F477225
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 719 | 299 | 719 | 278 |
Family's Representative Sequence
| Representative Sequence | 3300005548|Ga0070665_100468003|Ga0070665_1004680032 |
| Length | 330 |
| Sequence | MLHGALQARGPPARILTPMAAPTRSRRISSTPLRPRKRKDKTPAAPPKPAAVGPVPKXDAPPAPVIEFRGVAKEYDSGDIGVEQATFTVARGDFVFFVGPSGSGKSTLIRLLIKELDPTGGTIRVAGLNLSEITEKGVPYYRRNLGVVFQDFKLLPNRTVYDNVAYALQVTGHSRKEIRAKVPDILRLTGLATKLHNFPDQLSGGEQQRVSIARAFVNHPPLLVADEPTGNLDPETSIGIMQLLYRINRTGTTVVVATHDREMVDRMRRRVIQLEQGRVIRDEAAGFYVGDESTREFAARMRDGDPGPDADLPVSRAGKEIDALPREHDG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 36 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 44 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 46 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 47 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 48 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 50 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 51 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 52 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 53 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 54 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 55 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 56 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 57 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 58 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 59 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 60 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 62 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 63 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 64 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 68 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 69 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 70 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 71 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 72 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 73 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 74 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 75 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 77 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 103 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 104 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 105 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 158 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 161 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 162 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 163 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 164 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 165 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 166 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 167 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 168 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 169 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 170 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 171 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 172 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 173 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 174 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 175 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 176 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 177 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 178 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 179 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 180 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 181 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 182 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 183 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 184 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 185 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 186 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 187 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 188 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 189 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 190 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 191 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 192 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 193 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 194 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 195 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 196 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 197 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 198 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 199 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 239 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 240 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 241 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 242 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 243 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 244 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 245 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 246 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 247 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 248 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 249 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 250 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 251 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 252 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 253 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 254 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 255 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 256 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 257 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 275 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 280 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 281 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 282 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 283 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 296 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 297 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 298 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.58 |
| Metatranscriptomes | 0.42 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.2 |
| Nodule | 0 |
| Rhizoplane | 16.27 |
| Rhizosphere | 79.97 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.56 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1004111 | 3300000549 | Bacteria | 1911 |
| 2 | JGI25407J50210_10001587 | 3300003373 | Bacteria | 5183 |
| 3 | Ga0070658_10015503 | 3300005327 | Bacteria | 6096 |
| 4 | Ga0070658_10151055 | 3300005327 | Bacteria | 1945 |
| 5 | Ga0070683_100028945 | 3300005329 | Bacteria | 5010 |
| 6 | Ga0070683_100037483 | 3300005329 | Bacteria | 4438 |
| 7 | Ga0070683_100110974 | 3300005329 | Bacteria | 2587 |
| 8 | Ga0068869_100058170 | 3300005334 | Bacteria | 2825 |
| 9 | Ga0068869_100119666 | 3300005334 | Bacteria | 2013 |
| 10 | Ga0070680_100015319 | 3300005336 | Bacteria | 6007 |
| 11 | Ga0070680_100043211 | 3300005336 | Bacteria | 3660 |
| 12 | Ga0070682_100011195 | 3300005337 | Bacteria | 5119 |
| 13 | Ga0070682_100050574 | 3300005337 | Bacteria | 2595 |
| 14 | Ga0070682_100058674 | 3300005337 | Bacteria | 2428 |
| 15 | Ga0068868_100011835 | 3300005338 | Bacteria | 6361 |
| 16 | Ga0068868_100016431 | 3300005338 | Bacteria | 5496 |
| 17 | Ga0068868_100016773 | 3300005338 | Bacteria | 5446 |
| 18 | Ga0068868_100018104 | 3300005338 | Bacteria | 5259 |
| 19 | Ga0068868_100030208 | 3300005338 | Bacteria | 4155 |
| 20 | Ga0068868_100089212 | 3300005338 | Bacteria | 2482 |
| 21 | Ga0068868_100200232 | 3300005338 | Bacteria | 1664 |
| 22 | Ga0070660_100002839 | 3300005339 | Bacteria | 11929 |
| 23 | Ga0070660_100006060 | 3300005339 | Bacteria | 8359 |
| 24 | Ga0070660_100009392 | 3300005339 | Bacteria | 6875 |
| 25 | Ga0070660_100186885 | 3300005339 | Bacteria | 1678 |
| 26 | Ga0070689_100072393 | 3300005340 | Bacteria | 2694 |
| 27 | Ga0070689_100173892 | 3300005340 | Bacteria | 1746 |
| 28 | Ga0070691_10044147 | 3300005341 | Bacteria | 2113 |
| 29 | Ga0070687_100056701 | 3300005343 | Bacteria | 2051 |
| 30 | Ga0070687_100154329 | 3300005343 | Bacteria | 1351 |
| 31 | Ga0070661_100025148 | 3300005344 | Bacteria | 4277 |
| 32 | Ga0070661_100027674 | 3300005344 | Bacteria | 4085 |
| 33 | Ga0070692_10005288 | 3300005345 | Bacteria | 5484 |
| 34 | Ga0070692_10056320 | 3300005345 | Bacteria | 2058 |
| 35 | Ga0070668_100051335 | 3300005347 | Bacteria | 3177 |
| 36 | Ga0070668_100060266 | 3300005347 | Bacteria | 2938 |
| 37 | Ga0070668_100229392 | 3300005347 | Bacteria | 1534 |
| 38 | Ga0070675_100011764 | 3300005354 | Bacteria | 6854 |
| 39 | Ga0070675_100044247 | 3300005354 | Bacteria | 3640 |
| 40 | Ga0070674_100013587 | 3300005356 | Bacteria | 5038 |
| 41 | Ga0070674_100071502 | 3300005356 | Bacteria | 2454 |
| 42 | Ga0070674_100398636 | 3300005356 | Bacteria | 1124 |
| 43 | Ga0070673_100121356 | 3300005364 | Bacteria | 2181 |
| 44 | Ga0070673_100178412 | 3300005364 | Bacteria | 1817 |
| 45 | Ga0070688_100045380 | 3300005365 | Bacteria | 2715 |
| 46 | Ga0070688_100151967 | 3300005365 | Bacteria | 1583 |
| 47 | Ga0070688_100158909 | 3300005365 | Bacteria | 1551 |
| 48 | Ga0070659_100000030 | 3300005366 | Bacteria | 128662 |
| 49 | Ga0070659_100003072 | 3300005366 | Bacteria | 11853 |
| 50 | Ga0070659_100007128 | 3300005366 | Bacteria | 8109 |
| 51 | Ga0070659_100090951 | 3300005366 | Bacteria | 2446 |
| 52 | Ga0070659_100483829 | 3300005366 | Bacteria | 1053 |
| 53 | Ga0070709_10154429 | 3300005434 | Bacteria | 1589 |
| 54 | Ga0070714_100018715 | 3300005435 | Bacteria | 5634 |
| 55 | Ga0070714_100130846 | 3300005435 | Bacteria | 2243 |
| 56 | Ga0070710_10000002 | 3300005437 | Bacteria | 290371 |
| 57 | Ga0070710_10052656 | 3300005437 | Bacteria | 2290 |
| 58 | Ga0070701_10180337 | 3300005438 | Bacteria | 1236 |
| 59 | Ga0070711_100002079 | 3300005439 | Bacteria | 11310 |
| 60 | Ga0070711_100058046 | 3300005439 | Bacteria | 2682 |
| 61 | Ga0070711_100195817 | 3300005439 | Bacteria | 1556 |
| 62 | Ga0070705_100002095 | 3300005440 | Bacteria | 10161 |
| 63 | Ga0070705_100181033 | 3300005440 | Bacteria | 1428 |
| 64 | Ga0070700_100005075 | 3300005441 | Bacteria | 6943 |
| 65 | Ga0070700_100007134 | 3300005441 | Bacteria | 6015 |
| 66 | Ga0070708_100357294 | 3300005445 | Bacteria | 1377 |
| 67 | Ga0070678_100007985 | 3300005456 | Bacteria | 6308 |
| 68 | Ga0070678_100294040 | 3300005456 | Bacteria | 1378 |
| 69 | Ga0070681_10002829 | 3300005458 | Bacteria | 16032 |
| 70 | Ga0070681_10128134 | 3300005458 | Bacteria | 2471 |
| 71 | Ga0068867_100079020 | 3300005459 | Bacteria | 2475 |
| 72 | Ga0068867_100161951 | 3300005459 | Bacteria | 1765 |
| 73 | Ga0070685_10010229 | 3300005466 | Bacteria | 4869 |
| 74 | Ga0070679_100034677 | 3300005530 | Bacteria | 5002 |
| 75 | Ga0070679_100156115 | 3300005530 | Bacteria | 2257 |
| 76 | Ga0070684_100030701 | 3300005535 | Bacteria | 4569 |
| 77 | Ga0070684_100044176 | 3300005535 | Bacteria | 3852 |
| 78 | Ga0070684_100093670 | 3300005535 | Bacteria | 2674 |
| 79 | Ga0070684_100165382 | 3300005535 | Bacteria | 2008 |
| 80 | Ga0070684_100330208 | 3300005535 | Bacteria | 1401 |
| 81 | Ga0068853_100040299 | 3300005539 | Bacteria | 3985 |
| 82 | Ga0068853_100367488 | 3300005539 | Bacteria | 1341 |
| 83 | Ga0068853_100500022 | 3300005539 | Bacteria | 1148 |
| 84 | Ga0070672_100010299 | 3300005543 | Bacteria | 6479 |
| 85 | Ga0070672_100346972 | 3300005543 | Bacteria | 1265 |
| 86 | Ga0070686_100011251 | 3300005544 | Bacteria | 5070 |
| 87 | Ga0070686_100031311 | 3300005544 | Bacteria | 3251 |
| 88 | Ga0070686_100059709 | 3300005544 | Bacteria | 2458 |
| 89 | Ga0070686_100120057 | 3300005544 | Bacteria | 1804 |
| 90 | Ga0070695_100307511 | 3300005545 | Bacteria | 1174 |
| 91 | Ga0070696_100104892 | 3300005546 | Bacteria | 2030 |
| 92 | Ga0070693_100003310 | 3300005547 | Bacteria | 7490 |
| 93 | Ga0070693_100004855 | 3300005547 | Bacteria | 6416 |
| 94 | Ga0070693_100393552 | 3300005547 | Bacteria | 959 |
| 95 | Ga0070665_100156636 | 3300005548 | Bacteria | 2279 |
| 96 | Ga0070665_100468003 | 3300005548 | Bacteria | 1271 |
| 97 | Ga0070704_100128137 | 3300005549 | Bacteria | 1962 |
| 98 | Ga0070704_100425733 | 3300005549 | Bacteria | 1138 |
| 99 | Ga0068855_100015445 | 3300005563 | Bacteria | 9192 |
