga0495635_0009705 3300046663 Bacteria 6729
436 Ga0495588_0043991 3300046674 Bacteria 2286
437 Ga0495657_0008915 3300046675 Bacteria 7639
438 Ga0495657_0012315 3300046675 Bacteria 6355
439 Ga0495599_0033405 3300046678 Bacteria 3232
440 Ga0495623_0007354 3300046679 Bacteria 7148
441 Ga0495646_0003847 3300046680 Bacteria 9381
442 Ga0495646_0012031 3300046680 Bacteria 5505
443 Ga0495658_0002896 3300046683 Bacteria 8620
444 Ga0495624_0006089 3300046690 Bacteria 8596
445 Ga0495624_0053025 3300046690 Bacteria 2561
446 Ga0495600_0029983 3300046809 Bacteria 3523
447 Ga0495600_0041632 3300046809 Bacteria 2994
448 Ga0495581_0004679 3300047315 Bacteria 7906
449 Ga0495581_0024853 3300047315 Bacteria 3471
450 Ga0495604_0022284 3300047317 Bacteria 5057
451 Ga0495674_0003143 3300047319 Bacteria 16039
452 Ga0495674_0080199 3300047319 Bacteria 2801
453 Ga0495674_0085516 3300047319 Bacteria 2701
454 Ga0495672_0002758 3300047320 Bacteria 15727
455 Ga0495672_0021511 3300047320 Bacteria 4206
456 Ga0495676_0006015 3300047321 Bacteria 11149
457 Ga0495676_0023539 3300047321 Bacteria 5344
458 Ga0495680_0013293 3300047322 Bacteria 7189
459 Ga0495680_0014676 3300047322 Bacteria 6776
460 Ga0495680_0026724 3300047322 Bacteria 4752
461 Ga0495680_0031254 3300047322 Bacteria 4336
462 Ga0495680_0034264 3300047322 Bacteria 4103
463 Ga0495683_0000421 3300047323 Bacteria 33926
464 Ga0495675_0030233 3300047444 Bacteria 3456
465 Ga0495675_0030330 3300047444 Bacteria 3450
466 Ga0495675_0074013 3300047444 Bacteria 2147
467 Ga0495684_0010160 3300047471 Bacteria 7280
468 Ga0495684_0039979 3300047471 Bacteria 3595
469 Ga0495684_0074705 3300047471 Bacteria 2576
470 Ga0495686_0002680 3300047472 Bacteria 16392
471 Ga0495593_0005040 3300047673 Bacteria 7817
472 Ga0495614_0013100 3300048089 Bacteria 3637
473 Ga0496100_0000169 3300048903 Bacteria 36139
474 Ga0496100_0001459 3300048903 Bacteria 11592
475 Ga0496100_0028133 3300048903 Bacteria 3464
476 Ga0496100_0110048 3300048903 Bacteria 1912
477 Ga0496101_0000059 3300048904 Bacteria 130521
478 Ga0496101_0000808 3300048904 Bacteria 18478
479 Ga0496101_0011656 3300048904 Bacteria 5840
480 Ga0496102_0000083 3300048905 Bacteria 138102
481 Ga0496102_0000621 3300048905 Bacteria 36593
482 Ga0496102_0000721 3300048905 Bacteria 32596
483 Ga0496102_0001551 3300048905 Bacteria 20272
484 Ga0496102_0004351 3300048905 Bacteria 11970
485 Ga0496102_0005748 3300048905 Bacteria 10540
486 Ga0496102_0019868 3300048905 Bacteria 5923
487 Ga0496102_0054514 3300048905 Bacteria 3646
488 Ga0496102_0095247 3300048905 Bacteria 2759
489 Ga0496103_0000060 3300048906 Bacteria 138526
490 Ga0496103_0000215 3300048906 Bacteria 57372
491 Ga0496103_0000548 3300048906 Bacteria 30031
492 Ga0496103_0060795 3300048906 Bacteria 2348
493 Ga0496104_0002283 3300048907 Bacteria 16537
494 Ga0496104_0017658 3300048907 Bacteria 6503
495 Ga0496105_0007022 3300048908 Bacteria 8675
496 Ga0496106_0000656 3300048909 Bacteria 24775
497 Ga0496106_0011638 3300048909 Bacteria 6503
498 Ga0496106_0011826 3300048909 Bacteria 6444
499 Ga0496106_0047585 3300048909 Bacteria 3228
500 Ga0496107_0004768 3300048910 Bacteria 9210
501 Ga0496107_0015313 3300048910 Bacteria 5373
502 Ga0496107_0041508 3300048910 Bacteria 3303
503 Ga0496108_0001059 3300048911 Bacteria 21465
504 Ga0496108_0019695 3300048911 Bacteria 5542
505 Ga0496109_0000972 3300048912 Bacteria 23688
506 Ga0496109_0097458 3300048912 Bacteria 2725
507 Ga0496109_0116257 3300048912 Bacteria 2489
508 Ga0496110_0005418 3300048913 Bacteria 10009
509 Ga0496110_0049355 3300048913 Bacteria 3692
510 Ga0496110_0057826 3300048913 Bacteria 3415
511 Ga0496110_0118425 3300048913 Bacteria 2385
512 Ga0496111_0005465 3300048914 Bacteria 8147
513 Ga0496111_0074744 3300048914 Bacteria 2468
514 Ga0496112_0000453 3300048915 Bacteria 27330
515 Ga0496112_0037669 3300048915 Bacteria 4720
516 Ga0496113_0010905 3300048916 Bacteria 6031
517 Ga0496113_0023044 3300048916 Bacteria 4412
518 Ga0496114_0006910 3300048917 Bacteria 8941
519 Ga0496114_0011111 3300048917 Bacteria 7186
520 Ga0496115_0002853 3300048918 Bacteria 12442
521 Ga0496115_0014441 3300048918 Bacteria 5977
522 Ga0496116_0000159 3300048919 Bacteria 138102
523 Ga0496116_0002589 3300048919 Bacteria 18828