| 100 | Ga0068855_100144755 | 3300005563 | Bacteria | 2707 |
| 101 | Ga0068855_100360871 | 3300005563 | Bacteria | 1599 |
| 102 | Ga0070664_100011830 | 3300005564 | Bacteria | 7084 |
| 103 | Ga0070664_100040090 | 3300005564 | Bacteria | 3948 |
| 104 | Ga0068857_100114993 | 3300005577 | Bacteria | 2420 |
| 105 | Ga0068857_100203076 | 3300005577 | Bacteria | 1807 |
| 106 | Ga0068857_100279007 | 3300005577 | Bacteria | 1537 |
| 107 | Ga0068854_100007323 | 3300005578 | Bacteria | 7053 |
| 108 | Ga0068856_100012430 | 3300005614 | Bacteria | 8242 |
| 109 | Ga0068856_100015647 | 3300005614 | Bacteria | 7333 |
| 110 | Ga0068856_100072879 | 3300005614 | Bacteria | 3400 |
| 111 | Ga0068856_100082171 | 3300005614 | Bacteria | 3197 |
| 112 | Ga0068856_100377130 | 3300005614 | Bacteria | 1437 |
| 113 | Ga0068856_100497696 | 3300005614 | Bacteria | 1240 |
| 114 | Ga0070702_100017387 | 3300005615 | Bacteria | 3709 |
| 115 | Ga0070702_100037221 | 3300005615 | Bacteria | 2701 |
| 116 | Ga0068852_100002783 | 3300005616 | Bacteria | 12113 |
| 117 | Ga0068852_100028449 | 3300005616 | Bacteria | 4575 |
| 118 | Ga0068852_100047959 | 3300005616 | Bacteria | 3648 |
| 119 | Ga0068852_100365820 | 3300005616 | Bacteria | 1412 |
| 120 | Ga0068859_100048594 | 3300005617 | Bacteria | 4261 |
| 121 | Ga0068864_100048394 | 3300005618 | Bacteria | 3655 |
| 122 | Ga0068866_10019503 | 3300005718 | Bacteria | 3089 |
| 123 | Ga0068861_100176344 | 3300005719 | Bacteria | 1775 |
| 124 | Ga0068851_10083152 | 3300005834 | Bacteria | 1675 |
| 125 | Ga0068858_100100629 | 3300005842 | Bacteria | 2695 |
| 126 | Ga0068858_100211165 | 3300005842 | Bacteria | 1837 |
| 127 | Ga0068858_100225716 | 3300005842 | Bacteria | 1775 |
| 128 | Ga0068860_100406954 | 3300005843 | Bacteria | 1347 |
| 129 | Ga0081538_10003315 | 3300005981 | Bacteria | 15262 |
| 130 | Ga0081538_10011600 | 3300005981 | Bacteria | 7127 |
| 131 | Ga0081538_10014377 | 3300005981 | Bacteria | 6200 |
| 132 | Ga0081538_10018210 | 3300005981 | Bacteria | 5288 |
| 133 | Ga0081538_10165775 | 3300005981 | Bacteria | 973 |
| 134 | Ga0081540_1003590 | 3300005983 | Bacteria | 12182 |
| 135 | Ga0081540_1056995 | 3300005983 | Bacteria | 1892 |
| 136 | Ga0081539_10005785 | 3300005985 | Bacteria | 12319 |
| 137 | Ga0081539_10031344 | 3300005985 | Bacteria | 3279 |
| 138 | Ga0070717_10000006 | 3300006028 | Bacteria | 353403 |
| 139 | Ga0070717_10006501 | 3300006028 | Bacteria | 8600 |
| 140 | Ga0075365_10000962 | 3300006038 | Bacteria | 12225 |
| 141 | Ga0075365_10034978 | 3300006038 | Bacteria | 3248 |
| 142 | Ga0075365_10039533 | 3300006038 | Bacteria | 3072 |
| 143 | Ga0075365_10044634 | 3300006038 | Bacteria | 2905 |
| 144 | Ga0075365_10051144 | 3300006038 | Bacteria | 2728 |
| 145 | Ga0075365_10189924 | 3300006038 | Bacteria | 1437 |
| 146 | Ga0075363_100004856 | 3300006048 | Bacteria | 5938 |
| 147 | Ga0075363_100068459 | 3300006048 | Bacteria | 1925 |
| 148 | Ga0075364_10141452 | 3300006051 | Bacteria | 1619 |
| 149 | Ga0070716_100104670 | 3300006173 | Bacteria | 1742 |
| 150 | Ga0070712_100000003 | 3300006175 | Bacteria | 253696 |
| 151 | Ga0070712_100001897 | 3300006175 | Bacteria | 12763 |
| 152 | Ga0070712_100023236 | 3300006175 | Bacteria | 4094 |
| 153 | Ga0070712_100160520 | 3300006175 | Bacteria | 1735 |
| 154 | Ga0070712_100412302 | 3300006175 | Bacteria | 1118 |
| 155 | Ga0097621_100008265 | 3300006237 | Bacteria | 7488 |
| 156 | Ga0075428_100046970 | 3300006844 | Bacteria | 4743 |
| 157 | Ga0075428_100182529 | 3300006844 | Bacteria | 2271 |
| 158 | Ga0075430_100001607 | 3300006846 | Bacteria | 18432 |
| 159 | Ga0075430_100008213 | 3300006846 | Bacteria | 8816 |
| 160 | Ga0075430_100022815 | 3300006846 | Bacteria | 5323 |
| 161 | Ga0075430_100182603 | 3300006846 | Bacteria | 1745 |
| 162 | Ga0075431_100016842 | 3300006847 | Bacteria | 7422 |
| 163 | Ga0075431_100039664 | 3300006847 | Bacteria | 4852 |
| 164 | Ga0075433_10038711 | 3300006852 | Bacteria | 4120 |
| 165 | Ga0075433_10241478 | 3300006852 | Bacteria | 1603 |
| 166 | Ga0075433_10273631 | 3300006852 | Bacteria | 1497 |
| 167 | Ga0075434_100000636 | 3300006871 | Bacteria | 27160 |
| 168 | Ga0075434_100006423 | 3300006871 | Bacteria | 10771 |
| 169 | Ga0075434_100015967 | 3300006871 | Bacteria | 7214 |
| 170 | Ga0075434_100054927 | 3300006871 | Bacteria | 3957 |
| 171 | Ga0075434_100061463 | 3300006871 | Bacteria | 3737 |
| 172 | Ga0075434_100063702 | 3300006871 | Bacteria | 3670 |
| 173 | Ga0075429_100017712 | 3300006880 | Bacteria | 6160 |
| 174 | Ga0075429_100045049 | 3300006880 | Bacteria | 3838 |
| 175 | Ga0068865_100021350 | 3300006881 | Bacteria | 4208 |
| 176 | Ga0068865_100044283 | 3300006881 | Bacteria | 3046 |
| 177 | Ga0068865_100284557 | 3300006881 | Bacteria | 1317 |
| 178 | Ga0075436_100014111 | 3300006914 | Bacteria | 5470 |
| 179 | Ga0075436_100017851 | 3300006914 | Bacteria | 4858 |
| 180 | Ga0097620_100048592 | 3300006931 | Bacteria | 4261 |
| 181 | Ga0075435_100005632 | 3300007076 | Bacteria | 8775 |
| 182 | Ga0075435_100030324 | 3300007076 | Bacteria | 4251 |
| 183 | Ga0075435_100107500 | 3300007076 | Bacteria | 2317 |
| 184 | Ga0075435_100169154 | 3300007076 | Bacteria | 1844 |
| 185 | Ga0075435_100214833 | 3300007076 | Bacteria | 1632 |
| 186 | Ga0075435_100352758 | 3300007076 | Bacteria | 1261 |
| 187 | Ga0105240_10194152 | 3300009093 | Bacteria | 2385 |
| 188 | Ga0111539_10018708 | 3300009094 | Bacteria | 8577 |
| 189 | Ga0111539_10126830 | 3300009094 | Bacteria | 2989 |
| 190 | Ga0111539_10177351 | 3300009094 | Bacteria | 2489 |
| 191 | Ga0105245_10000236 | 3300009098 | Bacteria | 52639 |
| 192 | Ga0105245_10000669 | 3300009098 | Bacteria | 31081 |
| 193 | Ga0105245_10002692 | 3300009098 | Bacteria | 15989 |
| 194 | Ga0105245_10011183 | 3300009098 | Bacteria | 7811 |
| 195 | Ga0105245_10011861 | 3300009098 | Bacteria | 7579 |
| 196 | Ga0105245_10061512 | 3300009098 | Bacteria | 3385 |
| 197 | Ga0105245_10062746 | 3300009098 | Bacteria | 3353 |
| 198 | Ga0105247_10016729 | 3300009101 | Bacteria | 4397 |
| 199 | Ga0105247_10121695 | 3300009101 | Bacteria | 1691 |
| 200 | Ga0105247_10215442 | 3300009101 | Bacteria | 1297 |
| 201 | Ga0114129_10034007 | 3300009147 | Bacteria | 7200 |
| 202 | Ga0114129_10039784 | 3300009147 | Bacteria | 6632 |
| 203 | Ga0114129_10090382 | 3300009147 | Bacteria | 4245 |
| 204 | Ga0114129_10165540 | 3300009147 | Bacteria | 3018 |
| 205 | Ga0105243_10011229 | 3300009148 | Bacteria | 6776 |
| 206 | Ga0105243_10014153 | 3300009148 | Bacteria | 6034 |
| 207 | Ga0105243_10053195 | 3300009148 | Bacteria | 3211 |
| 208 | Ga0105241_10015056 | 3300009174 | Bacteria | 5665 |
| 209 | Ga0105242_10038913 | 3300009176 | Bacteria | 3827 |
| 210 | Ga0105242_10165807 | 3300009176 | Bacteria | 1938 |
| 211 | Ga0105242_10572011 | 3300009176 | Bacteria | 1087 |
| 212 | Ga0105248_10080383 | 3300009177 | Bacteria | 3664 |
| 213 | Ga0105248_10199240 | 3300009177 | Bacteria | 2256 |
| 214 | Ga0105237_10072649 | 3300009545 | Bacteria | 3434 |
| 215 | Ga0105238_10005424 | 3300009551 | Bacteria | 12598 |
| 216 | Ga0105238_10023960 | 3300009551 | Bacteria | 6222 |
| 217 | Ga0105238_10028177 | 3300009551 | Bacteria | 5723 |
| 218 | Ga0105249_10003833 | 3300009553 | Bacteria | 12976 |
| 219 | Ga0105249_10118212 | 3300009553 | Bacteria | 2516 |
| 220 | Ga0105249_10139158 | 3300009553 | Bacteria | 2326 |
| 221 | Ga0105239_10110942 | 3300010375 | Bacteria | 3040 |
| 222 | Ga0105239_10316419 | 3300010375 | Bacteria | 1759 |
| 223 | Ga0105246_10004873 | 3300011119 | Bacteria | 8178 |
| 224 | Ga0105246_10005282 | 3300011119 | Bacteria | 7859 |
| 225 | Ga0157371_10165552 | 3300013102 | Bacteria | 1579 |
| 226 | Ga0157370_10034555 | 3300013104 | Bacteria | 4920 |
| 227 | Ga0157369_10042338 | 3300013105 | Bacteria | 4968 |
| 228 | Ga0157369_10098405 | 3300013105 | Bacteria | 3120 |
| 229 | Ga0157374_10006355 | 3300013296 | Bacteria | 10025 |
| 230 | Ga0157374_10131411 | 3300013296 | Bacteria | 2423 |
| 231 | Ga0163162_10065255 | 3300013306 | Bacteria | 3687 |
| 232 | Ga0163162_10193734 | 3300013306 | Bacteria | 2160 |
| 233 | Ga0163162_10497588 | 3300013306 | Bacteria | 1349 |
| 234 | Ga0157372_10025827 | 3300013307 | Bacteria | 6388 |
| 235 | Ga0157372_10031201 | 3300013307 | Bacteria | 5835 |
| 236 | Ga0157372_10049481 | 3300013307 | Bacteria | 4673 |
| 237 | Ga0157372_10056335 | 3300013307 | Bacteria | 4392 |
| 238 | Ga0157372_10392538 | 3300013307 | Bacteria | 1617 |
| 239 | Ga0157375_10019870 | 3300013308 | Bacteria | 6123 |
| 240 | Ga0157375_10090423 | 3300013308 | Bacteria | 3120 |
| 241 | Ga0157375_10312405 | 3300013308 | Bacteria | 1736 |
| 242 | Ga0157380_10076674 | 3300014326 | Bacteria | 2722 |
| 243 | Ga0157377_10002213 | 3300014745 | Bacteria | 8546 |
| 244 | Ga0157377_10077639 | 3300014745 | Bacteria | 1934 |
| 245 | Ga0157379_10027726 | 3300014968 | Bacteria | 5042 |
| 246 | Ga0157379_10091082 | 3300014968 | Bacteria | 2735 |
| 247 | Ga0157376_10056472 | 3300014969 | Bacteria | 3280 |
| 248 | Ga0206350_10446008 | 3300020080 | Bacteria | 1578 |
| 249 | Ga0206354_11046704 | 3300020081 | Bacteria | 2149 |
| 250 | Ga0206353_10712527 | 3300020082 | Bacteria | 2465 |
| 251 | Ga0207656_10017778 | 3300025321 | Bacteria | 2790 |
| 252 | Ga0207692_10000005 | 3300025898 | Bacteria | 370169 |
| 253 | Ga0207688_10001553 | 3300025901 | Bacteria | 12080 |
| 254 | Ga0207688_10007739 | 3300025901 | Bacteria | 5852 |
| 255 | Ga0207688_10017211 | 3300025901 | Bacteria | 3927 |
| 256 | Ga0207688_10029668 | 3300025901 | Bacteria | 3012 |
| 257 | Ga0207688_10038782 | 3300025901 | Bacteria | 2645 |
| 258 | Ga0207688_10038988 | 3300025901 | Bacteria | 2639 |
| 259 | Ga0207688_10089694 | 3300025901 | Bacteria | 1764 |
| 260 | Ga0207647_10046087 | 3300025904 | Bacteria | 2717 |
| 261 | Ga0207685_10003722 | 3300025905 | Bacteria | 3756 |
| 262 | Ga0207699_10173291 | 3300025906 | Bacteria | 1445 |
| 263 | Ga0207643_10055277 | 3300025908 | Bacteria | 2257 |
| 264 | Ga0207705_10034442 | 3300025909 | Bacteria | 3621 |
| 265 | Ga0207654_10059151 | 3300025911 | Bacteria | 2234 |
| 266 | Ga0207707_10004145 | 3300025912 | Bacteria | 12836 |
| 267 | Ga0207707_10300819 | 3300025912 | Bacteria | 1387 |
| 268 | Ga0207671_10002598 | 3300025914 | Bacteria | 19077 |
| 269 | Ga0207671_10123956 | 3300025914 | Bacteria | 1977 |
| 270 | Ga0207693_10000009 | 3300025915 | Bacteria | 168990 |
| 271 | Ga0207693_10000677 | 3300025915 | Bacteria | 30611 |
| 272 | Ga0207693_10023429 | 3300025915 | Bacteria | 4902 |
| 273 | Ga0207693_10070645 | 3300025915 | Bacteria | 2732 |
| 274 | Ga0207663_10000923 | 3300025916 | Bacteria | 13422 |
| 275 | Ga0207663_10073810 | 3300025916 | Bacteria | 2209 |
| 276 | Ga0207660_10016594 | 3300025917 | Bacteria | 4877 |
| 277 | Ga0207660_10064262 | 3300025917 | Bacteria | 2649 |
| 278 | Ga0207660_10270672 | 3300025917 | Bacteria | 1346 |
| 279 | Ga0207662_10046814 | 3300025918 | Bacteria | 2560 |
| 280 | Ga0207662_10162044 | 3300025918 | Bacteria | 1429 |
| 281 | Ga0207662_10207557 | 3300025918 | Bacteria | 1270 |
| 282 | Ga0207657_10003779 | 3300025919 | Bacteria | 16095 |
| 283 | Ga0207657_10008221 | 3300025919 | Bacteria | 10622 |
| 284 | Ga0207657_10010856 | 3300025919 | Bacteria | 9060 |
| 285 | Ga0207657_10056990 | 3300025919 | Bacteria | 3370 |
| 286 | Ga0207649_10023612 | 3300025920 | Bacteria | 3564 |
| 287 | Ga0207652_10019049 | 3300025921 | Bacteria | 5637 |
| 288 | Ga0207681_10008907 | 3300025923 | Bacteria | 6127 |
| 289 | Ga0207694_10032291 | 3300025924 | Bacteria | 4006 |
| 290 | Ga0207694_10065931 | 3300025924 | Bacteria | 2824 |
| 291 | Ga0207694_10234359 | 3300025924 | Bacteria | 1499 |
| 292 | Ga0207659_10024972 | 3300025926 | Bacteria | 4011 |
| 293 | Ga0207659_10149866 | 3300025926 | Bacteria | 1820 |
| 294 | Ga0207687_10021202 | 3300025927 | Bacteria | 4316 |
| 295 | Ga0207687_10021270 | 3300025927 | Bacteria | 4309 |
| 296 | Ga0207687_10024845 | 3300025927 | Bacteria | 4005 |
| 297 | Ga0207687_10033628 | 3300025927 | Bacteria | 3478 |
| 298 | Ga0207687_10158762 | 3300025927 | Bacteria | 1733 |
| 299 | Ga0207687_10180603 | 3300025927 | Bacteria | 1635 |
| 300 | Ga0207664_10020701 | 3300025929 | Bacteria | 4882 |
| 301 | Ga0207664_10025169 | 3300025929 | Bacteria | 4479 |
| 302 | Ga0207664_10145218 | 3300025929 | Bacteria | 2011 |
| 303 | Ga0207690_10000117 | 3300025932 | Bacteria | 65570 |
| 304 | Ga0207690_10022756 | 3300025932 | Bacteria | 3902 |
| 305 | Ga0207690_10025889 | 3300025932 | Bacteria | 3690 |
| 306 | Ga0207690_10406397 | 3300025932 | Bacteria | 1087 |
| 307 | Ga0207706_10036331 | 3300025933 | Bacteria | 4376 |
| 308 | Ga0207706_10074834 | 3300025933 | Bacteria | 2978 |
| 309 | Ga0207686_10080861 | 3300025934 | Bacteria | 2119 |
| 310 | Ga0207686_10230988 | 3300025934 | Bacteria | 1341 |
| 311 | Ga0207709_10005840 | 3300025935 | Bacteria | 6958 |
| 312 | Ga0207709_10110145 | 3300025935 | Bacteria | 1839 |
| 313 | Ga0207709_10126245 | 3300025935 | Bacteria | 1736 |
| 314 | Ga0207709_10247100 | 3300025935 | Bacteria | 1301 |
| 315 | Ga0207670_10160274 | 3300025936 | Bacteria | 1679 |
| 316 | Ga0207669_10038693 | 3300025937 | Bacteria | 2749 |
| 317 | Ga0207669_10076194 | 3300025937 | Bacteria | 2128 |
| 318 | Ga0207669_10107922 | 3300025937 | Bacteria | 1858 |
| 319 | Ga0207665_10011859 | 3300025939 | Bacteria | 5724 |
| 320 | Ga0207665_10103539 | 3300025939 | Bacteria | 1991 |
| 321 | Ga0207665_10326612 | 3300025939 | Bacteria | 1153 |
| 322 | Ga0207691_10013609 | 3300025940 | Bacteria | 7776 |
| 323 | Ga0207691_10399733 | 3300025940 | Bacteria | 1172 |
| 324 | Ga0207711_10036972 | 3300025941 | Bacteria | 4144 |
| 325 | Ga0207711_10264528 | 3300025941 | Bacteria | 1581 |
| 326 | Ga0207689_10040927 | 3300025942 | Bacteria | 3834 |
| 327 | Ga0207689_10127255 | 3300025942 | Bacteria | 2095 |
| 328 | Ga0207689_10168900 | 3300025942 | Bacteria | 1803 |
| 329 | Ga0207661_10006000 | 3300025944 | Bacteria | 8578 |
| 330 | Ga0207661_10369603 | 3300025944 | Bacteria | 1296 |
| 331 | Ga0207667_10009530 | 3300025949 | Bacteria | 11426 |
| 332 | Ga0207651_10023152 | 3300025960 | Bacteria | 3814 |
| 333 | Ga0207651_10084276 | 3300025960 | Bacteria | 2302 |
| 334 | Ga0207712_10053320 | 3300025961 | Bacteria | 2836 |
| 335 | Ga0207712_10083145 | 3300025961 | Bacteria | 2336 |
| 336 | Ga0207668_10029600 | 3300025972 | Bacteria | 3590 |
| 337 | Ga0207668_10435735 | 3300025972 | Bacteria | 1115 |
| 338 | Ga0207640_10063200 | 3300025981 | Bacteria | 2459 |
| 339 | Ga0207640_10166235 | 3300025981 | Bacteria | 1638 |
| 340 | Ga0207640_10168167 | 3300025981 | Bacteria | 1630 |
| 341 | Ga0207658_10139516 | 3300025986 | Bacteria | 1960 |
| 342 | Ga0207677_10019594 | 3300026023 | Bacteria | 4090 |
| 343 | Ga0207677_10048251 | 3300026023 | Bacteria | 2866 |
| 344 | Ga0207677_10099408 | 3300026023 | Bacteria | 2136 |
| 345 | Ga0207677_10177324 | 3300026023 | Bacteria | 1673 |
| 346 | Ga0207703_10031376 | 3300026035 | Bacteria | 4201 |
| 347 | Ga0207703_10207607 | 3300026035 | Bacteria | 1744 |
| 348 | Ga0207639_10011957 | 3300026041 | Bacteria | 6039 |
| 349 | Ga0207639_10102459 | 3300026041 | Bacteria | 2317 |
| 350 | Ga0207639_10420039 | 3300026041 | Bacteria | 1209 |
| 351 | Ga0207678_10033655 | 3300026067 | Bacteria | 4464 |
| 352 | Ga0207678_10318092 | 3300026067 | Bacteria | 1339 |
| 353 | Ga0207708_10000144 | 3300026075 | Bacteria | 56710 |
| 354 | Ga0207708_10017396 | 3300026075 | Bacteria | 5412 |
| 355 | Ga0207708_10040352 | 3300026075 | Bacteria | 3559 |
| 356 | Ga0207708_10042499 | 3300026075 | Bacteria | 3465 |
| 357 | Ga0207708_10050119 | 3300026075 | Bacteria | 3179 |
| 358 | Ga0207702_10006854 | 3300026078 | Bacteria | 9769 |
| 359 | Ga0207702_10011114 | 3300026078 | Bacteria | 7514 |
| 360 | Ga0207702_10419561 | 3300026078 | Bacteria | 1294 |
| 361 | Ga0207648_10013626 | 3300026089 | Bacteria | 7549 |
| 362 | Ga0207648_10029561 | 3300026089 | Bacteria | 4859 |
| 363 | Ga0207648_10092619 | 3300026089 | Bacteria | 2642 |
| 364 | Ga0207676_10070542 | 3300026095 | Bacteria | 2802 |
| 365 | Ga0207676_10392776 | 3300026095 | Bacteria | 1294 |
| 366 | Ga0207674_10048068 | 3300026116 | Bacteria | 4370 |
| 367 | Ga0207674_10079071 | 3300026116 | Bacteria | 3293 |
| 368 | Ga0207674_10112077 | 3300026116 | Bacteria | 2702 |
| 369 | Ga0207674_10150976 | 3300026116 | Bacteria | 2281 |
| 370 | Ga0207675_100059882 | 3300026118 | Bacteria | 3554 |
| 371 | Ga0207675_100476186 | 3300026118 | Bacteria | 1240 |
| 372 | Ga0207683_10049732 | 3300026121 | Bacteria | 3671 |
| 373 | Ga0207683_10067654 | 3300026121 | Bacteria | 3152 |
| 374 | Ga0207683_10239541 | 3300026121 | Bacteria | 1655 |
| 375 | Ga0207683_10266811 | 3300026121 | Bacteria | 1563 |
| 376 | Ga0207698_10010173 | 3300026142 | Bacteria | 6029 |
| 377 | Ga0207698_10075761 | 3300026142 | Bacteria | 2690 |
| 378 | Ga0207698_10227370 | 3300026142 | Bacteria | 1691 |
| 379 | Ga0207428_10031421 | 3300027907 | Bacteria | 4379 |
| 380 | Ga0207428_10194245 | 3300027907 | Bacteria | 1529 |
| 381 | Ga0207428_10397494 | 3300027907 | Bacteria | 1009 |
| 382 | Ga0268266_10083156 | 3300028379 | Bacteria | 2794 |
| 383 | Ga0268265_10128993 | 3300028380 | Bacteria | 2098 |
| 384 | Ga0307408_100219996 | 3300031548 | Bacteria | 1549 |
| 385 | Ga0307405_10141401 | 3300031731 | Bacteria | 1679 |
| 386 | Ga0307413_10281500 | 3300031824 | Bacteria | 1251 |
| 387 | Ga0307410_10074333 | 3300031852 | Bacteria | 2366 |
| 388 | Ga0307410_10099595 | 3300031852 | Bacteria | 2081 |
| 389 | Ga0307410_10416688 | 3300031852 | Bacteria | 1088 |
| 390 | Ga0307410_10498983 | 3300031852 | Bacteria | 1001 |
| 391 | Ga0307406_10011316 | 3300031901 | Bacteria | 5061 |
| 392 | Ga0307406_10015221 | 3300031901 | Bacteria | 4446 |
| 393 | Ga0307406_10022093 | 3300031901 | Bacteria | 3772 |
| 394 | Ga0307407_10115833 | 3300031903 | Bacteria | 1690 |
| 395 | Ga0307407_10122250 | 3300031903 | Bacteria | 1652 |
| 396 | Ga0307412_10110799 | 3300031911 | Bacteria | 1959 |
| 397 | Ga0307412_10239301 | 3300031911 | Bacteria | 1403 |
| 398 | Ga0307409_100006140 | 3300031995 | Bacteria | 7026 |
| 399 | Ga0307409_100012655 | 3300031995 | Bacteria | 5387 |
| 400 | Ga0307409_100017381 | 3300031995 | Bacteria | 4792 |
| 401 | Ga0307409_100035690 | 3300031995 | Bacteria | 3646 |
| 402 | Ga0307409_100058844 | 3300031995 | Bacteria | 2987 |
| 403 | Ga0307409_100731779 | 3300031995 | Bacteria | 991 |
| 404 | Ga0307416_100039385 | 3300032002 | Bacteria | 3658 |
| 405 | Ga0307416_100060389 | 3300032002 | Bacteria | 3087 |
| 406 | Ga0307416_100303348 | 3300032002 | Bacteria | 1589 |
| 407 | Ga0307416_100448243 | 3300032002 | Bacteria | 1342 |
| 408 | Ga0307416_100587841 | 3300032002 | Bacteria | 1191 |
| 409 | Ga0307414_10022264 | 3300032004 | Bacteria | 3994 |
| 410 | Ga0307414_10227233 | 3300032004 | Bacteria | 1536 |
| 411 | Ga0307411_10031520 | 3300032005 | Bacteria | 3263 |
| 412 | Ga0307411_10099204 | 3300032005 | Bacteria | 2055 |
| 413 | Ga0307415_100011611 | 3300032126 | Bacteria | 5051 |
| 414 | Ga0307415_100019604 | 3300032126 | Bacteria | 4111 |
| 415 | Ga0307415_100033263 | 3300032126 | Bacteria | 3346 |
| 416 | Ga0307415_100188307 | 3300032126 | Bacteria | 1626 |
| 417 | Ga0307415_100398446 | 3300032126 | Bacteria | 1174 |
| 418 | Ga0373959_0045130 | 3300034820 | Bacteria | 937 |
| 419 | Ga0373934_0049208 | 3300035086 | Bacteria | 1669 |
| 420 | Ga0373932_0031565 | 3300035112 | Bacteria | 1477 |
| 421 | Ga0373936_0009851 | 3300035113 | Bacteria | 3606 |
| 422 | Ga0373954_0069833 | 3300035118 | Bacteria | 1668 |
| 423 | Ga0373960_0016150 | 3300035121 | Bacteria | 1917 |
| 424 | Ga0373943_0170746 | 3300035170 | Bacteria | 1190 |
| 425 | Ga0373946_0008723 | 3300035171 | Bacteria | 3722 |
| 426 | Ga0316574_0165461 | 3300035398 | Bacteria | 1424 |
| 427 | Ga0373931_0053879 | 3300035691 | Bacteria | 2148 |
| 428 | Ga0373933_0013238 | 3300035724 | Bacteria | 4570 |
| 429 | Ga0373933_0067728 | 3300035724 | Bacteria | 2167 |
| 430 | Ga0373947_0055033 | 3300035725 | Bacteria | 2402 |
| 431 | Ga0373937_0022802 | 3300036401 | Bacteria | 5632 |
| 432 | Ga0373937_0188724 | 3300036401 | Bacteria | 1936 |
| 433 | Ga0373925_0005631 | 3300037068 | Bacteria | 9318 |
| 434 | Ga0395898_0083790 | 3300037466 | Bacteria | 3073 |
| 435 | Ga0395898_0124830 | 3300037466 | Bacteria | 2466 |
| 436 | Ga0395898_0147321 | 3300037466 | Bacteria | 2253 |
| 437 | Ga0395898_0177416 | 3300037466 | Bacteria | 2036 |
| 438 | Ga0395898_0233643 | 3300037466 | Bacteria | 1753 |
| 439 | Ga0395901_0009881 | 3300038443 | Bacteria | 9672 |
| 440 | Ga0395901_0053969 | 3300038443 | Bacteria | 4177 |
| 441 | Ga0451843_1319959 | 3300041509 | Bacteria | 1129 |
| 442 | Ga0439455_0020927 | 3300042012 | Bacteria | 1555 |
| 443 | Ga0466972_0109468 | 3300044658 | Bacteria | 1306 |
| 444 | Ga0466966_0101772 | 3300044684 | Bacteria | 1776 |
| 445 | Ga0466963_0150345 | 3300044694 | Bacteria | 1616 |
| 446 | Ga0466968_0056779 | 3300044735 | Bacteria | 1682 |
| 447 | Ga0466957_0042969 | 3300044842 | Bacteria | 2735 |
| 448 | Ga0466960_0000174 | 3300044901 | Bacteria | 22018 |
| 449 | Ga0466959_0179553 | 3300045049 | Bacteria | 1481 |
| 450 | Ga0466958_0031892 | 3300045836 | Bacteria | 3132 |
| 451 | Ga0466967_0038279 | 3300045976 | Bacteria | 4111 |
| 452 | Ga0466967_0054442 | 3300045976 | Bacteria | 3521 |
| 453 | Ga0466967_0289579 | 3300045976 | Bacteria | 1573 |
| 454 | Ga0466967_0295385 | 3300045976 | Bacteria | 1558 |
| 455 | Ga0466967_0342291 | 3300045976 | Bacteria | 1446 |
| 456 | Ga0495603_0146233 | 3300046455 | Bacteria | 1374 |
| 457 | Ga0495629_0100205 | 3300046459 | Bacteria | 2022 |
| 458 | Ga0495641_0001756 | 3300046461 | Bacteria | 18044 |
| 459 | Ga0495641_0012982 | 3300046461 | Bacteria | 4613 |
| 460 | Ga0495653_0001652 | 3300046463 | Bacteria | 17517 |
| 461 | Ga0495653_0103366 | 3300046463 | Bacteria | 2060 |
| 462 | Ga0495650_0000055 | 3300046471 | Bacteria | 308438 |
| 463 | Ga0495582_0001910 | 3300046473 | Bacteria | 11714 |
| 464 | Ga0495582_0188450 | 3300046473 | Bacteria | 1176 |
| 465 | Ga0495584_0037880 | 3300046491 | Bacteria | 2438 |
| 466 | Ga0495584_0046639 | 3300046491 | Bacteria | 2186 |
| 467 | Ga0495594_0013912 | 3300046499 | Bacteria | 4210 |
| 468 | Ga0495607_0079110 | 3300046501 | Bacteria | 1812 |
| 469 | Ga0495608_0004420 | 3300046511 | Bacteria | 10069 |
| 470 | Ga0495618_0000275 | 3300046514 | Bacteria | 37279 |
| 471 | Ga0495630_0000383 | 3300046517 | Bacteria | 34741 |
| 472 | Ga0495630_0293037 | 3300046517 | Bacteria | 1243 |
| 473 | Ga0495642_0099935 | 3300046528 | Bacteria | 1234 |
| 474 | Ga0495642_0107161 | 3300046528 | Bacteria | 1193 |
| 475 | Ga0495652_0309001 | 3300046529 | Bacteria | 1146 |
| 476 | Ga0495665_0005873 | 3300046531 | Bacteria | 6615 |
| 477 | Ga0495640_0009765 | 3300046533 | Bacteria | 7454 |
| 478 | Ga0495587_0048849 | 3300046536 | Bacteria | 2505 |
| 479 | Ga0495645_0000055 | 3300046543 | Bacteria | 82861 |
| 480 | Ga0495645_0004740 | 3300046543 | Bacteria | 9297 |
| 481 | Ga0495634_0002112 | 3300046642 | Bacteria | 16780 |
| 482 | Ga0495588_0119533 | 3300046674 | Bacteria | 1389 |
| 483 | Ga0495657_0000013 | 3300046675 | Bacteria | 195590 |
| 484 | Ga0495657_0116321 | 3300046675 | Bacteria | 1688 |
| 485 | Ga0495599_0093005 | 3300046678 | Bacteria | 1881 |
| 486 | Ga0495623_0059210 | 3300046679 | Bacteria | 2406 |
| 487 | Ga0495646_0109692 | 3300046680 | Bacteria | 1572 |
| 488 | Ga0495658_0094478 | 3300046683 | Bacteria | 1776 |
| 489 | Ga0495613_0018875 | 3300046689 | Bacteria | 5137 |
| 490 | Ga0495613_0135268 | 3300046689 | Bacteria | 1764 |
| 491 | Ga0495624_0005867 | 3300046690 | Bacteria | 8782 |
| 492 | Ga0495670_0080011 | 3300046691 | Bacteria | 1664 |
| 493 | Ga0495600_0005156 | 3300046809 | Bacteria | 7855 |
| 494 | Ga0495581_0011509 | 3300047315 | Bacteria | 5119 |
| 495 | Ga0495604_0059967 | 3300047317 | Bacteria | 2915 |
| 496 | Ga0495604_0063123 | 3300047317 | Bacteria | 2826 |
| 497 | Ga0495674_0038746 | 3300047319 | Bacteria | 4276 |
| 498 | Ga0495674_0101617 | 3300047319 | Bacteria | 2446 |
| 499 | Ga0495674_0103411 | 3300047319 | Bacteria | 2421 |
| 500 | Ga0495672_0110334 | 3300047320 | Bacteria | 1477 |
| 501 | Ga0495676_0009683 | 3300047321 | Bacteria | 8760 |
| 502 | Ga0495676_0067715 | 3300047321 | Bacteria | 2761 |
| 503 | Ga0495680_0077905 | 3300047322 | Bacteria | 2509 |
| 504 | Ga0495684_0005578 | 3300047471 | Bacteria | 9802 |
| 505 | Ga0495684_0012288 | 3300047471 | Bacteria | 6604 |
| 506 | Ga0495593_0012033 | 3300047673 | Bacteria | 4959 |
| 507 | Ga0495602_0238271 | 3300048088 | Bacteria | 1362 |
| 508 | Ga0495614_0100680 | 3300048089 | Bacteria | 1263 |
| 509 | Ga0496100_0002167 | 3300048903 | Bacteria | 9890 |
| 510 | Ga0496100_0011204 | 3300048903 | Bacteria | 5097 |
| 511 | Ga0496100_0032264 | 3300048903 | Bacteria | 3264 |
| 512 | Ga0496100_0098436 | 3300048903 | Bacteria | 2010 |
| 513 | Ga0496100_0101786 | 3300048903 | Bacteria | 1981 |