524 Ga0496116_0005469 3300048919 Bacteria 11761
525 Ga0496117_0000167 3300048920 Bacteria 138102
526 Ga0496117_0002257 3300048920 Bacteria 24885
527 Ga0496117_0004619 3300048920 Bacteria 15002
528 Ga0496117_0024942 3300048920 Bacteria 4710
529 Ga0496118_0000121 3300048921 Bacteria 138102
530 Ga0496118_0000160 3300048921 Bacteria 120349
531 Ga0496118_0002464 3300048921 Bacteria 24866
532 Ga0496118_0020939 3300048921 Bacteria 5781
533 Ga0496119_0005170 3300048922 Bacteria 12628
534 Ga0496119_0015087 3300048922 Bacteria 5981
535 Ga0496119_0022220 3300048922 Bacteria 4551
536 Ga0496120_0007715 3300048923 Bacteria 7965
537 Ga0496120_0023124 3300048923 Bacteria 3895
538 Ga0496121_0000002 3300048924 Bacteria 1494588
539 Ga0496121_0000690 3300048924 Bacteria 62907
540 Ga0496121_0007408 3300048924 Bacteria 13261
541 Ga0496122_0001116 3300048925 Bacteria 46294
542 Ga0496123_0018847 3300048926 Bacteria 5467
543 Ga0496124_0000002 3300048927 Bacteria 1494588
544 Ga0496124_0039098 3300048927 Bacteria 4115
545 Ga0496125_0000002 3300048928 Bacteria 1480920
546 Ga0496126_0000009 3300048929 Bacteria 750350
547 Ga0496126_0001058 3300048929 Bacteria 46539
548 Ga0496126_0004263 3300048929 Bacteria 17201
549 Ga0496126_0009352 3300048929 Bacteria 10424
550 Ga0496126_0029025 3300048929 Bacteria 5259
551 Ga0496126_0106225 3300048929 Bacteria 2450
552 Ga0501032_0000241 3300049569 Bacteria 45455
553 Ga0501032_0015556 3300049569 Bacteria 5366
554 Ga0501032_0017352 3300049569 Bacteria 5054
555 Ga0501033_0008007 3300049570 Bacteria 8187
556 Ga0501033_0017603 3300049570 Bacteria 5398
557 Ga0501034_0033129 3300049571 Bacteria 5244
558 Ga0501034_0112472 3300049571 Bacteria 2713
559 Ga0501036_0004947 3300049572 Bacteria 10770
560 Ga0501037_0000194 3300049573 Bacteria 56286
561 Ga0501037_0001558 3300049573 Bacteria 16726
562 Ga0501038_0000163 3300049574 Bacteria 56384
563 Ga0501038_0007570 3300049574 Bacteria 10014
564 Ga0501038_0055596 3300049574 Bacteria 3399
565 Ga0501039_0003023 3300049575 Bacteria 12577
566 Ga0501042_0004930 3300049578 Bacteria 8545
567 Ga0501042_0015464 3300049578 Bacteria 5227
568 Ga0501043_0022464 3300049579 Bacteria 4947
569 Ga0501046_0002371 3300049580 Bacteria 17711
570 Ga0501046_0002488 3300049580 Bacteria 17265
571 Ga0501047_0001872 3300049581 Bacteria 20254
572 Ga0501047_0011257 3300049581 Bacteria 8467
573 Ga0501047_0038481 3300049581 Bacteria 4628
574 Ga0501048_0000286 3300049582 Bacteria 34220
575 Ga0501048_0009104 3300049582 Bacteria 7475
576 Ga0501069_0022549 3300049585 Bacteria 3427
577 Ga0501070_0001787 3300049586 Bacteria 18980
578 Ga0501070_0009494 3300049586 Bacteria 8225
579 Ga0501070_0058211 3300049586 Bacteria 3203
580 Ga0501072_0094486 3300049588 Bacteria 2376
581 Ga0501073_0013132 3300049589 Bacteria 6038
582 Ga0501083_0033278 3300049744 Bacteria 3531
583 Ga0501035_0000218 3300049822 Bacteria 68475
584 Ga0501035_0004799 3300049822 Bacteria 12816
585 Ga0501035_0010663 3300049822 Bacteria 8509
586 Ga0501044_0000639 3300049823 Bacteria 42286
587 Ga0501044_0000719 3300049823 Bacteria 39936
588 Ga0501044_0076481 3300049823 Bacteria 3397
589 Ga0501045_0069066 3300049824 Bacteria 2597
590 Ga0501045_0094054 3300049824 Bacteria 2217
591 nmdc:mga03683_10050_c1 3300050489 Bacteria 3383
592 nmdc:mga03n38_15218_c1 3300050490 Bacteria 2966
593 nmdc:mga03n38_19382_c2 3300050490 Bacteria 2078
594 nmdc:mga03n38_2351_c1 3300050490 Bacteria 5817
595 nmdc:mga03n38_3217_c1 3300050490 Bacteria 5206
596 nmdc:mga03n38_3785_c1 3300050490 Bacteria 4910
597 nmdc:mga03n38_449_c1 3300050490 Bacteria 10277
598 nmdc:mga03n38_4691_c1 3300050490 Bacteria 4562
599 nmdc:mga00v17_11628_c1 3300050491 Bacteria 4839
600 nmdc:mga00v17_12920_c1 3300050491 Bacteria 4622
601 nmdc:mga00v17_25153_c1 3300050491 Bacteria 3458
602 nmdc:mga00v17_27433_c1 3300050491 Bacteria 3325
603 nmdc:mga00v17_29376_c1 3300050491 Bacteria 3227
604 nmdc:mga00v17_34946_c1 3300050491 Bacteria 2687
605 nmdc:mga00v17_3754_c1 3300050491 Bacteria 7841
606 nmdc:mga00v17_50049_c1 3300050491 Bacteria 2537
607 nmdc:mga00v17_5063_c1 3300050491 Bacteria 6919
608 nmdc:mga00v17_93385_c1 3300050491 Bacteria 1892
609 nmdc:mga0yw44_13504_c1 3300050492 Bacteria 4304
610 nmdc:mga0yw44_33739_c1 3300050492 Bacteria 2993
611 nmdc:mga0yw44_34254_c1 3300050492 Bacteria 2974