| 514 | Ga0496101_0006752 | 3300048904 | Bacteria | 7403 |
| 515 | Ga0496101_0011824 | 3300048904 | Bacteria | 5806 |
| 516 | Ga0496101_0026891 | 3300048904 | Bacteria | 4001 |
| 517 | Ga0496101_0038877 | 3300048904 | Bacteria | 3380 |
| 518 | Ga0496101_0039470 | 3300048904 | Bacteria | 3358 |
| 519 | Ga0496101_0146541 | 3300048904 | Bacteria | 1803 |
| 520 | Ga0496101_0383043 | 3300048904 | Bacteria | 1106 |
| 521 | Ga0496102_0022208 | 3300048905 | Bacteria | 5620 |
| 522 | Ga0496102_0033117 | 3300048905 | Bacteria | 4643 |
| 523 | Ga0496102_0042276 | 3300048905 | Bacteria | 4130 |
| 524 | Ga0496102_0042518 | 3300048905 | Bacteria | 4118 |
| 525 | Ga0496102_0054325 | 3300048905 | Bacteria | 3652 |
| 526 | Ga0496102_0111015 | 3300048905 | Bacteria | 2556 |
| 527 | Ga0496102_0439328 | 3300048905 | Bacteria | 1224 |
| 528 | Ga0496103_0003871 | 3300048906 | Bacteria | 9110 |
| 529 | Ga0496104_0009675 | 3300048907 | Bacteria | 8588 |
| 530 | Ga0496104_0021058 | 3300048907 | Bacteria | 5981 |
| 531 | Ga0496104_0078185 | 3300048907 | Bacteria | 3152 |
| 532 | Ga0496104_0095259 | 3300048907 | Bacteria | 2848 |
| 533 | Ga0496104_0358553 | 3300048907 | Bacteria | 1370 |
| 534 | Ga0496105_0007598 | 3300048908 | Bacteria | 8404 |
| 535 | Ga0496105_0008495 | 3300048908 | Bacteria | 7976 |
| 536 | Ga0496105_0009077 | 3300048908 | Bacteria | 7756 |
| 537 | Ga0496105_0113541 | 3300048908 | Bacteria | 2235 |
| 538 | Ga0496106_0014712 | 3300048909 | Bacteria | 5784 |
| 539 | Ga0496106_0015042 | 3300048909 | Bacteria | 5726 |
| 540 | Ga0496106_0023269 | 3300048909 | Bacteria | 4602 |
| 541 | Ga0496106_0026304 | 3300048909 | Bacteria | 4332 |
| 542 | Ga0496106_0039874 | 3300048909 | Bacteria | 3516 |
| 543 | Ga0496106_0077830 | 3300048909 | Bacteria | 2543 |
| 544 | Ga0496106_0219337 | 3300048909 | Bacteria | 1517 |
| 545 | Ga0496106_0417143 | 3300048909 | Bacteria | 1079 |
| 546 | Ga0496106_0493712 | 3300048909 | Bacteria | 983 |
| 547 | Ga0496107_0000676 | 3300048910 | Bacteria | 19307 |
| 548 | Ga0496107_0000968 | 3300048910 | Bacteria | 17040 |
| 549 | Ga0496107_0011247 | 3300048910 | Bacteria | 6228 |
| 550 | Ga0496107_0015369 | 3300048910 | Bacteria | 5364 |
| 551 | Ga0496107_0018306 | 3300048910 | Bacteria | 4932 |
| 552 | Ga0496107_0049358 | 3300048910 | Bacteria | 3033 |
| 553 | Ga0496107_0063448 | 3300048910 | Bacteria | 2677 |
| 554 | Ga0496107_0117311 | 3300048910 | Bacteria | 1960 |
| 555 | Ga0496107_0172955 | 3300048910 | Bacteria | 1603 |
| 556 | Ga0496107_0299641 | 3300048910 | Bacteria | 1196 |
| 557 | Ga0496108_0006986 | 3300048911 | Bacteria | 9137 |
| 558 | Ga0496108_0007007 | 3300048911 | Bacteria | 9129 |
| 559 | Ga0496108_0008398 | 3300048911 | Bacteria | 8378 |
| 560 | Ga0496108_0024246 | 3300048911 | Bacteria | 4995 |
| 561 | Ga0496108_0024404 | 3300048911 | Bacteria | 4978 |
| 562 | Ga0496108_0027324 | 3300048911 | Bacteria | 4710 |
| 563 | Ga0496108_0157546 | 3300048911 | Bacteria | 1961 |
| 564 | Ga0496109_0003243 | 3300048912 | Bacteria | 13555 |
| 565 | Ga0496109_0010650 | 3300048912 | Bacteria | 7865 |
| 566 | Ga0496109_0015282 | 3300048912 | Bacteria | 6684 |
| 567 | Ga0496109_0025326 | 3300048912 | Bacteria | 5286 |
| 568 | Ga0496109_0036413 | 3300048912 | Bacteria | 4441 |
| 569 | Ga0496109_0041860 | 3300048912 | Bacteria | 4149 |
| 570 | Ga0496109_0064843 | 3300048912 | Bacteria | 3343 |
| 571 | Ga0496109_0098725 | 3300048912 | Bacteria | 2707 |
| 572 | Ga0496109_0125036 | 3300048912 | Bacteria | 2397 |
| 573 | Ga0496109_0179980 | 3300048912 | Bacteria | 1985 |
| 574 | Ga0496109_0299880 | 3300048912 | Bacteria | 1515 |
| 575 | Ga0496109_0411686 | 3300048912 | Bacteria | 1277 |
| 576 | Ga0496110_0000249 | 3300048913 | Bacteria | 34963 |
| 577 | Ga0496110_0006837 | 3300048913 | Bacteria | 9067 |
| 578 | Ga0496110_0015865 | 3300048913 | Bacteria | 6281 |
| 579 | Ga0496110_0019361 | 3300048913 | Bacteria | 5725 |
| 580 | Ga0496110_0022529 | 3300048913 | Bacteria | 5350 |
| 581 | Ga0496110_0070941 | 3300048913 | Bacteria | 3088 |
| 582 | Ga0496110_0117161 | 3300048913 | Bacteria | 2398 |
| 583 | Ga0496110_0177265 | 3300048913 | Bacteria | 1935 |
| 584 | Ga0496110_0224482 | 3300048913 | Bacteria | 1708 |
| 585 | Ga0496111_0007128 | 3300048914 | Bacteria | 7303 |
| 586 | Ga0496111_0008400 | 3300048914 | Bacteria | 6831 |
| 587 | Ga0496111_0008466 | 3300048914 | Bacteria | 6812 |
| 588 | Ga0496111_0017764 | 3300048914 | Bacteria | 4919 |
| 589 | Ga0496111_0023258 | 3300048914 | Bacteria | 4350 |
| 590 | Ga0496111_0045772 | 3300048914 | Bacteria | 3148 |
| 591 | Ga0496111_0052043 | 3300048914 | Bacteria | 2956 |
| 592 | Ga0496111_0082506 | 3300048914 | Bacteria | 2348 |
| 593 | Ga0496111_0122108 | 3300048914 | Bacteria | 1924 |
| 594 | Ga0496112_0005086 | 3300048915 | Bacteria | 11301 |
| 595 | Ga0496112_0012867 | 3300048915 | Bacteria | 7702 |
| 596 | Ga0496112_0013233 | 3300048915 | Bacteria | 7612 |
| 597 | Ga0496112_0020728 | 3300048915 | Bacteria | 6236 |
| 598 | Ga0496112_0027218 | 3300048915 | Bacteria | 5513 |
| 599 | Ga0496112_0035922 | 3300048915 | Bacteria | 4830 |
| 600 | Ga0496112_0057311 | 3300048915 | Bacteria | 3835 |
| 601 | Ga0496112_0060568 | 3300048915 | Bacteria | 3730 |
| 602 | Ga0496112_0209138 | 3300048915 | Bacteria | 1909 |
| 603 | Ga0496112_0407770 | 3300048915 | Bacteria | 1298 |
| 604 | Ga0496113_0001761 | 3300048916 | Bacteria | 12286 |
| 605 | Ga0496113_0005823 | 3300048916 | Bacteria | 7731 |
| 606 | Ga0496113_0009943 | 3300048916 | Bacteria | 6268 |
| 607 | Ga0496113_0012175 | 3300048916 | Bacteria | 5773 |
| 608 | Ga0496113_0025680 | 3300048916 | Bacteria | 4202 |
| 609 | Ga0496113_0030345 | 3300048916 | Bacteria | 3914 |
| 610 | Ga0496113_0039799 | 3300048916 | Bacteria | 3461 |
| 611 | Ga0496113_0053053 | 3300048916 | Bacteria | 3031 |
| 612 | Ga0496113_0090120 | 3300048916 | Bacteria | 2362 |
| 613 | Ga0496113_0176570 | 3300048916 | Bacteria | 1692 |
| 614 | Ga0496113_0225787 | 3300048916 | Bacteria | 1493 |
| 615 | Ga0496114_0004855 | 3300048917 | Bacteria | 10475 |
| 616 | Ga0496114_0011620 | 3300048917 | Bacteria | 7041 |
| 617 | Ga0496114_0013857 | 3300048917 | Bacteria | 6464 |
| 618 | Ga0496114_0013883 | 3300048917 | Bacteria | 6457 |
| 619 | Ga0496114_0179660 | 3300048917 | Bacteria | 1847 |
| 620 | Ga0496114_0388449 | 3300048917 | Bacteria | 1236 |
| 621 | Ga0496115_0000282 | 3300048918 | Bacteria | 43855 |
| 622 | Ga0496115_0000581 | 3300048918 | Bacteria | 28187 |
| 623 | Ga0496115_0001432 | 3300048918 | Bacteria | 17093 |
| 624 | Ga0496115_0072769 | 3300048918 | Bacteria | 2789 |
| 625 | Ga0496115_0082680 | 3300048918 | Bacteria | 2617 |
| 626 | Ga0496119_0065632 | 3300048922 | Bacteria | 2149 |
| 627 | Ga0496121_0040393 | 3300048924 | Bacteria | 4094 |
| 628 | Ga0496122_0257017 | 3300048925 | Bacteria | 972 |
| 629 | Ga0501031_0112382 | 3300049568 | Bacteria | 1779 |
| 630 | Ga0501032_0081123 | 3300049569 | Bacteria | 2158 |
| 631 | Ga0501034_0098077 | 3300049571 | Bacteria | 2926 |
| 632 | Ga0501034_0303232 | 3300049571 | Bacteria | 1533 |
| 633 | Ga0501034_0315712 | 3300049571 | Bacteria | 1496 |
| 634 | Ga0501036_0213675 | 3300049572 | Bacteria | 1620 |
| 635 | Ga0501036_0261959 | 3300049572 | Bacteria | 1448 |
| 636 | Ga0501036_0446203 | 3300049572 | Bacteria | 1078 |
| 637 | Ga0501037_0071404 | 3300049573 | Bacteria | 2525 |
| 638 | Ga0501039_0218320 | 3300049575 | Bacteria | 1499 |
| 639 | Ga0501040_0130181 | 3300049576 | Bacteria | 1769 |
| 640 | Ga0501046_0053408 | 3300049580 | Bacteria | 3183 |
| 641 | Ga0501048_0015944 | 3300049582 | Bacteria | 5544 |
| 642 | Ga0501048_0329665 | 3300049582 | Bacteria | 1087 |
| 643 | Ga0501067_0022371 | 3300049583 | Bacteria | 3498 |
| 644 | Ga0501067_0156833 | 3300049583 | Bacteria | 1268 |
| 645 | Ga0501068_0073264 | 3300049584 | Bacteria | 2092 |
| 646 | Ga0501069_0012787 | 3300049585 | Bacteria | 4469 |
| 647 | Ga0501069_0019101 | 3300049585 | Bacteria | 3703 |
| 648 | Ga0501070_0077618 | 3300049586 | Bacteria | 2748 |
| 649 | Ga0501070_0189058 | 3300049586 | Bacteria | 1693 |
| 650 | Ga0501071_0131830 | 3300049587 | Bacteria | 1857 |
| 651 | Ga0501071_0135237 | 3300049587 | Bacteria | 1834 |
| 652 | Ga0501072_0070913 | 3300049588 | Bacteria | 2752 |
| 653 | Ga0501072_0251474 | 3300049588 | Bacteria | 1407 |
| 654 | Ga0501072_0256926 | 3300049588 | Bacteria | 1391 |
| 655 | Ga0501072_0324477 | 3300049588 | Bacteria | 1223 |
| 656 | Ga0501074_0046749 | 3300049590 | Bacteria | 3129 |
| 657 | Ga0501074_0244943 | 3300049590 | Bacteria | 1275 |
| 658 | Ga0501074_0408916 | 3300049590 | Bacteria | 962 |
| 659 | Ga0501076_0059543 | 3300049592 | Bacteria | 3038 |
| 660 | Ga0501217_065903 | 3300049661 | Bacteria | 977 |
| 661 | Ga0501080_0049265 | 3300049742 | Bacteria | 3921 |
| 662 | Ga0501081_0093453 | 3300049743 | Bacteria | 2118 |
| 663 | Ga0501035_0146741 | 3300049822 | Bacteria | 2048 |
| 664 | Ga0501044_0191857 | 3300049823 | Bacteria | 2005 |
| 665 | nmdc:mga03n38_38433_c1 | 3300050490 | Bacteria | 2070 |
| 666 | nmdc:mga03n38_94137_c1 | 3300050490 | Bacteria | 1432 |
| 667 | nmdc:mga00v17_263711_c1 | 3300050491 | Bacteria | 1118 |
| 668 | nmdc:mga00v17_263733_c1 | 3300050491 | Bacteria | 1118 |
| 669 | nmdc:mga00v17_58993_c1 | 3300050491 | Bacteria | 2353 |
| 670 | nmdc:mga00v17_91480_c1 | 3300050491 | Bacteria | 1911 |
| 671 | nmdc:mga0yw44_26748_c1 | 3300050492 | Bacteria | 3299 |
| 672 | nmdc:mga0yw44_59410_c1 | 3300050492 | Bacteria | 2339 |
| 673 | nmdc:mga0yw44_87694_c1 | 3300050492 | Bacteria | 1962 |
| 674 | nmdc:mga06z11_32083_c1 | 3300050494 | Bacteria | 2558 |
| 675 | nmdc:mga05p37_157690_c1 | 3300050507 | Bacteria | 2773 |
| 676 | nmdc:mga05p37_29983_c1 | 3300050507 | Bacteria | 6637 |
| 677 | nmdc:mga05p37_43891_c1 | 3300050507 | Bacteria | 5500 |
| 678 | nmdc:mga05p37_541883_c1 | 3300050507 | Bacteria | 1327 |
| 679 | nmdc:mga05p37_8891_c1 | 3300050507 | Bacteria | 11867 |
| 680 | nmdc:mga05p37_936144_c1 | 3300050507 | Bacteria | 929 |
| 681 | nmdc:mga09592_33101_c1 | 3300050508 | Bacteria | 4312 |
| 682 | nmdc:mga09592_4149_c2 | 3300050508 | Bacteria | 11364 |
| 683 | nmdc:mga09592_525199_c1 | 3300050508 | Bacteria | 1018 |
| 684 | nmdc:mga0qj67_13160_c1 | 3300050509 | Bacteria | 6247 |
| 685 | nmdc:mga0qj67_40801_c1 | 3300050509 | Bacteria | 3648 |
| 686 | nmdc:mga06r32_2689_c1 | 3300050510 | Bacteria | 15905 |
| 687 | nmdc:mga06r32_38703_c1 | 3300050510 | Bacteria | 4521 |
| 688 | nmdc:mga06r32_550707_c1 | 3300050510 | Bacteria | 1127 |
| 689 | nmdc:mga08y16_105446_c1 | 3300050511 | Bacteria | 2934 |
| 690 | nmdc:mga08y16_132920_c1 | 3300050511 | Bacteria | 2586 |
| 691 | nmdc:mga08y16_196867_c1 | 3300050511 | Bacteria | 2089 |
| 692 | nmdc:mga08y16_207803_c1 | 3300050511 | Bacteria | 2028 |
| 693 | nmdc:mga0n895_1093_c1 | 3300050512 | Bacteria | 19814 |
| 694 | nmdc:mga0n895_136566_c1 | 3300050512 | Bacteria | 2479 |
| 695 | nmdc:mga0n895_43869_c1 | 3300050512 | Bacteria | 4360 |
| 696 | nmdc:mga0n895_5709_c1 | 3300050512 | Bacteria | 10435 |
| 697 | nmdc:mga0n895_91965_c1 | 3300050512 | Bacteria | 3037 |
| 698 | nmdc:mga0rr50_110528_c1 | 3300050513 | Bacteria | 2174 |
| 699 | nmdc:mga0rr50_339934_c1 | 3300050513 | Bacteria | 1261 |
| 700 | nmdc:mga0rr50_425_c1 | 3300050513 | Bacteria | 22784 |
| 701 | nmdc:mga0rr50_44590_c1 | 3300050513 | Bacteria | 3253 |
| 702 | nmdc:mga08x19_113433_c1 | 3300050514 | Bacteria | 1810 |
| 703 | nmdc:mga08x19_16617_c1 | 3300050514 | Bacteria | 4491 |
| 704 | nmdc:mga0a205_124255_c2 | 3300050515 | Bacteria | 1887 |
| 705 | nmdc:mga0a205_137590_c1 | 3300050515 | Bacteria | 2343 |
| 706 | nmdc:mga0a205_185042_c1 | 3300050515 | Bacteria | 1976 |
| 707 | nmdc:mga0a205_47351_c1 | 3300050515 | Bacteria | 4148 |
| 708 | nmdc:mga0a205_53201_c1 | 3300050515 | Bacteria | 3907 |
| 709 | nmdc:mga0a205_64442_c1 | 3300050515 | Bacteria | 3539 |
| 710 | Ga0495601_0029656 | 3300053077 | Bacteria | 3395 |
| 711 | Ga0495612_0000222 | 3300053078 | Bacteria | 24117 |
| 712 | Ga0495619_0177212 | 3300053085 | Bacteria | 1474 |
| 713 | Ga0500556_0000593 | 3300053104 | Bacteria | 23858 |
| 714 | Ga0500616_0006676 | 3300053153 | Bacteria | 7498 |
| 715 | Ga0500616_0010552 | 3300053153 | Bacteria | 5519 |
| 716 | Ga0500599_010383 | 3300053736 | Bacteria | 1231 |
| 717 | Ga0501082_0004346 | 3300060353 | Bacteria | 12388 |
| 718 | Ga0530510_0014384 | 3300061734 | Bacteria | 5580 |
| 719 | Ga0530510_0116220 | 3300061734 | Bacteria | 1961 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005338 | Ga0068868_100016773 | Ga0068868_1000167732 | 235 |
| 2 | 3300005339 | Ga0070660_100006060 | Ga0070660_1000060601 | 235 |
| 3 | 3300005364 | Ga0070673_100121356 | Ga0070673_1001213562 | 235 |
| 4 | 3300005366 | Ga0070659_100090951 | Ga0070659_1000909513 | 235 |
| 5 | 3300005434 | Ga0070709_10154429 | Ga0070709_101544292 | 235 |
| 6 | 3300005438 | Ga0070701_10180337 | Ga0070701_101803372 | 235 |
| 7 | 3300005440 | Ga0070705_100181033 | Ga0070705_1001810332 | 235 |
| 8 | 3300005445 | Ga0070708_100357294 | Ga0070708_1003572942 | 235 |
| 9 | 3300005456 | Ga0070678_100007985 | Ga0070678_1000079853 | 235 |
| 10 | 3300005543 | Ga0070672_100346972 | Ga0070672_1003469721 | 235 |
| 11 | 3300005544 | Ga0070686_100059709 | Ga0070686_1000597092 | 235 |
| 12 | 3300005547 | Ga0070693_100003310 | Ga0070693_1000033103 | 235 |
| 13 | 3300005563 | Ga0068855_100015445 | Ga0068855_1000154458 | 235 |
| 14 | 3300005614 | Ga0068856_100015647 | Ga0068856_1000156475 | 235 |
| 15 | 3300005617 | Ga0068859_100048594 | Ga0068859_1000485943 | 235 |
| 16 | 3300005618 | Ga0068864_100048394 | Ga0068864_1000483944 | 235 |
| 17 | 3300005842 | Ga0068858_100211165 | Ga0068858_1002111652 | 235 |
| 18 | 3300006028 | Ga0070717_10006501 | Ga0070717_100065015 | 235 |
| 19 | 3300006173 | Ga0070716_100104670 | Ga0070716_1001046702 | 235 |
| 20 | 3300006175 | Ga0070712_100160520 | Ga0070712_1001605202 | 235 |
| 21 | 3300006871 | Ga0075434_100000636 | Ga0075434_10000063614 | 235 |
| 22 | 3300006881 | Ga0068865_100044283 | Ga0068865_1000442833 | 235 |
| 23 | 3300006914 | Ga0075436_100014111 | Ga0075436_1000141112 | 235 |
| 24 | 3300006931 | Ga0097620_100048592 | Ga0097620_1000485923 | 235 |
| 25 | 3300007076 | Ga0075435_100005632 | Ga0075435_1000056322 | 235 |
| 26 | 3300009093 | Ga0105240_10194152 | Ga0105240_101941523 | 235 |
| 27 | 3300009098 | Ga0105245_10011861 | Ga0105245_100118612 | 235 |
| 28 | 3300009101 | Ga0105247_10016729 | Ga0105247_100167293 | 235 |
| 29 | 3300009176 | Ga0105242_10038913 | Ga0105242_100389133 | 235 |
| 30 | 3300009177 | Ga0105248_10080383 | Ga0105248_100803832 | 235 |
| 31 | 3300009551 | Ga0105238_10005424 | Ga0105238_100054245 | 235 |
| 32 | 3300009553 | Ga0105249_10118212 | Ga0105249_101182122 | 235 |
| 33 | 3300011119 | Ga0105246_10005282 | Ga0105246_100052826 | 235 |
| 34 | 3300013105 | Ga0157369_10098405 | Ga0157369_100984052 | 235 |
| 35 | 3300013306 | Ga0163162_10193734 | Ga0163162_101937343 | 235 |
| 36 | 3300013307 | Ga0157372_10056335 | Ga0157372_100563354 | 235 |
| 37 | 3300013308 | Ga0157375_10312405 | Ga0157375_103124052 | 235 |
| 38 | 3300025901 | Ga0207688_10007739 | Ga0207688_100077392 | 235 |
| 39 | 3300025904 | Ga0207647_10046087 | Ga0207647_100460873 | 235 |
| 40 | 3300025905 | Ga0207685_10003722 | Ga0207685_100037222 | 235 |
| 41 | 3300025906 | Ga0207699_10173291 | Ga0207699_101732911 | 235 |
| 42 | 3300025911 | Ga0207654_10059151 | Ga0207654_100591512 | 235 |
| 43 | 3300025919 | Ga0207657_10003779 | Ga0207657_100037799 | 235 |
| 44 | 3300025924 | Ga0207694_10065931 | Ga0207694_100659313 | 235 |
| 45 | 3300025927 | Ga0207687_10021202 | Ga0207687_100212024 | 235 |
| 46 | 3300025929 | Ga0207664_10145218 | Ga0207664_101452182 | 235 |
| 47 | 3300025933 | Ga0207706_10074834 | Ga0207706_100748342 | 235 |
| 48 | 3300025934 | Ga0207686_10230988 | Ga0207686_102309882 | 235 |
| 49 | 3300025935 | Ga0207709_10126245 | Ga0207709_101262452 | 235 |
| 50 | 3300025939 | Ga0207665_10011859 | Ga0207665_100118593 | 235 |
| 51 | 3300025940 | Ga0207691_10399733 | Ga0207691_103997331 | 235 |
| 52 | 3300025941 | Ga0207711_10264528 | Ga0207711_102645282 | 235 |
| 53 | 3300025949 | Ga0207667_10009530 | Ga0207667_100095304 | 235 |
| 54 | 3300025960 | Ga0207651_10084276 | Ga0207651_100842762 | 235 |
| 55 | 3300026035 | Ga0207703_10207607 | Ga0207703_102076072 | 235 |
| 56 | 3300026078 | Ga0207702_10006854 | Ga0207702_100068545 | 235 |
| 57 | 3300026078 | Ga0207702_10419561 | Ga0207702_104195612 | 235 |
| 58 | 3300026121 | Ga0207683_10049732 | Ga0207683_100497324 | 235 |
| 59 | 3300034820 | Ga0373959_0045130 | Ga0373959_0045130_10_822 | 235 |
| 60 | 3300035086 | Ga0373934_0049208 | Ga0373934_0049208_702_1511 | 235 |
| 61 | 3300035113 | Ga0373936_0009851 | Ga0373936_0009851_769_1578 | 235 |
| 62 | 3300035118 | Ga0373954_0069833 | Ga0373954_0069833_781_1590 | 235 |
| 63 | 3300035170 | Ga0373943_0170746 | Ga0373943_0170746_208_1020 | 235 |
| 64 | 3300035171 | Ga0373946_0008723 | Ga0373946_0008723_1962_2771 | 235 |
| 65 | 3300035724 | Ga0373933_0013238 | Ga0373933_0013238_1920_2729 | 235 |
| 66 | 3300035725 | Ga0373947_0055033 | Ga0373947_0055033_462_1271 | 235 |
| 67 | 3300036401 | Ga0373937_0022802 | Ga0373937_0022802_18_827 | 235 |
| 68 | 3300037068 | Ga0373925_0005631 | Ga0373925_0005631_8272_9081 | 235 |
| 69 | 3300046461 | Ga0495641_0001756 | Ga0495641_0001756_4264_5073 | 235 |
| 70 | 3300046463 | Ga0495653_0103366 | Ga0495653_0103366_688_1497 | 235 |
| 71 | 3300046473 | Ga0495582_0001910 | Ga0495582_0001910_6768_7577 | 235 |
| 72 | 3300046499 | Ga0495594_0013912 | Ga0495594_0013912_319_1128 | 235 |
| 73 | 3300046511 | Ga0495608_0004420 | Ga0495608_0004420_7222_8031 | 235 |
| 74 | 3300046517 | Ga0495630_0293037 | Ga0495630_0293037_192_1001 | 235 |
| 75 | 3300046531 | Ga0495665_0005873 | Ga0495665_0005873_1100_1909 | 235 |
| 76 | 3300046533 | Ga0495640_0009765 | Ga0495640_0009765_4061_4870 | 235 |
| 77 | 3300046536 | Ga0495587_0048849 | Ga0495587_0048849_322_1131 | 235 |
| 78 | 3300046642 | Ga0495634_0002112 | Ga0495634_0002112_12563_13372 | 235 |
| 79 | 3300046674 | Ga0495588_0119533 | Ga0495588_0119533_303_1112 | 235 |
| 80 | 3300046675 | Ga0495657_0116321 | Ga0495657_0116321_80_889 | 235 |
| 81 | 3300046678 | Ga0495599_0093005 | Ga0495599_0093005_341_1150 | 235 |
| 82 | 3300046679 | Ga0495623_0059210 | Ga0495623_0059210_1383_2192 | 235 |
| 83 | 3300046680 | Ga0495646_0109692 | Ga0495646_0109692_414_1223 | 235 |
| 84 | 3300046689 | Ga0495613_0018875 | Ga0495613_0018875_390_1199 | 235 |
| 85 | 3300046690 | Ga0495624_0005867 | Ga0495624_0005867_7256_8065 | 235 |
| 86 | 3300046809 | Ga0495600_0005156 | Ga0495600_0005156_2364_3173 | 235 |
| 87 | 3300047315 | Ga0495581_0011509 | Ga0495581_0011509_298_1107 | 235 |
| 88 | 3300047317 | Ga0495604_0063123 | Ga0495604_0063123_1993_2802 | 235 |
| 89 | 3300047319 | Ga0495674_0038746 | Ga0495674_0038746_1229_2038 | 235 |
| 90 | 3300047319 | Ga0495674_0103411 | Ga0495674_0103411_741_1550 | 235 |
| 91 | 3300047321 | Ga0495676_0009683 | Ga0495676_0009683_324_1133 | 235 |
| 92 | 3300047321 | Ga0495676_0067715 | Ga0495676_0067715_1334_2143 | 235 |
| 93 | 3300047322 | Ga0495680_0077905 | Ga0495680_0077905_688_1497 | 235 |
| 94 | 3300047471 | Ga0495684_0005578 | Ga0495684_0005578_7501_8310 | 235 |
| 95 | 3300047673 | Ga0495593_0012033 | Ga0495593_0012033_2035_2844 | 235 |
| 96 | 3300048088 | Ga0495602_0238271 | Ga0495602_0238271_294_1103 | 235 |
| 97 | 3300048903 | Ga0496100_0098436 | Ga0496100_0098436_996_1808 | 235 |
| 98 | 3300048904 | Ga0496101_0026891 | Ga0496101_0026891_321_1145 | 235 |
| 99 | 3300048904 | Ga0496101_0038877 | Ga0496101_0038877_1862_2674 | 235 |
| 100 | 3300048905 | Ga0496102_0439328 | Ga0496102_0439328_308_1132 | 235 |
| 101 | 3300048907 | Ga0496104_0078185 | Ga0496104_0078185_802_1614 | 235 |
| 102 | 3300048909 | Ga0496106_0015042 | Ga0496106_0015042_1724_2548 | 235 |
| 103 | 3300048909 | Ga0496106_0023269 | Ga0496106_0023269_2543_3355 | 235 |
| 104 | 3300048909 | Ga0496106_0493712 | Ga0496106_0493712_87_899 | 235 |
| 105 | 3300048910 | Ga0496107_0000676 | Ga0496107_0000676_16155_16967 | 235 |
| 106 | 3300048910 | Ga0496107_0015369 | Ga0496107_0015369_1644_2468 | 235 |
| 107 | 3300048911 | Ga0496108_0008398 | Ga0496108_0008398_4996_5820 | 235 |
| 108 | 3300048912 | Ga0496109_0003243 | Ga0496109_0003243_7354_8178 | 235 |
| 109 | 3300048912 | Ga0496109_0098725 | Ga0496109_0098725_1249_2061 | 235 |
| 110 | 3300048913 | Ga0496110_0000249 | Ga0496110_0000249_33845_34657 | 235 |
| 111 | 3300048913 | Ga0496110_0006837 | Ga0496110_0006837_1377_2201 | 235 |
| 112 | 3300048914 | Ga0496111_0008466 | Ga0496111_0008466_311_1135 | 235 |
| 113 | 3300048914 | Ga0496111_0045772 | Ga0496111_0045772_1731_2543 | 235 |
| 114 | 3300048915 | Ga0496112_0005086 | Ga0496112_0005086_3118_3930 | 235 |
| 115 | 3300048915 | Ga0496112_0012867 | Ga0496112_0012867_5405_6229 | 235 |
| 116 | 3300048916 | Ga0496113_0009943 | Ga0496113_0009943_3868_4692 | 235 |
| 117 | 3300048916 | Ga0496113_0025680 | Ga0496113_0025680_311_1123 | 235 |
| 118 | 3300048917 | Ga0496114_0011620 | Ga0496114_0011620_4885_5709 | 235 |
| 119 | 3300048917 | Ga0496114_0179660 | Ga0496114_0179660_696_1508 | 235 |
| 120 | 3300050512 | nmdc:mga0n895_1093_c1 | nmdc:mga0n895_1093_c1_16207_17019 | 235 |
| 121 | 3300050513 | nmdc:mga0rr50_425_c1 | nmdc:mga0rr50_425_c1_5271_6083 | 235 |
| 122 | 3300050514 | nmdc:mga08x19_16617_c1 | nmdc:mga08x19_16617_c1_1885_2697 | 235 |
| 123 | 3300050515 | nmdc:mga0a205_124255_c2 | nmdc:mga0a205_124255_c2_226_1038 | 235 |
| 124 | 3300053085 | Ga0495619_0177212 | Ga0495619_0177212_101_910 | 235 |
| 125 | 3300005435 | Ga0070714_100018715 | Ga0070714_1000187153 | 236 |
| 126 | 3300025929 | Ga0207664_10025169 | Ga0207664_100251692 | 236 |
| 127 | 3300005544 | Ga0070686_100120057 | Ga0070686_1001200572 | 239 |
| 128 | 3300005843 | Ga0068860_100406954 | Ga0068860_1004069542 | 239 |
| 129 | 3300005535 | Ga0070684_100330208 | Ga0070684_1003302082 | 242 |
| 130 | 3300005577 | Ga0068857_100203076 | Ga0068857_1002030762 | 242 |
| 131 | 3300005614 | Ga0068856_100082171 | Ga0068856_1000821711 | 242 |
| 132 | 3300005614 | Ga0068856_100377130 | Ga0068856_1003771302 | 242 |
| 133 | 3300006871 | Ga0075434_100015967 | Ga0075434_1000159677 | 242 |
| 134 | 3300006914 | Ga0075436_100017851 | Ga0075436_1000178513 | 242 |
| 135 | 3300013296 | Ga0157374_10131411 | Ga0157374_101314113 | 242 |
| 136 | 3300020082 | Ga0206353_10712527 | Ga0206353_107125272 | 242 |
| 137 | 3300025912 | Ga0207707_10300819 | Ga0207707_103008191 | 242 |
| 138 | 3300035724 | Ga0373933_0067728 | Ga0373933_0067728_1201_2013 | 242 |
| 139 | 3300036401 | Ga0373937_0188724 | Ga0373937_0188724_357_1256 | 242 |
| 140 | 3300044694 | Ga0466963_0150345 | Ga0466963_0150345_50_862 | 242 |
| 141 | 3300044842 | Ga0466957_0042969 | Ga0466957_0042969_1044_1856 | 242 |
| 142 | 3300045836 | Ga0466958_0031892 | Ga0466958_0031892_460_1272 | 242 |
| 143 | 3300045976 | Ga0466967_0038279 | Ga0466967_0038279_1244_2056 | 242 |
| 144 | 3300047319 | Ga0495674_0101617 | Ga0495674_0101617_790_1602 | 242 |
| 145 | 3300048907 | Ga0496104_0358553 | Ga0496104_0358553_332_1144 | 242 |
| 146 | 3300048911 | Ga0496108_0006986 | Ga0496108_0006986_5527_6339 | 242 |
| 147 | 3300048912 | Ga0496109_0025326 | Ga0496109_0025326_136_948 | 242 |
| 148 | 3300048913 | Ga0496110_0224482 | Ga0496110_0224482_416_1228 | 242 |
| 149 | 3300048914 | Ga0496111_0052043 | Ga0496111_0052043_667_1479 | 242 |
| 150 | 3300048915 | Ga0496112_0035922 | Ga0496112_0035922_2838_3650 | 242 |
| 151 | 3300048917 | Ga0496114_0013857 | Ga0496114_0013857_4959_5771 | 242 |
| 152 | 3300049583 | Ga0501067_0022371 | Ga0501067_0022371_1275_2087 | 242 |
| 153 | 3300049585 | Ga0501069_0019101 | Ga0501069_0019101_1404_2216 | 242 |
| 154 | 3300050512 | nmdc:mga0n895_91965_c1 | nmdc:mga0n895_91965_c1_1341_2153 | 242 |
| 155 | 3300050514 | nmdc:mga08x19_113433_c1 | nmdc:mga08x19_113433_c1_13_825 | 242 |
| 156 | 3300050515 | nmdc:mga0a205_64442_c1 | nmdc:mga0a205_64442_c1_1932_2744 | 242 |
| 157 | 3300005329 | Ga0070683_100037483 | Ga0070683_1000374833 | 243 |
| 158 | 3300005336 | Ga0070680_100043211 | Ga0070680_1000432112 | 243 |
| 159 | 3300005337 | Ga0070682_100050574 | Ga0070682_1000505742 | 243 |
| 160 | 3300005338 | Ga0068868_100011835 | Ga0068868_1000118354 | 243 |
| 161 | 3300005340 | Ga0070689_100072393 | Ga0070689_1000723932 | 243 |
| 162 | 3300005341 | Ga0070691_10044147 | Ga0070691_100441472 | 243 |
| 163 | 3300005345 | Ga0070692_10056320 | Ga0070692_100563202 | 243 |
| 164 | 3300005356 | Ga0070674_100398636 | Ga0070674_1003986361 | 243 |
| 165 | 3300005365 | Ga0070688_100151967 | Ga0070688_1001519672 | 243 |
| 166 | 3300005366 | Ga0070659_100007128 | Ga0070659_1000071283 | 243 |
| 167 | 3300005459 | Ga0068867_100161951 | Ga0068867_1001619512 | 243 |
| 168 | 3300005535 | Ga0070684_100093670 | Ga0070684_1000936702 | 243 |
| 169 | 3300005539 | Ga0068853_100367488 | Ga0068853_1003674881 | 243 |