612 nmdc:mga0yw44_4742_c1 3300050492 Bacteria 6298
613 nmdc:mga0yw44_71469_c1 3300050492 Bacteria 2155
614 nmdc:mga0yw44_72833_c1 3300050492 Bacteria 2136
615 nmdc:mga0yw44_88268_c1 3300050492 Bacteria 1955
616 nmdc:mga06z11_70924_c1 3300050494 Bacteria 1843
617 nmdc:mga06z11_8231_c1 3300050494 Bacteria 4335
618 nmdc:mga07m45_27632_c1 3300050496 Bacteria 3127
619 nmdc:mga07m45_3475_c2 3300050496 Bacteria 4399
620 nmdc:mga07m45_43342_c1 3300050496 Bacteria 2522
621 nmdc:mga07m45_49672_c1 3300050496 Bacteria 2362
622 nmdc:mga0sz30_1386_c1 3300050516 Bacteria 8253
623 nmdc:mga0sz30_1946_c1 3300050516 Bacteria 7380
624 nmdc:mga0sz30_5861_c2 3300050516 Bacteria 2796
625 Ga0495601_0042091 3300053077 Bacteria 2864
626 Ga0495601_0083069 3300053077 Bacteria 2057
627 Ga0495612_0018932 3300053078 Bacteria 2756
628 Ga0495595_0004652 3300053084 Bacteria 5519
629 Ga0495595_0045336 3300053084 Bacteria 2022
630 Ga0495619_0018188 3300053085 Bacteria 4457
631 Ga0495619_0068887 3300053085 Bacteria 2364
632 Ga0495619_0100804 3300053085 Bacteria 1965
633 Ga0500643_009094 3300053087 Bacteria 3827
634 Ga0500644_0000067 3300053088 Bacteria 61703
635 Ga0500556_0003191 3300053104 Bacteria 4884
636 Ga0500556_0012709 3300053104 Bacteria 2524
637 Ga0500562_003774 3300053108 Bacteria 3811
638 Ga0500593_000139 3300053117 Bacteria 28985
639 Ga0500652_002153 3300053131 Bacteria 5924
640 Ga0500573_0004302 3300053140 Bacteria 7473
641 Ga0500577_0017911 3300053142 Bacteria 2266
642 Ga0500616_0000060 3300053153 Bacteria 252252
643 Ga0500616_0007654 3300053153 Bacteria 6823
644 Ga0500645_000020 3300053730 Bacteria 134162
645 Ga0466962_0009146 3300061719 Bacteria 4745
646 Ga0466962_0038878 3300061719 Bacteria 2279
647 Ga0466962_0048769 3300061719 Bacteria 2023
648 2583150744 2582580736 Bacteria 5325865
649 2523387750 2523231044 Bacteria 6434991
650 2548692754 2547132424 Bacteria 8348532
651 2548698159 2547132424 Bacteria 8348532
652 2552105338 2551306166 Bacteria 9731570
653 2558905613 2558860112 Bacteria 9931328
654 2559431283 2558860280 Bacteria 11429938
655 2566992425 2565956761 Bacteria 6601618
656 2566995953 2565956761 Bacteria 6601618
657 2586062592 2585427649 Bacteria 9053857
658 2643825948 2643221561 Bacteria 4984412
659 2643891700 2643221576 Bacteria 5214352
660 2643960748 2643221590 Bacteria 5214697
661 2644089278 2643221615 Bacteria 5487866
662 2644319123 2643221657 Bacteria 5490246
663 2644491372 2643221687 Bacteria 6500351
664 2644512008 2643221692 Bacteria 7282860
665 2644515707 2643221692 Bacteria 7282860
666 2644531939 2643221696 Bacteria 5431823
667 2644636886 2643221715 Bacteria 6671032
668 2645721709 2643221961 Bacteria 3919167
669 2645724341 2643221962 Bacteria 3874254
670 2738669210 2738541264 Bacteria 5935393
671 2738703572 2738541274 Bacteria 6909446
672 2738891603 2738541308 Bacteria 7020677
673 2739148306 2738541356 Bacteria 5935017
674 2739204056 2738543005 Bacteria 5278128
675 2739204758 2738543005 Bacteria 5278128
676 2739239567 2738543011 Bacteria 5731169
677 2739240449 2738543011 Bacteria 5731169
678 2739328967 2738543028 Bacteria 6917070
679 2739362418 2738543034 Bacteria 6084756
680 2744954463 2744054611 Bacteria 5611514
681 2753038783 2751185725 Bacteria 5740550
682 2753039675 2751185725 Bacteria 5740550
683 2753327431 2751185792 Bacteria 5739090
684 2753328184 2751185792 Bacteria 5739090
685 2809588227 2808606522 Bacteria 9488490
686 2842140273 2842134933 Bacteria 5847019
687 2842889784 2842888712 Bacteria 4279094
688 2855387016 2855386786 Bacteria 4752232
689 2866618472 2866612099 Bacteria 7543886
690 2889303786 2889300758 Bacteria 5690814
691 2889304755 2889300758 Bacteria 5690814
692 2899367063 2899359706 Bacteria 10940472
693 2899372298 2899370129 Bacteria 6781179
694 2902795735 2902792274 Bacteria 7270173
695 2902804251 2902799365 Bacteria 5419524
696 2902814392 2902810491 Bacteria 6794147
697 2902842525 2902837492 Bacteria 6697721
698 2904539323 2904535858 Bacteria 6308016
699 2904540589 2904535858 Bacteria 6308016
700 2904770365 2904765812 Bacteria 5369154
701 2915771288 2915768154 Bacteria 8424322
702 2917741680 2917736166 Bacteria 9690793
703 2919422374 2919420072 Bacteria 5390363
704 2919435373 2919432681 Bacteria 5390474