| 170 | 3300005545 | Ga0070695_100307511 | Ga0070695_1003075112 | 243 |
| 171 | 3300005546 | Ga0070696_100104892 | Ga0070696_1001048922 | 243 |
| 172 | 3300005547 | Ga0070693_100004855 | Ga0070693_1000048553 | 243 |
| 173 | 3300005549 | Ga0070704_100425733 | Ga0070704_1004257331 | 243 |
| 174 | 3300005563 | Ga0068855_100144755 | Ga0068855_1001447552 | 243 |
| 175 | 3300005564 | Ga0070664_100011830 | Ga0070664_1000118305 | 243 |
| 176 | 3300005577 | Ga0068857_100114993 | Ga0068857_1001149932 | 243 |
| 177 | 3300005615 | Ga0070702_100017387 | Ga0070702_1000173872 | 243 |
| 178 | 3300005616 | Ga0068852_100028449 | Ga0068852_1000284494 | 243 |
| 179 | 3300006175 | Ga0070712_100412302 | Ga0070712_1004123022 | 243 |
| 180 | 3300006237 | Ga0097621_100008265 | Ga0097621_1000082654 | 243 |
| 181 | 3300006871 | Ga0075434_100063702 | Ga0075434_1000637023 | 243 |
| 182 | 3300006881 | Ga0068865_100284557 | Ga0068865_1002845572 | 243 |
| 183 | 3300007076 | Ga0075435_100030324 | Ga0075435_1000303242 | 243 |
| 184 | 3300009098 | Ga0105245_10062746 | Ga0105245_100627463 | 243 |
| 185 | 3300009174 | Ga0105241_10015056 | Ga0105241_100150563 | 243 |
| 186 | 3300009176 | Ga0105242_10165807 | Ga0105242_101658072 | 243 |
| 187 | 3300009551 | Ga0105238_10028177 | Ga0105238_100281772 | 243 |
| 188 | 3300010375 | Ga0105239_10316419 | Ga0105239_103164192 | 243 |
| 189 | 3300013306 | Ga0163162_10065255 | Ga0163162_100652553 | 243 |
| 190 | 3300013307 | Ga0157372_10025827 | Ga0157372_100258274 | 243 |
| 191 | 3300020080 | Ga0206350_10446008 | Ga0206350_104460082 | 243 |
| 192 | 3300020081 | Ga0206354_11046704 | Ga0206354_110467042 | 243 |
| 193 | 3300025917 | Ga0207660_10064262 | Ga0207660_100642622 | 243 |
| 194 | 3300025934 | Ga0207686_10080861 | Ga0207686_100808613 | 243 |
| 195 | 3300025942 | Ga0207689_10168900 | Ga0207689_101689002 | 243 |
| 196 | 3300025981 | Ga0207640_10168167 | Ga0207640_101681672 | 243 |
| 197 | 3300026023 | Ga0207677_10019594 | Ga0207677_100195944 | 243 |
| 198 | 3300026067 | Ga0207678_10318092 | Ga0207678_103180922 | 243 |
| 199 | 3300026075 | Ga0207708_10042499 | Ga0207708_100424993 | 243 |
| 200 | 3300026078 | Ga0207702_10011114 | Ga0207702_100111143 | 243 |
| 201 | 3300026116 | Ga0207674_10079071 | Ga0207674_100790713 | 243 |
| 202 | 3300026118 | Ga0207675_100476186 | Ga0207675_1004761862 | 243 |
| 203 | 3300026142 | Ga0207698_10227370 | Ga0207698_102273702 | 243 |
| 204 | 3300048904 | Ga0496101_0383043 | Ga0496101_0383043_221_1087 | 243 |
| 205 | 3300048905 | Ga0496102_0042276 | Ga0496102_0042276_539_1405 | 243 |
| 206 | 3300048909 | Ga0496106_0077830 | Ga0496106_0077830_1637_2503 | 243 |
| 207 | 3300048910 | Ga0496107_0063448 | Ga0496107_0063448_887_1753 | 243 |
| 208 | 3300048913 | Ga0496110_0070941 | Ga0496110_0070941_1769_2635 | 243 |
| 209 | 3300048915 | Ga0496112_0407770 | Ga0496112_0407770_128_925 | 243 |
| 210 | 3300048916 | Ga0496113_0053053 | Ga0496113_0053053_582_1379 | 243 |
| 211 | 3300048917 | Ga0496114_0013883 | Ga0496114_0013883_536_1402 | 243 |
| 212 | 3300048918 | Ga0496115_0082680 | Ga0496115_0082680_245_1111 | 243 |
| 213 | 3300050512 | nmdc:mga0n895_136566_c1 | nmdc:mga0n895_136566_c1_423_1289 | 243 |
| 214 | 3300050513 | nmdc:mga0rr50_44590_c1 | nmdc:mga0rr50_44590_c1_200_1066 | 243 |
| 215 | 3300050515 | nmdc:mga0a205_47351_c1 | nmdc:mga0a205_47351_c1_883_1749 | 243 |
| 216 | 3300005459 | Ga0068867_100079020 | Ga0068867_1000790203 | 244 |
| 217 | 3300005535 | Ga0070684_100165382 | Ga0070684_1001653822 | 244 |
| 218 | 3300025901 | Ga0207688_10089694 | Ga0207688_100896942 | 244 |
| 219 | 3300025972 | Ga0207668_10435735 | Ga0207668_104357351 | 244 |
| 220 | 3300026075 | Ga0207708_10050119 | Ga0207708_100501192 | 244 |
| 221 | 3300026089 | Ga0207648_10013626 | Ga0207648_100136265 | 244 |
| 222 | 3300045049 | Ga0466959_0179553 | Ga0466959_0179553_222_1142 | 247 |
| 223 | 3300048909 | Ga0496106_0417143 | Ga0496106_0417143_87_887 | 247 |
| 224 | 3300005437 | Ga0070710_10000002 | Ga0070710_10000002252 | 249 |
| 225 | 3300025898 | Ga0207692_10000005 | Ga0207692_10000005154 | 249 |
| 226 | 3300005338 | Ga0068868_100200232 | Ga0068868_1002002322 | 250 |
| 227 | 3300048910 | Ga0496107_0117311 | Ga0496107_0117311_343_1176 | 250 |
| 228 | 3300025944 | Ga0207661_10369603 | Ga0207661_103696032 | 251 |
| 229 | 3300048903 | Ga0496100_0002167 | Ga0496100_0002167_8575_9552 | 251 |
| 230 | 3300005440 | Ga0070705_100002095 | Ga0070705_1000020955 | 252 |
| 231 | 3300005339 | Ga0070660_100009392 | Ga0070660_1000093924 | 253 |
| 232 | 3300005439 | Ga0070711_100002079 | Ga0070711_1000020794 | 253 |
| 233 | 3300005530 | Ga0070679_100156115 | Ga0070679_1001561152 | 253 |
| 234 | 3300025919 | Ga0207657_10056990 | Ga0207657_100569902 | 253 |
| 235 | 3300005366 | Ga0070659_100000030 | Ga0070659_100000030132 | 254 |
| 236 | 3300005539 | Ga0068853_100500022 | Ga0068853_1005000222 | 254 |
| 237 | 3300006038 | Ga0075365_10000962 | Ga0075365_100009629 | 254 |
| 238 | 3300025923 | Ga0207681_10008907 | Ga0207681_100089071 | 254 |
| 239 | 3300025932 | Ga0207690_10000117 | Ga0207690_100001176 | 254 |
| 240 | 3300031852 | Ga0307410_10416688 | Ga0307410_104166882 | 254 |
| 241 | 3300031995 | Ga0307409_100017381 | Ga0307409_1000173813 | 254 |
| 242 | 3300032126 | Ga0307415_100011611 | Ga0307415_1000116113 | 254 |
| 243 | 3300050492 | nmdc:mga0yw44_26748_c1 | nmdc:mga0yw44_26748_c1_515_1312 | 254 |
| 244 | 3300005337 | Ga0070682_100058674 | Ga0070682_1000586743 | 255 |
| 245 | 3300005338 | Ga0068868_100030208 | Ga0068868_1000302084 | 255 |
| 246 | 3300005343 | Ga0070687_100056701 | Ga0070687_1000567012 | 255 |
| 247 | 3300005549 | Ga0070704_100128137 | Ga0070704_1001281372 | 255 |
| 248 | 3300005718 | Ga0068866_10019503 | Ga0068866_100195032 | 255 |
| 249 | 3300005842 | Ga0068858_100225716 | Ga0068858_1002257162 | 255 |
| 250 | 3300006846 | Ga0075430_100008213 | Ga0075430_1000082131 | 255 |
| 251 | 3300009098 | Ga0105245_10061512 | Ga0105245_100615123 | 255 |
| 252 | 3300009148 | Ga0105243_10014153 | Ga0105243_100141534 | 255 |
| 253 | 3300011119 | Ga0105246_10004873 | Ga0105246_100048737 | 255 |
| 254 | 3300025901 | Ga0207688_10038782 | Ga0207688_100387822 | 255 |
| 255 | 3300025927 | Ga0207687_10180603 | Ga0207687_101806032 | 255 |
| 256 | 3300026041 | Ga0207639_10420039 | Ga0207639_104200391 | 255 |
| 257 | 3300031824 | Ga0307413_10281500 | Ga0307413_102815002 | 255 |
| 258 | 3300031852 | Ga0307410_10074333 | Ga0307410_100743332 | 255 |
| 259 | 3300031852 | Ga0307410_10099595 | Ga0307410_100995952 | 255 |
| 260 | 3300031901 | Ga0307406_10011316 | Ga0307406_100113164 | 255 |
| 261 | 3300031903 | Ga0307407_10115833 | Ga0307407_101158332 | 255 |
| 262 | 3300031911 | Ga0307412_10110799 | Ga0307412_101107993 | 255 |
| 263 | 3300031911 | Ga0307412_10239301 | Ga0307412_102393012 | 255 |
| 264 | 3300031995 | Ga0307409_100035690 | Ga0307409_1000356903 | 255 |
| 265 | 3300031995 | Ga0307409_100731779 | Ga0307409_1007317791 | 255 |
| 266 | 3300032002 | Ga0307416_100060389 | Ga0307416_1000603894 | 255 |
| 267 | 3300032004 | Ga0307414_10227233 | Ga0307414_102272332 | 255 |
| 268 | 3300032005 | Ga0307411_10031520 | Ga0307411_100315203 | 255 |
| 269 | 3300048905 | Ga0496102_0054325 | Ga0496102_0054325_2321_3223 | 255 |
| 270 | 3300048912 | Ga0496109_0411686 | Ga0496109_0411686_303_1205 | 255 |
| 271 | 3300050508 | nmdc:mga09592_4149_c2 | nmdc:mga09592_4149_c2_7465_8319 | 255 |
| 272 | 3300005340 | Ga0070689_100173892 | Ga0070689_1001738922 | 256 |
| 273 | 3300005456 | Ga0070678_100294040 | Ga0070678_1002940402 | 256 |
| 274 | 3300005548 | Ga0070665_100156636 | Ga0070665_1001566362 | 256 |
| 275 | 3300009098 | Ga0105245_10000236 | Ga0105245_100002363 | 256 |
| 276 | 3300009101 | Ga0105247_10121695 | Ga0105247_101216951 | 256 |
| 277 | 3300009176 | Ga0105242_10572011 | Ga0105242_105720111 | 256 |
| 278 | 3300009553 | Ga0105249_10139158 | Ga0105249_101391583 | 256 |
| 279 | 3300013306 | Ga0163162_10497588 | Ga0163162_104975881 | 256 |
| 280 | 3300013308 | Ga0157375_10019870 | Ga0157375_100198706 | 256 |
| 281 | 3300014969 | Ga0157376_10056472 | Ga0157376_100564723 | 256 |
| 282 | 3300025935 | Ga0207709_10247100 | Ga0207709_102471002 | 256 |
| 283 | 3300026089 | Ga0207648_10029561 | Ga0207648_100295612 | 256 |
| 284 | 3300044735 | Ga0466968_0056779 | Ga0466968_0056779_655_1461 | 256 |
| 285 | 3300046514 | Ga0495618_0000275 | Ga0495618_0000275_18062_19012 | 256 |
| 286 | 3300048903 | Ga0496100_0011204 | Ga0496100_0011204_349_1152 | 256 |
| 287 | 3300048904 | Ga0496101_0011824 | Ga0496101_0011824_1973_2776 | 256 |
| 288 | 3300048905 | Ga0496102_0022208 | Ga0496102_0022208_977_1780 | 256 |
| 289 | 3300048906 | Ga0496103_0003871 | Ga0496103_0003871_5697_6500 | 256 |
| 290 | 3300048907 | Ga0496104_0021058 | Ga0496104_0021058_610_1413 | 256 |
| 291 | 3300048908 | Ga0496105_0009077 | Ga0496105_0009077_1316_2119 | 256 |
| 292 | 3300048909 | Ga0496106_0039874 | Ga0496106_0039874_1737_2540 | 256 |
| 293 | 3300048910 | Ga0496107_0000968 | Ga0496107_0000968_2077_2880 | 256 |
| 294 | 3300048912 | Ga0496109_0041860 | Ga0496109_0041860_1449_2252 | 256 |
| 295 | 3300048913 | Ga0496110_0019361 | Ga0496110_0019361_4123_4926 | 256 |
| 296 | 3300048914 | Ga0496111_0007128 | Ga0496111_0007128_2382_3185 | 256 |
| 297 | 3300048915 | Ga0496112_0027218 | Ga0496112_0027218_3414_4217 | 256 |
| 298 | 3300048916 | Ga0496113_0005823 | Ga0496113_0005823_1150_1953 | 256 |
| 299 | 3300048917 | Ga0496114_0004855 | Ga0496114_0004855_1074_1877 | 256 |
| 300 | 3300048918 | Ga0496115_0001432 | Ga0496115_0001432_6206_7009 | 256 |
| 301 | 3300048925 | Ga0496122_0257017 | Ga0496122_0257017_54_863 | 256 |
| 302 | 3300049569 | Ga0501032_0081123 | Ga0501032_0081123_515_1321 | 256 |
| 303 | 3300049571 | Ga0501034_0303232 | Ga0501034_0303232_244_1050 | 256 |
| 304 | 3300049573 | Ga0501037_0071404 | Ga0501037_0071404_798_1604 | 256 |
| 305 | 3300049575 | Ga0501039_0218320 | Ga0501039_0218320_662_1468 | 256 |
| 306 | 3300049582 | Ga0501048_0015944 | Ga0501048_0015944_4657_5463 | 256 |
| 307 | 3300049584 | Ga0501068_0073264 | Ga0501068_0073264_1074_1880 | 256 |
| 308 | 3300049590 | Ga0501074_0408916 | Ga0501074_0408916_62_868 | 256 |
| 309 | 3300049822 | Ga0501035_0146741 | Ga0501035_0146741_256_1062 | 256 |
| 310 | 3300049823 | Ga0501044_0191857 | Ga0501044_0191857_1173_1979 | 256 |
| 311 | 3300053078 | Ga0495612_0000222 | Ga0495612_0000222_19103_20056 | 256 |
| 312 | 3300053104 | Ga0500556_0000593 | Ga0500556_0000593_17509_18318 | 256 |
| 313 | 3300053153 | Ga0500616_0006676 | Ga0500616_0006676_1954_2763 | 256 |
| 314 | 3300053736 | Ga0500599_010383 | Ga0500599_010383_55_864 | 256 |
| 315 | 3300060353 | Ga0501082_0004346 | Ga0501082_0004346_3725_4531 | 256 |
| 316 | 3300005435 | Ga0070714_100130846 | Ga0070714_1001308462 | 257 |
| 317 | 3300006028 | Ga0070717_10000006 | Ga0070717_100000068 | 257 |
| 318 | 3300025929 | Ga0207664_10020701 | Ga0207664_100207014 | 257 |
| 319 | 3300026023 | Ga0207677_10177324 | Ga0207677_101773242 | 257 |
| 320 | 3300026116 | Ga0207674_10048068 | Ga0207674_100480682 | 257 |
| 321 | 3300045976 | Ga0466967_0342291 | Ga0466967_0342291_385_1203 | 257 |
| 322 | 3300048918 | Ga0496115_0000282 | Ga0496115_0000282_15828_16658 | 257 |
| 323 | 3300005981 | Ga0081538_10018210 | Ga0081538_100182104 | 258 |
| 324 | 3300006038 | Ga0075365_10034978 | Ga0075365_100349784 | 258 |
| 325 | 3300006038 | Ga0075365_10189924 | Ga0075365_101899242 | 258 |
| 326 | 3300006051 | Ga0075364_10141452 | Ga0075364_101414522 | 258 |
| 327 | 3300025916 | Ga0207663_10000923 | Ga0207663_100009237 | 258 |
| 328 | 3300032002 | Ga0307416_100303348 | Ga0307416_1003033481 | 258 |
| 329 | 3300045976 | Ga0466967_0295385 | Ga0466967_0295385_189_1007 | 258 |
| 330 | 3300048903 | Ga0496100_0032264 | Ga0496100_0032264_288_1172 | 258 |
| 331 | 3300048910 | Ga0496107_0049358 | Ga0496107_0049358_149_991 | 258 |
| 332 | 3300049571 | Ga0501034_0315712 | Ga0501034_0315712_356_1189 | 258 |
| 333 | 3300049583 | Ga0501067_0156833 | Ga0501067_0156833_37_870 | 258 |
| 334 | 3300049585 | Ga0501069_0012787 | Ga0501069_0012787_3139_3972 | 258 |
| 335 | 3300049586 | Ga0501070_0077618 | Ga0501070_0077618_1295_2128 | 258 |
| 336 | 3300049586 | Ga0501070_0189058 | Ga0501070_0189058_837_1667 | 258 |
| 337 | 3300049587 | Ga0501071_0131830 | Ga0501071_0131830_714_1547 | 258 |
| 338 | 3300049588 | Ga0501072_0251474 | Ga0501072_0251474_107_940 | 258 |
| 339 | 3300049588 | Ga0501072_0256926 | Ga0501072_0256926_160_1083 | 258 |