705 2919715643 2919713450 Bacteria 7431245
706 2919718018 2919713450 Bacteria 7431245
707 2922554673 2922554459 Bacteria 6683962
708 2922555597 2922554459 Bacteria 6683962
709 2928145781 2928142448 Bacteria 5288925
710 2928147334 2928142448 Bacteria 5288925
711 2929218016 2929212328 Bacteria 7708288
712 2932400349 2932398195 Bacteria 3847976
713 2939584112 2939582691 Bacteria 7088898
714 2939587718 2939582691 Bacteria 7088898
715 2939744858 2939743619 Bacteria 5762299
716 2939747570 2939743619 Bacteria 5762299
717 3006501202 3006493962 Bacteria 8825450
718 8003316825 8003314358 Bacteria 10575343
719 8056210802 8056207758 Bacteria 8639239
720 JGI24034J26672_10001838
721 Ga0055540_1000129
722 Ga0055540_1001745
723 Ga0055540_1004105
724 Ga0055540_1007649
725 Ga0070658_10010848
726 Ga0070690_100033772
727 Ga0068869_100015173
728 Ga0070680_100008494
729 Ga0070682_100049204
730 Ga0068868_100001236
731 Ga0068868_100022508
732 Ga0070660_100113103
733 Ga0070689_100022950
734 Ga0070668_100001358
735 Ga0070668_100001665
736 Ga0070669_100042620
737 Ga0070669_100043302
738 Ga0070671_100007331
739 Ga0070674_100023411
740 Ga0070659_100009893
741 Ga0070667_100000220
742 Ga0070667_100003332
743 Ga0070667_100003781
744 Ga0070667_100072985
745 Ga0070667_100077809
746 Ga0070709_10001154
747 Ga0070709_10067826
748 Ga0070714_100000205
749 Ga0070714_100016392
750 Ga0070714_100019490
751 Ga0070714_100025647
752 Ga0070714_100039528
753 Ga0070714_100101343
754 Ga0070710_10000331
755 Ga0070710_10006316
756 Ga0070710_10015488
757 Ga0070701_10000560
758 Ga0070701_10049552
759 Ga0070711_100002890
760 Ga0070711_100004061
761 Ga0070711_100035360
762 Ga0070711_100061901
763 Ga0070705_100011492
764 Ga0070700_100016555
765 Ga0070708_100077797
766 Ga0070663_100000346
767 Ga0070663_100038266
768 Ga0070663_100060219
769 Ga0070663_100126482
770 Ga0070678_100000614
771 Ga0070662_100000432
772 Ga0070681_10117046
773 Ga0068867_100002257
774 Ga0070685_10013806
775 Ga0070706_100128503
776 Ga0070706_100196661
777 Ga0070707_100011425
778 Ga0070698_100001196
779 Ga0070698_100014214
780 Ga0070698_100030911
781 Ga0070699_100000764
782 Ga0070699_100007678
783 Ga0070697_100124722
784 Ga0068853_100002578
785 Ga0068853_100006403
786 Ga0068853_100074589
787 Ga0070672_100099511
788 Ga0070695_100007910
789 Ga0070695_100065667
790 Ga0070696_100001571
791 Ga0070693_100011593
792 Ga0070665_100047016
793 Ga0070665_100109951
794 Ga0070704_100004159
795 Ga0068855_100225392
796 Ga0070664_100024907
797 Ga0068857_100017181
798 Ga0068854_100019634
799 Ga0070702_100007259
800 Ga0068852_100126526
801 Ga0068859_100155012
802 Ga0068859_100198532
803 Ga0068866_10002878
804 Ga0068863_100002923
805 Ga0068863_100023008
806 Ga0068858_100011053
807 Ga0068858_100065364
808 Ga0068860_100000150
809 Ga0068860_100021823
810 Ga0068862_100000078
811 Ga0068862_100034339
812 Ga0081455_10001381
813 Ga0081540_1000526
814 Ga0081539_10000086
815 Ga0081539_10039003
816 Ga0070717_10013919
817 Ga0070717_10023864
818 Ga0070717_10039626
819 Ga0070717_10060550
820 Ga0075365_10001375
821 Ga0075365_10001792
822 Ga0075365_10015399
823 Ga0075365_10032660
824 Ga0075365_10034620
825 Ga0075365_10040470
826 Ga0075368_10014777
827 Ga0075368_10016679
828 Ga0075363_100003651
829 Ga0075363_100003717
830 Ga0075363_100015312
831 Ga0075363_100025561
832 Ga0075364_10000763
833 Ga0075364_10003008
834 Ga0075364_10010592
835 Ga0075364_10018772
836 Ga0075364_10032895
837 Ga0075364_10092036
838 Ga0070715_10016039
839 Ga0070715_10019773
840 Ga0070716_100028562
841 Ga0070716_100038713
842 Ga0070716_100041261
843 Ga0070712_100004853
844 Ga0070712_100045597
845 Ga0075362_10002955
846 Ga0075362_10019260
847 Ga0075367_10002381
848 Ga0075369_10001355
849 Ga0075369_10002007
850 Ga0075369_10013536
851 Ga0075369_10030506
852 Ga0075369_10036556
853 Ga0075370_10005609
854 Ga0075370_10012487
855 Ga0075370_10028313
856 Ga0068871_100072623
857 Ga0075428_100027391
858 Ga0068865_100005626
859 Ga0097620_100155020
860 Ga0097620_100198537
861 Ga0105244_10000510
862 Ga0105250_10017879
863 Ga0105240_10054668
864 Ga0105245_10007729
865 Ga0105245_10024506
866 Ga0105247_10000074
867 Ga0105247_10002062
868 Ga0105247_10057815
869 Ga0105243_10000289
870 Ga0105243_10000320
871 Ga0105243_10008584