| 340 | 3300049590 | Ga0501074_0046749 | Ga0501074_0046749_1265_2098 | 258 |
| 341 | 3300049742 | Ga0501080_0049265 | Ga0501080_0049265_1583_2416 | 258 |
| 342 | 3300050491 | nmdc:mga00v17_263711_c1 | nmdc:mga00v17_263711_c1_190_990 | 258 |
| 343 | 3300050491 | nmdc:mga00v17_263733_c1 | nmdc:mga00v17_263733_c1_129_929 | 258 |
| 344 | 3300050491 | nmdc:mga00v17_91480_c1 | nmdc:mga00v17_91480_c1_154_954 | 258 |
| 345 | 3300050492 | nmdc:mga0yw44_87694_c1 | nmdc:mga0yw44_87694_c1_670_1470 | 258 |
| 346 | 3300005327 | Ga0070658_10015503 | Ga0070658_100155036 | 259 |
| 347 | 3300005329 | Ga0070683_100110974 | Ga0070683_1001109743 | 259 |
| 348 | 3300005338 | Ga0068868_100016431 | Ga0068868_1000164312 | 259 |
| 349 | 3300005339 | Ga0070660_100002839 | Ga0070660_1000028393 | 259 |
| 350 | 3300005343 | Ga0070687_100154329 | Ga0070687_1001543291 | 259 |
| 351 | 3300005344 | Ga0070661_100027674 | Ga0070661_1000276743 | 259 |
| 352 | 3300005345 | Ga0070692_10005288 | Ga0070692_100052884 | 259 |
| 353 | 3300005347 | Ga0070668_100051335 | Ga0070668_1000513351 | 259 |
| 354 | 3300005354 | Ga0070675_100011764 | Ga0070675_1000117645 | 259 |
| 355 | 3300005356 | Ga0070674_100013587 | Ga0070674_1000135872 | 259 |
| 356 | 3300005365 | Ga0070688_100045380 | Ga0070688_1000453803 | 259 |
| 357 | 3300005366 | Ga0070659_100003072 | Ga0070659_1000030726 | 259 |
| 358 | 3300005439 | Ga0070711_100058046 | Ga0070711_1000580463 | 259 |
| 359 | 3300005441 | Ga0070700_100005075 | Ga0070700_1000050755 | 259 |
| 360 | 3300005466 | Ga0070685_10010229 | Ga0070685_100102295 | 259 |
| 361 | 3300005535 | Ga0070684_100030701 | Ga0070684_1000307013 | 259 |
| 362 | 3300005543 | Ga0070672_100010299 | Ga0070672_1000102992 | 259 |
| 363 | 3300005544 | Ga0070686_100031311 | Ga0070686_1000313113 | 259 |
| 364 | 3300005577 | Ga0068857_100279007 | Ga0068857_1002790072 | 259 |
| 365 | 3300005578 | Ga0068854_100007323 | Ga0068854_1000073236 | 259 |
| 366 | 3300005842 | Ga0068858_100100629 | Ga0068858_1001006292 | 259 |
| 367 | 3300006038 | Ga0075365_10039533 | Ga0075365_100395333 | 259 |
| 368 | 3300006048 | Ga0075363_100004856 | Ga0075363_1000048562 | 259 |
| 369 | 3300009094 | Ga0111539_10126830 | Ga0111539_101268303 | 259 |
| 370 | 3300009094 | Ga0111539_10177351 | Ga0111539_101773512 | 259 |
| 371 | 3300009098 | Ga0105245_10011183 | Ga0105245_100111833 | 259 |
| 372 | 3300009148 | Ga0105243_10011229 | Ga0105243_100112296 | 259 |
| 373 | 3300009148 | Ga0105243_10053195 | Ga0105243_100531952 | 259 |
| 374 | 3300010375 | Ga0105239_10110942 | Ga0105239_101109423 | 259 |
| 375 | 3300014968 | Ga0157379_10091082 | Ga0157379_100910822 | 259 |
| 376 | 3300025908 | Ga0207643_10055277 | Ga0207643_100552773 | 259 |
| 377 | 3300025918 | Ga0207662_10207557 | Ga0207662_102075571 | 259 |
| 378 | 3300025919 | Ga0207657_10010856 | Ga0207657_100108565 | 259 |
| 379 | 3300025920 | Ga0207649_10023612 | Ga0207649_100236122 | 259 |
| 380 | 3300025924 | Ga0207694_10234359 | Ga0207694_102343592 | 259 |
| 381 | 3300025926 | Ga0207659_10149866 | Ga0207659_101498662 | 259 |
| 382 | 3300025927 | Ga0207687_10033628 | Ga0207687_100336283 | 259 |
| 383 | 3300025932 | Ga0207690_10022756 | Ga0207690_100227563 | 259 |
| 384 | 3300025932 | Ga0207690_10406397 | Ga0207690_104063972 | 259 |
| 385 | 3300025935 | Ga0207709_10005840 | Ga0207709_100058404 | 259 |
| 386 | 3300025935 | Ga0207709_10110145 | Ga0207709_101101452 | 259 |
| 387 | 3300025937 | Ga0207669_10038693 | Ga0207669_100386933 | 259 |
| 388 | 3300025939 | Ga0207665_10326612 | Ga0207665_103266122 | 259 |
| 389 | 3300025940 | Ga0207691_10013609 | Ga0207691_100136096 | 259 |
| 390 | 3300025960 | Ga0207651_10023152 | Ga0207651_100231521 | 259 |
| 391 | 3300025961 | Ga0207712_10083145 | Ga0207712_100831451 | 259 |
| 392 | 3300025972 | Ga0207668_10029600 | Ga0207668_100296001 | 259 |
| 393 | 3300025981 | Ga0207640_10166235 | Ga0207640_101662351 | 259 |
| 394 | 3300026035 | Ga0207703_10031376 | Ga0207703_100313762 | 259 |
| 395 | 3300026041 | Ga0207639_10011957 | Ga0207639_100119575 | 259 |
| 396 | 3300026067 | Ga0207678_10033655 | Ga0207678_100336554 | 259 |
| 397 | 3300026075 | Ga0207708_10017396 | Ga0207708_100173965 | 259 |
| 398 | 3300026116 | Ga0207674_10150976 | Ga0207674_101509762 | 259 |
| 399 | 3300027907 | Ga0207428_10397494 | Ga0207428_103974942 | 259 |
| 400 | 3300028380 | Ga0268265_10128993 | Ga0268265_101289931 | 259 |
| 401 | 3300031548 | Ga0307408_100219996 | Ga0307408_1002199962 | 259 |
| 402 | 3300035398 | Ga0316574_0165461 | Ga0316574_0165461_550_1359 | 259 |
| 403 | 3300037466 | Ga0395898_0124830 | Ga0395898_0124830_988_1815 | 259 |
| 404 | 3300042012 | Ga0439455_0020927 | Ga0439455_0020927_285_1103 | 259 |
| 405 | 3300048903 | Ga0496100_0101786 | Ga0496100_0101786_971_1777 | 259 |
| 406 | 3300048905 | Ga0496102_0111015 | Ga0496102_0111015_1343_2149 | 259 |
| 407 | 3300048909 | Ga0496106_0014712 | Ga0496106_0014712_303_1109 | 259 |
| 408 | 3300048910 | Ga0496107_0018306 | Ga0496107_0018306_3210_4016 | 259 |
| 409 | 3300048911 | Ga0496108_0024246 | Ga0496108_0024246_2748_3554 | 259 |
| 410 | 3300048912 | Ga0496109_0064843 | Ga0496109_0064843_1948_2754 | 259 |
| 411 | 3300048913 | Ga0496110_0022529 | Ga0496110_0022529_281_1087 | 259 |
| 412 | 3300048914 | Ga0496111_0008400 | Ga0496111_0008400_4304_5110 | 259 |
| 413 | 3300048916 | Ga0496113_0030345 | Ga0496113_0030345_182_988 | 259 |
| 414 | 3300050490 | nmdc:mga03n38_38433_c1 | nmdc:mga03n38_38433_c1_623_1429 | 259 |
| 415 | 3300050491 | nmdc:mga00v17_58993_c1 | nmdc:mga00v17_58993_c1_302_1108 | 259 |
| 416 | 3300050492 | nmdc:mga0yw44_59410_c1 | nmdc:mga0yw44_59410_c1_34_840 | 259 |
| 417 | 3300050511 | nmdc:mga08y16_105446_c1 | nmdc:mga08y16_105446_c1_500_1306 | 259 |
| 418 | 3300053153 | Ga0500616_0010552 | Ga0500616_0010552_1538_2416 | 259 |
| 419 | 3300006175 | Ga0070712_100000003 | Ga0070712_100000003138 | 260 |
| 420 | 3300025915 | Ga0207693_10000009 | Ga0207693_1000000946 | 260 |
| 421 | 3300025918 | Ga0207662_10162044 | Ga0207662_101620442 | 260 |
| 422 | 3300046517 | Ga0495630_0000383 | Ga0495630_0000383_26387_27355 | 260 |
| 423 | 3300046675 | Ga0495657_0000013 | Ga0495657_0000013_152841_153809 | 260 |
| 424 | 3300047320 | Ga0495672_0110334 | Ga0495672_0110334_296_1150 | 260 |
| 425 | 3300047471 | Ga0495684_0012288 | Ga0495684_0012288_2782_3750 | 260 |
| 426 | 3300048917 | Ga0496114_0388449 | Ga0496114_0388449_57_911 | 260 |
| 427 | 3300005334 | Ga0068869_100058170 | Ga0068869_1000581702 | 261 |
| 428 | 3300005338 | Ga0068868_100018104 | Ga0068868_1000181044 | 261 |
| 429 | 3300005347 | Ga0070668_100060266 | Ga0070668_1000602662 | 261 |
| 430 | 3300005347 | Ga0070668_100229392 | Ga0070668_1002293922 | 261 |
| 431 | 3300005354 | Ga0070675_100044247 | Ga0070675_1000442471 | 261 |
| 432 | 3300005365 | Ga0070688_100158909 | Ga0070688_1001589091 | 261 |
| 433 | 3300005366 | Ga0070659_100483829 | Ga0070659_1004838291 | 261 |
| 434 | 3300005614 | Ga0068856_100072879 | Ga0068856_1000728793 | 261 |
| 435 | 3300005615 | Ga0070702_100037221 | Ga0070702_1000372212 | 261 |
| 436 | 3300005616 | Ga0068852_100365820 | Ga0068852_1003658202 | 261 |
| 437 | 3300005719 | Ga0068861_100176344 | Ga0068861_1001763442 | 261 |
| 438 | 3300005834 | Ga0068851_10083152 | Ga0068851_100831522 | 261 |
| 439 | 3300005985 | Ga0081539_10005785 | Ga0081539_100057857 | 261 |
| 440 | 3300006844 | Ga0075428_100182529 | Ga0075428_1001825292 | 261 |
| 441 | 3300006847 | Ga0075431_100016842 | Ga0075431_1000168426 | 261 |
| 442 | 3300006852 | Ga0075433_10241478 | Ga0075433_102414782 | 261 |
| 443 | 3300006881 | Ga0068865_100021350 | Ga0068865_1000213502 | 261 |
| 444 | 3300009101 | Ga0105247_10215442 | Ga0105247_102154422 | 261 |
| 445 | 3300009177 | Ga0105248_10199240 | Ga0105248_101992402 | 261 |
| 446 | 3300014326 | Ga0157380_10076674 | Ga0157380_100766742 | 261 |
| 447 | 3300025321 | Ga0207656_10017778 | Ga0207656_100177782 | 261 |
| 448 | 3300025901 | Ga0207688_10017211 | Ga0207688_100172113 | 261 |
| 449 | 3300025901 | Ga0207688_10038988 | Ga0207688_100389882 | 261 |
| 450 | 3300025914 | Ga0207671_10002598 | Ga0207671_100025989 | 261 |
| 451 | 3300025915 | Ga0207693_10023429 | Ga0207693_100234293 | 261 |
| 452 | 3300025916 | Ga0207663_10073810 | Ga0207663_100738102 | 261 |
| 453 | 3300025918 | Ga0207662_10046814 | Ga0207662_100468142 | 261 |
| 454 | 3300025927 | Ga0207687_10021270 | Ga0207687_100212702 | 261 |
| 455 | 3300025927 | Ga0207687_10158762 | Ga0207687_101587622 | 261 |
| 456 | 3300025932 | Ga0207690_10025889 | Ga0207690_100258892 | 261 |
| 457 | 3300025937 | Ga0207669_10107922 | Ga0207669_101079222 | 261 |
| 458 | 3300025941 | Ga0207711_10036972 | Ga0207711_100369724 | 261 |
| 459 | 3300025942 | Ga0207689_10127255 | Ga0207689_101272552 | 261 |
| 460 | 3300025986 | Ga0207658_10139516 | Ga0207658_101395162 | 261 |
| 461 | 3300026075 | Ga0207708_10040352 | Ga0207708_100403523 | 261 |
| 462 | 3300026089 | Ga0207648_10092619 | Ga0207648_100926192 | 261 |
| 463 | 3300026095 | Ga0207676_10070542 | Ga0207676_100705422 | 261 |
| 464 | 3300026118 | Ga0207675_100059882 | Ga0207675_1000598821 | 261 |
| 465 | 3300026121 | Ga0207683_10067654 | Ga0207683_100676542 | 261 |
| 466 | 3300026121 | Ga0207683_10239541 | Ga0207683_102395412 | 261 |
| 467 | 3300026121 | Ga0207683_10266811 | Ga0207683_102668111 | 261 |
| 468 | 3300026142 | Ga0207698_10075761 | Ga0207698_100757613 | 261 |
| 469 | 3300027907 | Ga0207428_10194245 | Ga0207428_101942452 | 261 |
| 470 | 3300032002 | Ga0307416_100448243 | Ga0307416_1004482432 | 261 |
| 471 | 3300032126 | Ga0307415_100398446 | Ga0307415_1003984462 | 261 |
| 472 | 3300046459 | Ga0495629_0100205 | Ga0495629_0100205_378_1265 | 261 |
| 473 | 3300046491 | Ga0495584_0046639 | Ga0495584_0046639_676_1518 | 261 |
| 474 | 3300046501 | Ga0495607_0079110 | Ga0495607_0079110_111_953 | 261 |
| 475 | 3300046528 | Ga0495642_0107161 | Ga0495642_0107161_192_1034 | 261 |
| 476 | 3300046691 | Ga0495670_0080011 | Ga0495670_0080011_756_1598 | 261 |
| 477 | 3300048904 | Ga0496101_0039470 | Ga0496101_0039470_533_1375 | 261 |
| 478 | 3300048907 | Ga0496104_0009675 | Ga0496104_0009675_1547_2404 | 261 |
| 479 | 3300048907 | Ga0496104_0095259 | Ga0496104_0095259_174_1031 | 261 |
| 480 | 3300048908 | Ga0496105_0008495 | Ga0496105_0008495_535_1392 | 261 |
| 481 | 3300048908 | Ga0496105_0113541 | Ga0496105_0113541_660_1502 | 261 |
| 482 | 3300048910 | Ga0496107_0299641 | Ga0496107_0299641_146_1129 | 261 |
| 483 | 3300048911 | Ga0496108_0007007 | Ga0496108_0007007_8211_9053 | 261 |
| 484 | 3300048911 | Ga0496108_0024404 | Ga0496108_0024404_643_1485 | 261 |
| 485 | 3300048912 | Ga0496109_0015282 | Ga0496109_0015282_2475_3317 | 261 |
| 486 | 3300048912 | Ga0496109_0036413 | Ga0496109_0036413_1767_2624 | 261 |
| 487 | 3300048912 | Ga0496109_0125036 | Ga0496109_0125036_536_1519 | 261 |
| 488 | 3300048913 | Ga0496110_0015865 | Ga0496110_0015865_4534_5376 | 261 |
| 489 | 3300048914 | Ga0496111_0017764 | Ga0496111_0017764_1946_2929 | 261 |
| 490 | 3300048914 | Ga0496111_0023258 | Ga0496111_0023258_2624_3466 | 261 |
| 491 | 3300048914 | Ga0496111_0122108 | Ga0496111_0122108_20_877 | 261 |
| 492 | 3300048915 | Ga0496112_0013233 | Ga0496112_0013233_2537_3394 | 261 |
| 493 | 3300048916 | Ga0496113_0001761 | Ga0496113_0001761_8602_9444 | 261 |
| 494 | 3300048916 | Ga0496113_0176570 | Ga0496113_0176570_669_1652 | 261 |
| 495 | 3300048918 | Ga0496115_0072769 | Ga0496115_0072769_1725_2708 | 261 |
| 496 | 3300050515 | nmdc:mga0a205_53201_c1 | nmdc:mga0a205_53201_c1_184_1167 | 261 |
| 497 | 3300005547 | Ga0070693_100393552 | Ga0070693_1003935521 | 262 |
| 498 | 3300005983 | Ga0081540_1003590 | Ga0081540_100359010 | 262 |
| 499 | 3300005985 | Ga0081539_10031344 | Ga0081539_100313444 | 262 |
| 500 | 3300013307 | Ga0157372_10392538 | Ga0157372_103925382 | 262 |
| 501 | 3300014968 | Ga0157379_10027726 | Ga0157379_100277262 | 262 |
| 502 | 3300025909 | Ga0207705_10034442 | Ga0207705_100344424 | 262 |
| 503 | 3300025915 | Ga0207693_10070645 | Ga0207693_100706452 | 262 |
| 504 | 3300025919 | Ga0207657_10008221 | Ga0207657_100082215 | 262 |
| 505 | 3300025939 | Ga0207665_10103539 | Ga0207665_101035392 | 262 |
| 506 | 3300028379 | Ga0268266_10083156 | Ga0268266_100831562 | 262 |
| 507 | 3300037466 | Ga0395898_0177416 | Ga0395898_0177416_835_1686 | 262 |
| 508 | 3300041509 | Ga0451843_1319959 | Ga0451843_1319959_104_922 | 262 |
| 509 | 3300044658 | Ga0466972_0109468 | Ga0466972_0109468_38_886 | 262 |