872 Ga0105242_10008449
873 Ga0105248_10000077
874 Ga0105248_10115368
875 Ga0105248_10236653
876 Ga0105237_10006473
877 Ga0105237_10057364
878 Ga0105237_10126396
879 Ga0105238_10035966
880 Ga0105238_10099172
881 Ga0105249_10000111
882 Ga0105249_10002996
883 Ga0105249_10083599
884 Ga0105249_10107890
885 Ga0105239_10007577
886 Ga0105239_10015124
887 Ga0105246_10038935
888 Ga0157373_10019867
889 Ga0157374_10094027
890 Ga0163162_10006863
891 Ga0163162_10038718
892 Ga0157375_10078279
893 Ga0163163_10065264
894 Ga0157380_10021060
895 Ga0157377_10078632
896 Ga0157379_10028802
897 Ga0157379_10052990
898 Ga0157379_10053557
899 Ga0157376_10037696
900 Ga0157376_10066049
901 Ga0213876_10000704
902 Ga0213876_10025841
903 Ga0213875_10017719
904 Ga0209051_1000034
905 Ga0209051_1001216
906 Ga0209051_1007995
907 Ga0209051_1008529
908 Ga0207655_1002085
909 Ga0207692_10001536
910 Ga0207692_10012129
911 Ga0207692_10013100
912 Ga0207642_10000893
913 Ga0207710_10000086
914 Ga0207710_10005728
915 Ga0207688_10001044
916 Ga0207688_10009239
917 Ga0207688_10025886
918 Ga0207647_10015380
919 Ga0207699_10002700
920 Ga0207699_10036795
921 Ga0207684_10004936
922 Ga0207695_10113758
923 Ga0207671_10028233
924 Ga0207693_10001709
925 Ga0207693_10003694
926 Ga0207693_10038811
927 Ga0207693_10042912
928 Ga0207693_10053199
929 Ga0207663_10000984
930 Ga0207663_10008447
931 Ga0207663_10036880
932 Ga0207662_10014442
933 Ga0207657_10014838
934 Ga0207646_10034486
935 Ga0207694_10077616
936 Ga0207687_10014059
937 Ga0207700_10002848
938 Ga0207700_10024776
939 Ga0207700_10073387
940 Ga0207664_10001897
941 Ga0207664_10004784
942 Ga0207664_10033281
943 Ga0207664_10049593
944 Ga0207664_10067999
945 Ga0207644_10012148
946 Ga0207690_10096583
947 Ga0207686_10009036
948 Ga0207709_10000326
949 Ga0207709_10004680
950 Ga0207709_10028933
951 Ga0207709_10052392
952 Ga0207704_10045872
953 Ga0207665_10005509
954 Ga0207665_10007441
955 Ga0207665_10012962
956 Ga0207665_10016807
957 Ga0207691_10024114
958 Ga0207711_10002507
959 Ga0207711_10044465
960 Ga0207689_10041452
961 Ga0207661_10108706
962 Ga0207667_10017308
963 Ga0207651_10035848
964 Ga0207712_10000359
965 Ga0207668_10000928
966 Ga0207640_10001743
967 Ga0207658_10003085
968 Ga0207658_10004646
969 Ga0207658_10007205
970 Ga0207658_10063236
971 Ga0207703_10065116
972 Ga0207639_10005623
973 Ga0207639_10056639
974 Ga0207678_10000470
975 Ga0207678_10008317
976 Ga0207678_10012535
977 Ga0207678_10044269
978 Ga0207708_10010031
979 Ga0207641_10001160
980 Ga0207641_10003664
981 Ga0207648_10002259
982 Ga0207648_10071264
983 Ga0207674_10006266
984 Ga0207675_100032367
985 Ga0207683_10001470
986 Ga0207683_10003942
987 Ga0207698_10010836
988 Ga0268266_10031218
989 Ga0268265_10000012
990 Ga0268264_10000104
991 Ga0268264_10000155
992 Ga0265337_1000189
993 Ga0265334_10004354
994 Ga0265338_10001286
995 Ga0265338_10029310
996 Ga0265338_10043965
997 Ga0307511_10001088
998 Ga0307512_10018221
999 Ga0316176_1055854
1000 Ga0316182_1003641
1001 Ga0265332_10003210
1002 Ga0265340_10002821
1003 Ga0265327_10000004
1004 Ga0265327_10000274
1005 Ga0265327_10001702
1006 Ga0307513_10000198
1007 Ga0265314_10032628
1008 Ga0307413_10055223
1009 Ga0307518_10000486
1010 Ga0307409_100007560
1011 Ga0307409_100112138
1012 Ga0307507_10074129
1013 Ga0373926_0010197
1014 Ga0373934_0004253
1015 Ga0373934_0022809
1016 Ga0373940_0013936
1017 Ga0373944_0000572
1018 Ga0373944_0003552
1019 Ga0373923_0013836
1020 Ga0373923_0024889
1021 Ga0373936_0001661
1022 Ga0373945_0000063
1023 Ga0373953_0008677
1024 Ga0373953_0028766
1025 Ga0373956_0007134
1026 Ga0373943_0000639
1027 Ga0373943_0003607
1028 Ga0373946_0000960
1029 Ga0373924_0009366
1030 Ga0373935_0000853
1031 Ga0373927_0001934
1032 Ga0373927_0025767
1033 Ga0373933_0004818
1034 Ga0373947_0000952
1035 Ga0373937_0026885
1036 Ga0373937_0080780
1037 Ga0373925_0000072
1038 Ga0373925_0002590
1039 Ga0373925_0007011
1040 Ga0436364_0410131
1041 Ga0436364_0591707
1042 Ga0436364_1438977
1043 Ga0436365_0341904
1044 Ga0436365_1870027
1045 Ga0439461_0000259
1046 Ga0439465_0000144
1047 Ga0439465_0001423
1048 Ga0439465_0004106
1049 Ga0451837_1277956
1050 Ga0451843_0112177
1051 Ga0439431_0001040
1052 Ga0439448_0018703
1053 Ga0439434_0007193
1054 Ga0466972_0001659
1055 Ga0466972_0009368
1056 Ga0466972_0018184
1057 Ga0466972_0047671
1058 Ga0466965_0000192
1059 Ga0466965_0009126
1060 Ga0466965_0036791
1061 Ga0466966_0009760
1062 Ga0466966_0018446
1063 Ga0466966_0023330
1064 Ga0466966_0062324
1065 Ga0466961_0001778
1066 Ga0466961_0004127
1067 Ga0466961_0029585
1068 Ga0466963_0018690
1069 Ga0466963_0022452
1070 Ga0466963_0129564
1071 Ga0466971_0019283
1072 Ga0466971_0026608
1073 Ga0466968_0001060
1074 Ga0466968_0006556
1075 Ga0466968_0022210
1076 Ga0466970_0004142
1077 Ga0466970_0016998
1078 Ga0466970_0049113
1079 Ga0466960_0000268
1080 Ga0466960_0000775
1081 Ga0466960_0002460
1082 Ga0466960_0002894
1083 Ga0466959_0003887
1084 Ga0466959_0009155
1085 Ga0466959_0014938
1086 Ga0466959_0025109
1087 Ga0466959_0070815
1088 Ga0466958_0001690
1089 Ga0466958_0017177
1090 Ga0466958_0044518
1091 Ga0466958_0053131
1092 Ga0466967_0002377
1093 Ga0466967_0004350
1094 Ga0466967_0006781
1095 Ga0466967_0007847
1096 Ga0466967_0032717
1097 Ga0466967_0037235
1098 Ga0466967_0088597
1099 Ga0466967_0108046
1100 Ga0466967_0139289
1101 Ga0495592_0000831
1102 Ga0495592_0007188
1103 Ga0495603_0014944
1104 Ga0495603_0091492
1105 Ga0495629_0026031
1106 Ga0495629_0092353
1107 Ga0495638_0055236
1108 Ga0495641_0007985
1109 Ga0495641_0012223
1110 Ga0495641_0013375
1111 Ga0495651_0003087
1112 Ga0495651_0010663
1113 Ga0495651_0037455
1114 Ga0495653_0002608
1115 Ga0495653_0012520
1116 Ga0495580_0017702
1117 Ga0495582_0002871
1118 Ga0495582_0086589
1119 Ga0495639_0026071
1120 Ga0495662_0014879
1121 Ga0495662_0021426
1122 Ga0495664_0000220
1123 Ga0495664_0023634
1124 Ga0495664_0032198
1125 Ga0495608_0023048
1126 Ga0495608_0031398
1127 Ga0495608_0039926
1128 Ga0495608_0047264
1129 Ga0495608_0064323
1130 Ga0495618_0017792
1131 Ga0495618_0029410
1132 Ga0495628_0071698
1133 Ga0495630_0027031
1134 Ga0495666_0005772
1135 Ga0495652_0109366
1136 Ga0495665_0004311
1137 Ga0495665_0035542
1138 Ga0495640_0006614
1139 Ga0495640_0023854
1140 Ga0495640_0024392
1141 Ga0495586_0006789
1142 Ga0495586_0025786
1143 Ga0495587_0014653
1144 Ga0495587_0022101
1145 Ga0495587_0023299
1146 Ga0495645_0070035
1147 Ga0495667_0003797
1148 Ga0495667_0008305
1149 Ga0495667_0029986
1150 Ga0495668_0027125
1151 Ga0495668_0039470
1152 Ga0495634_0024194
1153 Ga0495635_0001457
1154 Ga0495635_0009705
1155 Ga0495588_0043991
1156 Ga0495657_0008915
1157 Ga0495657_0012315
1158 Ga0495599_0033405
1159 Ga0495623_0007354
1160 Ga0495646_0003847
1161 Ga0495646_0012031
1162 Ga0495658_0002896
1163 Ga0495624_0006089
1164 Ga0495624_0053025
1165 Ga0495600_0029983
1166 Ga0495600_0041632
1167 Ga0495581_0004679
1168 Ga0495581_0024853
1169 Ga0495604_0022284
1170 Ga0495674_0003143
1171 Ga0495674_0080199
1172 Ga0495674_0085516
1173 Ga0495672_0002758
1174 Ga0495672_0021511
1175 Ga0495676_0006015
1176 Ga0495676_0023539
1177 Ga0495680_0013293
1178 Ga0495680_0014676
1179 Ga0495680_0026724
1180 Ga0495680_0031254
1181 Ga0495680_0034264
1182 Ga0495683_0000421
1183 Ga0495675_0030233
1184 Ga0495675_0030330
1185 Ga0495675_0074013
1186 Ga0495684_0010160
1187 Ga0495684_0039979
1188 Ga0495684_0074705
1189 Ga0495686_0002680
1190 Ga0495593_0005040
1191 Ga0495614_0013100
1192 Ga0496100_0000169
1193 Ga0496100_0001459
1194 Ga0496100_0028133
1195 Ga0496100_0110048
1196 Ga0496101_0000059
1197 Ga0496101_0000808
1198 Ga0496101_0011656
1199 Ga0496102_0000083
1200 Ga0496102_0000621
1201 Ga0496102_0000721
1202 Ga0496102_0001551
1203 Ga0496102_0004351
1204 Ga0496102_0005748
1205 Ga0496102_0019868
1206 Ga0496102_0054514
1207 Ga0496102_0095247
1208 Ga0496103_0000060
1209 Ga0496103_0000215
1210 Ga0496103_0000548
1211 Ga0496103_0060795
1212 Ga0496104_0002283
1213 Ga0496104_0017658
1214 Ga0496105_0007022
1215 Ga0496106_0000656
1216 Ga0496106_0011638
1217 Ga0496106_0011826
1218 Ga0496106_0047585
1219 Ga0496107_0004768
1220 Ga0496107_0015313
1221 Ga0496107_0041508
1222 Ga0496108_0001059
1223 Ga0496108_0019695
1224 Ga0496109_0000972
1225 Ga0496109_0097458
1226 Ga0496109_0116257
1227 Ga0496110_0005418
1228 Ga0496110_0049355
1229 Ga0496110_0057826
1230 Ga0496110_0118425
1231 Ga0496111_0005465
1232 Ga0496111_0074744
1233 Ga0496112_0000453
1234 Ga0496112_0037669
1235 Ga0496113_0010905
1236 Ga0496113_0023044
1237 Ga0496114_0006910
1238 Ga0496114_0011111
1239 Ga0496115_0002853
1240 Ga0496115_0014441
1241 Ga0496116_0000159
1242 Ga0496116_0002589
1243 Ga0496116_0005469
1244 Ga0496117_0000167
1245 Ga0496117_0002257
1246 Ga0496117_0004619
1247 Ga0496117_0024942
1248 Ga0496118_0000121
1249 Ga0496118_0000160
1250 Ga0496118_0002464
1251 Ga0496118_0020939
1252 Ga0496119_0005170
1253 Ga0496119_0015087
1254 Ga0496119_0022220
1255 Ga0496120_0007715
1256 Ga0496120_0023124
1257 Ga0496121_0000002
1258 Ga0496121_0000690
1259 Ga0496121_0007408
1260 Ga0496122_0001116
1261 Ga0496123_0018847
1262 Ga0496124_0000002
1263 Ga0496124_0039098
1264 Ga0496125_0000002
1265 Ga0496126_0000009
1266 Ga0496126_0001058
1267 Ga0496126_0004263
1268 Ga0496126_0009352
1269 Ga0496126_0029025
1270 Ga0496126_0106225
1271 Ga0501032_0000241
1272 Ga0501032_0015556
1273 Ga0501032_0017352
1274 Ga0501033_0008007
1275 Ga0501033_0017603
1276 Ga0501034_0033129
1277 Ga0501034_0112472
1278 Ga0501036_0004947
1279 Ga0501037_0000194
1280 Ga0501037_0001558
1281 Ga0501038_0000163
1282 Ga0501038_0007570
1283 Ga0501038_0055596
1284 Ga0501039_0003023
1285 Ga0501042_0004930
1286 Ga0501042_0015464
1287 Ga0501043_0022464
1288 Ga0501046_0002371
1289 Ga0501046_0002488
1290 Ga0501047_0001872
1291 Ga0501047_0011257
1292 Ga0501047_0038481
1293 Ga0501048_0000286
1294 Ga0501048_0009104
1295 Ga0501069_0022549
1296 Ga0501070_0001787
1297 Ga0501070_0009494
1298 Ga0501070_0058211
1299 Ga0501072_0094486
1300 Ga0501073_0013132
1301 Ga0501083_0033278
1302 Ga0501035_0000218
1303 Ga0501035_0004799
1304 Ga0501035_0010663
1305 Ga0501044_0000639
1306 Ga0501044_0000719
1307 Ga0501044_0076481
1308 Ga0501045_0069066
1309 Ga0501045_0094054
1310 nmdc:mga03683_10050_c1
1311 nmdc:mga03n38_15218_c1
1312 nmdc:mga03n38_19382_c2
1313 nmdc:mga03n38_2351_c1
1314 nmdc:mga03n38_3217_c1
1315 nmdc:mga03n38_3785_c1
1316 nmdc:mga03n38_449_c1
1317 nmdc:mga03n38_4691_c1
1318 nmdc:mga00v17_11628_c1
1319 nmdc:mga00v17_12920_c1
1320 nmdc:mga00v17_25153_c1
1321 nmdc:mga00v17_27433_c1
1322 nmdc:mga00v17_29376_c1
1323 nmdc:mga00v17_34946_c1
1324 nmdc:mga00v17_3754_c1
1325 nmdc:mga00v17_50049_c1
1326 nmdc:mga00v17_5063_c1
1327 nmdc:mga00v17_93385_c1
1328 nmdc:mga0yw44_13504_c1
1329 nmdc:mga0yw44_33739_c1
1330 nmdc:mga0yw44_34254_c1
1331 nmdc:mga0yw44_4742_c1
1332 nmdc:mga0yw44_71469_c1
1333 nmdc:mga0yw44_72833_c1
1334 nmdc:mga0yw44_88268_c1
1335 nmdc:mga06z11_70924_c1
1336 nmdc:mga06z11_8231_c1
1337 nmdc:mga07m45_27632_c1
1338 nmdc:mga07m45_3475_c2
1339 nmdc:mga07m45_43342_c1
1340 nmdc:mga07m45_49672_c1
1341 nmdc:mga0sz30_1386_c1
1342 nmdc:mga0sz30_1946_c1
1343 nmdc:mga0sz30_5861_c2
1344 Ga0495601_0042091
1345 Ga0495601_0083069
1346 Ga0495612_0018932
1347 Ga0495595_0004652
1348 Ga0495595_0045336
1349 Ga0495619_0018188
1350 Ga0495619_0068887
1351 Ga0495619_0100804
1352 Ga0500643_009094
1353 Ga0500644_0000067
1354 Ga0500556_0003191
1355 Ga0500556_0012709
1356 Ga0500562_003774
1357 Ga0500593_000139
1358 Ga0500652_002153
1359 Ga0500573_0004302
1360 Ga0500577_0017911
1361 Ga0500616_0000060
1362 Ga0500616_0007654
1363 Ga0500645_000020
1364 Ga0466962_0009146
1365 Ga0466962_0038878
1366 Ga0466962_0048769
1367 2583150744
1368 2523387750
1369 2548692754
1370 2548698159
1371 2552105338
1372 2558905613
1373 2559431283
1374 2566992425
1375 2566995953
1376 2586062592
1377 2643825948
1378 2643891700
1379 2643960748
1380 2644089278
1381 2644319123
1382 2644491372
1383 2644512008
1384 2644515707
1385 2644531939
1386 2644636886
1387 2645721709
1388 2645724341
1389 2738669210
1390 2738703572
1391 2738891603
1392 2739148306
1393 2739204056
1394 2739204758
1395 2739239567
1396 2739240449
1397 2739328967
1398 2739362418
1399 2744954463
1400 2753038783
1401 2753039675
1402 2753327431
1403 2753328184
1404 2809588227
1405 2842140273
1406 2842889784
1407 2855387016
1408 2866618472
1409 2889303786
1410 2889304755
1411 2899367063
1412 2899372298
1413 2902795735
1414 2902804251
1415 2902814392
1416 2902842525
1417 2904539323
1418 2904540589
1419 2904770365
1420 2915771288
1421 2917741680
1422 2919422374
1423 2919435373
1424 2919715643
1425 2919718018
1426 2922554673
1427 2922555597
1428 2928145781
1429 2928147334
1430 2929218016
1431 2932400349
1432 2939584112
1433 2939587718
1434 2939744858
1435 2939747570
1436 3006501202
1437 8003316825
1438 8056210802

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13450

NAD_binding_8

NAD(P)-binding Rossmann-like domain

17

61

0.93

PF00890

FAD_binding_2

FAD binding domain

14

554

0.91

PF01946

Thi4

Thi4 family

10

80

0.88

PF01134

GIDA

Glucose inhibited division protein A

14

111

0.87

PF12831

FAD_oxidored

FAD dependent oxidoreductase

14

108

0.79

PF01266

DAO

FAD dependent oxidoreductase

14

308

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p18-assembly2.cif.gz_B crystal structure of 3-ketosteroid delta1-dehydrogenase from sterolibacterium denitrificans in complex with 1,4-androstadiene-3,17-dione 0.922 4 547
7p18-assembly2.cif.gz_B crystal structure of 3-ketosteroid delta1-dehydrogenase from sterolibacterium denitrificans in complex with 1,4-androstadiene-3,17-dione 0.9157 4 547
2cvj-assembly1.cif.gz_A crystal structure of thioredoxin reductase-related protein ttha0370 from thermus thermophilus hb8 0.9009 6 33
5m5j-assembly1.cif.gz_A thioredoxin reductase from giardia duodenalis 0.8957 4 33
1vdc-assembly1.cif.gz_A-2 structure of nadph dependent thioredoxin reductase 0.8933 4 33
ID Description Score Start End Superfamily
af_P71864_2_395_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.989 2 382 3.50.50.60
af_P71864_2_395_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9541 2 382 3.50.50.60
4zn0A01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.901 5 33 3.50.50.60
2cvjA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9009 6 33 3.50.50.60
af_Q4CQD9_26_141_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8841 6 33 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A2S8MPB8-F1-model_v4 deleted 0.995 327 461
AF-A0A2S8M960-F1-model_v4 deleted 0.9938 116 461
AF-P71864-F1-model_v4 3-oxosteroid 1-dehydrogenase (EC 1.3.99.4) (3-keto-Delta(4)-steroid Delta(1)-dehydrogenase) (KSDD) (3-oxo-Delta(4)-steroid 1-dehydrogenase) (KSTD) 0.9936 1 544 GO:0005737
GO:0005886
GO:0006694
GO:0006707
GO:0047571
AF-A0A433CD35-F1-model_v4 deleted 0.9934 327 542
AF-A0A7M3S8T6-F1-model_v4 deleted 0.9913 86 408

Map