| 510 | 3300044684 | Ga0466966_0101772 | Ga0466966_0101772_185_1057 | 262 |
| 511 | 3300044901 | Ga0466960_0000174 | Ga0466960_0000174_153_1001 | 262 |
| 512 | 3300046463 | Ga0495653_0001652 | Ga0495653_0001652_13943_14893 | 262 |
| 513 | 3300046471 | Ga0495650_0000055 | Ga0495650_0000055_190705_191574 | 262 |
| 514 | 3300046543 | Ga0495645_0004740 | Ga0495645_0004740_2383_3354 | 262 |
| 515 | 3300048904 | Ga0496101_0006752 | Ga0496101_0006752_6282_7136 | 262 |
| 516 | 3300048904 | Ga0496101_0146541 | Ga0496101_0146541_827_1675 | 262 |
| 517 | 3300048905 | Ga0496102_0042518 | Ga0496102_0042518_2983_3837 | 262 |
| 518 | 3300048909 | Ga0496106_0026304 | Ga0496106_0026304_625_1479 | 262 |
| 519 | 3300048909 | Ga0496106_0219337 | Ga0496106_0219337_455_1321 | 262 |
| 520 | 3300048910 | Ga0496107_0011247 | Ga0496107_0011247_5107_5961 | 262 |
| 521 | 3300048915 | Ga0496112_0020728 | Ga0496112_0020728_5240_6088 | 262 |
| 522 | 3300048915 | Ga0496112_0060568 | Ga0496112_0060568_2658_3524 | 262 |
| 523 | 3300048915 | Ga0496112_0209138 | Ga0496112_0209138_485_1351 | 262 |
| 524 | 3300048916 | Ga0496113_0225787 | Ga0496113_0225787_363_1211 | 262 |
| 525 | 3300048918 | Ga0496115_0000581 | Ga0496115_0000581_21416_22300 | 262 |
| 526 | 3300048922 | Ga0496119_0065632 | Ga0496119_0065632_929_1786 | 262 |
| 527 | 3300048924 | Ga0496121_0040393 | Ga0496121_0040393_2113_2982 | 262 |
| 528 | 3300049571 | Ga0501034_0098077 | Ga0501034_0098077_2030_2878 | 262 |
| 529 | 3300050510 | nmdc:mga06r32_550707_c1 | nmdc:mga06r32_550707_c1_166_1014 | 262 |
| 530 | 3300005337 | Ga0070682_100011195 | Ga0070682_1000111954 | 263 |
| 531 | 3300005338 | Ga0068868_100089212 | Ga0068868_1000892122 | 263 |
| 532 | 3300005356 | Ga0070674_100071502 | Ga0070674_1000715023 | 263 |
| 533 | 3300005437 | Ga0070710_10052656 | Ga0070710_100526562 | 263 |
| 534 | 3300005439 | Ga0070711_100195817 | Ga0070711_1001958172 | 263 |
| 535 | 3300005544 | Ga0070686_100011251 | Ga0070686_1000112514 | 263 |
| 536 | 3300006048 | Ga0075363_100068459 | Ga0075363_1000684592 | 263 |
| 537 | 3300006175 | Ga0070712_100001897 | Ga0070712_1000018979 | 263 |
| 538 | 3300007076 | Ga0075435_100352758 | Ga0075435_1003527581 | 263 |
| 539 | 3300025901 | Ga0207688_10029668 | Ga0207688_100296681 | 263 |
| 540 | 3300025915 | Ga0207693_10000677 | Ga0207693_1000067710 | 263 |
| 541 | 3300025927 | Ga0207687_10024845 | Ga0207687_100248454 | 263 |
| 542 | 3300025936 | Ga0207670_10160274 | Ga0207670_101602742 | 263 |
| 543 | 3300025937 | Ga0207669_10076194 | Ga0207669_100761942 | 263 |
| 544 | 3300025961 | Ga0207712_10053320 | Ga0207712_100533202 | 263 |
| 545 | 3300026023 | Ga0207677_10048251 | Ga0207677_100482513 | 263 |
| 546 | 3300046455 | Ga0495603_0146233 | Ga0495603_0146233_398_1279 | 263 |
| 547 | 3300046461 | Ga0495641_0012982 | Ga0495641_0012982_1211_2092 | 263 |
| 548 | 3300046473 | Ga0495582_0188450 | Ga0495582_0188450_122_1003 | 263 |
| 549 | 3300046529 | Ga0495652_0309001 | Ga0495652_0309001_286_1131 | 263 |
| 550 | 3300046543 | Ga0495645_0000055 | Ga0495645_0000055_25855_26784 | 263 |
| 551 | 3300046683 | Ga0495658_0094478 | Ga0495658_0094478_35_916 | 263 |
| 552 | 3300047317 | Ga0495604_0059967 | Ga0495604_0059967_1784_2629 | 263 |
| 553 | 3300048910 | Ga0496107_0172955 | Ga0496107_0172955_665_1531 | 263 |
| 554 | 3300048912 | Ga0496109_0299880 | Ga0496109_0299880_83_952 | 263 |
| 555 | 3300048913 | Ga0496110_0177265 | Ga0496110_0177265_591_1562 | 263 |
| 556 | 3300050490 | nmdc:mga03n38_94137_c1 | nmdc:mga03n38_94137_c1_189_1070 | 263 |
| 557 | 3300050494 | nmdc:mga06z11_32083_c1 | nmdc:mga06z11_32083_c1_219_1100 | 263 |
| 558 | 3300050513 | nmdc:mga0rr50_339934_c1 | nmdc:mga0rr50_339934_c1_210_1091 | 263 |
| 559 | 3300053077 | Ga0495601_0029656 | Ga0495601_0029656_1127_1972 | 263 |
| 560 | 3300006871 | Ga0075434_100006423 | Ga0075434_1000064234 | 264 |
| 561 | 3300037466 | Ga0395898_0083790 | Ga0395898_0083790_642_1523 | 266 |
| 562 | 3300038443 | Ga0395901_0053969 | Ga0395901_0053969_462_1343 | 266 |
| 563 | 3300045976 | Ga0466967_0054442 | Ga0466967_0054442_1076_1888 | 266 |
| 564 | 3300006871 | Ga0075434_100054927 | Ga0075434_1000549273 | 267 |
| 565 | 3300007076 | Ga0075435_100169154 | Ga0075435_1001691542 | 267 |
| 566 | 3300014745 | Ga0157377_10077639 | Ga0157377_100776392 | 267 |
| 567 | 3300046491 | Ga0495584_0037880 | Ga0495584_0037880_1069_1959 | 267 |
| 568 | 3300050511 | nmdc:mga08y16_207803_c1 | nmdc:mga08y16_207803_c1_408_1373 | 267 |
| 569 | 3300050512 | nmdc:mga0n895_43869_c1 | nmdc:mga0n895_43869_c1_1844_2809 | 267 |
| 570 | 3300050515 | nmdc:mga0a205_185042_c1 | nmdc:mga0a205_185042_c1_352_1215 | 267 |
| 571 | 3300005334 | Ga0068869_100119666 | Ga0068869_1001196662 | 268 |
| 572 | 3300005344 | Ga0070661_100025148 | Ga0070661_1000251482 | 268 |
| 573 | 3300005364 | Ga0070673_100178412 | Ga0070673_1001784122 | 268 |
| 574 | 3300005441 | Ga0070700_100007134 | Ga0070700_1000071344 | 268 |
| 575 | 3300005548 | Ga0070665_100468003 | Ga0070665_1004680032 | 268 |
| 576 | 3300005614 | Ga0068856_100012430 | Ga0068856_1000124308 | 268 |
| 577 | 3300005616 | Ga0068852_100047959 | Ga0068852_1000479594 | 268 |
| 578 | 3300006038 | Ga0075365_10051144 | Ga0075365_100511442 | 268 |
| 579 | 3300006175 | Ga0070712_100023236 | Ga0070712_1000232362 | 268 |
| 580 | 3300009098 | Ga0105245_10000669 | Ga0105245_1000066934 | 268 |
| 581 | 3300013296 | Ga0157374_10006355 | Ga0157374_100063552 | 268 |
| 582 | 3300013307 | Ga0157372_10049481 | Ga0157372_100494814 | 268 |
| 583 | 3300013308 | Ga0157375_10090423 | Ga0157375_100904232 | 268 |
| 584 | 3300014745 | Ga0157377_10002213 | Ga0157377_100022134 | 268 |
| 585 | 3300025901 | Ga0207688_10001553 | Ga0207688_100015534 | 268 |
| 586 | 3300025926 | Ga0207659_10024972 | Ga0207659_100249722 | 268 |
| 587 | 3300025933 | Ga0207706_10036331 | Ga0207706_100363312 | 268 |
| 588 | 3300025942 | Ga0207689_10040927 | Ga0207689_100409274 | 268 |
| 589 | 3300026023 | Ga0207677_10099408 | Ga0207677_100994082 | 268 |
| 590 | 3300026075 | Ga0207708_10000144 | Ga0207708_1000014446 | 268 |
| 591 | 3300026095 | Ga0207676_10392776 | Ga0207676_103927762 | 268 |
| 592 | 3300048905 | Ga0496102_0033117 | Ga0496102_0033117_1215_2180 | 268 |
| 593 | 3300048908 | Ga0496105_0007598 | Ga0496105_0007598_3272_4237 | 268 |
| 594 | 3300048911 | Ga0496108_0027324 | Ga0496108_0027324_555_1520 | 268 |
| 595 | 3300048912 | Ga0496109_0179980 | Ga0496109_0179980_283_1248 | 268 |
| 596 | 3300048913 | Ga0496110_0117161 | Ga0496110_0117161_159_1124 | 268 |
| 597 | 3300048915 | Ga0496112_0057311 | Ga0496112_0057311_1904_2869 | 268 |
| 598 | 3300048916 | Ga0496113_0012175 | Ga0496113_0012175_4462_5427 | 268 |
| 599 | 3300050511 | nmdc:mga08y16_132920_c1 | nmdc:mga08y16_132920_c1_559_1524 | 268 |
| 600 | 3300005981 | Ga0081538_10003315 | Ga0081538_1000331512 | 269 |
| 601 | 3300006846 | Ga0075430_100022815 | Ga0075430_1000228154 | 270 |
| 602 | 3300006846 | Ga0075430_100182603 | Ga0075430_1001826031 | 270 |
| 603 | 3300006852 | Ga0075433_10038711 | Ga0075433_100387114 | 270 |
| 604 | 3300006880 | Ga0075429_100045049 | Ga0075429_1000450494 | 270 |
| 605 | 3300007076 | Ga0075435_100107500 | Ga0075435_1001075001 | 270 |
| 606 | 3300009094 | Ga0111539_10018708 | Ga0111539_100187083 | 270 |
| 607 | 3300009098 | Ga0105245_10002692 | Ga0105245_100026927 | 270 |
| 608 | 3300009147 | Ga0114129_10039784 | Ga0114129_100397842 | 270 |
| 609 | 3300009147 | Ga0114129_10090382 | Ga0114129_100903822 | 270 |
| 610 | 3300009147 | Ga0114129_10165540 | Ga0114129_101655403 | 270 |
| 611 | 3300009553 | Ga0105249_10003833 | Ga0105249_100038339 | 270 |
| 612 | 3300025981 | Ga0207640_10063200 | Ga0207640_100632003 | 270 |
| 613 | 3300027907 | Ga0207428_10031421 | Ga0207428_100314214 | 270 |
| 614 | 3300031731 | Ga0307405_10141401 | Ga0307405_101414012 | 270 |
| 615 | 3300031852 | Ga0307410_10498983 | Ga0307410_104989831 | 270 |
| 616 | 3300031995 | Ga0307409_100058844 | Ga0307409_1000588443 | 270 |
| 617 | 3300032126 | Ga0307415_100019604 | Ga0307415_1000196043 | 270 |
| 618 | 3300032126 | Ga0307415_100188307 | Ga0307415_1001883072 | 270 |
| 619 | 3300035112 | Ga0373932_0031565 | Ga0373932_0031565_407_1219 | 270 |
| 620 | 3300035121 | Ga0373960_0016150 | Ga0373960_0016150_206_1018 | 270 |
| 621 | 3300035691 | Ga0373931_0053879 | Ga0373931_0053879_818_1630 | 270 |
| 622 | 3300037466 | Ga0395898_0147321 | Ga0395898_0147321_645_1457 | 270 |
| 623 | 3300046689 | Ga0495613_0135268 | Ga0495613_0135268_554_1435 | 270 |
| 624 | 3300048089 | Ga0495614_0100680 | Ga0495614_0100680_198_1079 | 270 |
| 625 | 3300049568 | Ga0501031_0112382 | Ga0501031_0112382_85_951 | 270 |
| 626 | 3300049572 | Ga0501036_0261959 | Ga0501036_0261959_139_1005 | 270 |
| 627 | 3300049572 | Ga0501036_0446203 | Ga0501036_0446203_155_967 | 270 |
| 628 | 3300049580 | Ga0501046_0053408 | Ga0501046_0053408_681_1493 | 270 |
| 629 | 3300049582 | Ga0501048_0329665 | Ga0501048_0329665_195_1007 | 270 |
| 630 | 3300049587 | Ga0501071_0135237 | Ga0501071_0135237_617_1429 | 270 |
| 631 | 3300049588 | Ga0501072_0070913 | Ga0501072_0070913_513_1379 | 270 |
| 632 | 3300049590 | Ga0501074_0244943 | Ga0501074_0244943_327_1193 | 270 |
| 633 | 3300049592 | Ga0501076_0059543 | Ga0501076_0059543_740_1606 | 270 |
| 634 | 3300049743 | Ga0501081_0093453 | Ga0501081_0093453_597_1409 | 270 |
| 635 | 3300050507 | nmdc:mga05p37_157690_c1 | nmdc:mga05p37_157690_c1_361_1227 | 270 |
| 636 | 3300050507 | nmdc:mga05p37_29983_c1 | nmdc:mga05p37_29983_c1_4823_5701 | 270 |
| 637 | 3300050507 | nmdc:mga05p37_541883_c1 | nmdc:mga05p37_541883_c1_440_1252 | 270 |
| 638 | 3300050507 | nmdc:mga05p37_8891_c1 | nmdc:mga05p37_8891_c1_8537_9349 | 270 |
| 639 | 3300050508 | nmdc:mga09592_525199_c1 | nmdc:mga09592_525199_c1_23_835 | 270 |
| 640 | 3300050509 | nmdc:mga0qj67_40801_c1 | nmdc:mga0qj67_40801_c1_1655_2467 | 270 |
| 641 | 3300050510 | nmdc:mga06r32_2689_c1 | nmdc:mga06r32_2689_c1_1731_2609 | 270 |
| 642 | 3300050511 | nmdc:mga08y16_196867_c1 | nmdc:mga08y16_196867_c1_1064_1876 | 270 |
| 643 | 3300050512 | nmdc:mga0n895_5709_c1 | nmdc:mga0n895_5709_c1_5654_6532 | 270 |
| 644 | 3300050513 | nmdc:mga0rr50_110528_c1 | nmdc:mga0rr50_110528_c1_975_1853 | 270 |
| 645 | 3300050515 | nmdc:mga0a205_137590_c1 | nmdc:mga0a205_137590_c1_792_1604 | 270 |
| 646 | 3300061734 | Ga0530510_0116220 | Ga0530510_0116220_706_1572 | 270 |
| 647 | 3300031995 | Ga0307409_100006140 | Ga0307409_1000061405 | 271 |
| 648 | 3300032004 | Ga0307414_10022264 | Ga0307414_100222644 | 271 |
| 649 | 3300032005 | Ga0307411_10099204 | Ga0307411_100992042 | 271 |
| 650 | 3300032126 | Ga0307415_100033263 | Ga0307415_1000332633 | 271 |
| 651 | 3300049661 | Ga0501217_065903 | Ga0501217_065903_87_902 | 271 |
| 652 | 3300050507 | nmdc:mga05p37_43891_c1 | nmdc:mga05p37_43891_c1_3229_4074 | 271 |
| 653 | 3300003373 | JGI25407J50210_10001587 | JGI25407J50210_100015875 | 272 |
| 654 | 3300005981 | Ga0081538_10165775 | Ga0081538_101657751 | 272 |
| 655 | 3300006038 | Ga0075365_10044634 | Ga0075365_100446341 | 272 |
| 656 | 3300006847 | Ga0075431_100039664 | Ga0075431_1000396647 | 272 |
| 657 | 3300006852 | Ga0075433_10273631 | Ga0075433_102736312 | 272 |
| 658 | 3300006871 | Ga0075434_100061463 | Ga0075434_1000614632 | 272 |
| 659 | 3300007076 | Ga0075435_100214833 | Ga0075435_1002148331 | 272 |
| 660 | 3300009147 | Ga0114129_10034007 | Ga0114129_100340074 | 272 |
| 661 | 3300031901 | Ga0307406_10015221 | Ga0307406_100152213 | 272 |
| 662 | 3300031901 | Ga0307406_10022093 | Ga0307406_100220934 | 272 |
| 663 | 3300031903 | Ga0307407_10122250 | Ga0307407_101222502 | 272 |
| 664 | 3300031995 | Ga0307409_100012655 | Ga0307409_1000126557 | 272 |
| 665 | 3300032002 | Ga0307416_100039385 | Ga0307416_1000393852 | 272 |
| 666 | 3300032002 | Ga0307416_100587841 | Ga0307416_1005878412 | 272 |
| 667 | 3300046528 | Ga0495642_0099935 | Ga0495642_0099935_134_967 | 272 |
| 668 | 3300049576 | Ga0501040_0130181 | Ga0501040_0130181_485_1318 | 272 |
| 669 | 3300050507 | nmdc:mga05p37_936144_c1 | nmdc:mga05p37_936144_c1_38_859 | 272 |
| 670 | 3300005458 | Ga0070681_10128134 | Ga0070681_101281344 | 273 |
| 671 | 3300005535 | Ga0070684_100044176 | Ga0070684_1000441765 | 273 |
| 672 | 3300005614 | Ga0068856_100497696 | Ga0068856_1004976962 | 273 |
| 673 | 3300025917 | Ga0207660_10270672 | Ga0207660_102706722 | 273 |
| 674 | 3300045976 | Ga0466967_0289579 | Ga0466967_0289579_556_1389 | 273 |
| 675 | 3300048916 | Ga0496113_0090120 | Ga0496113_0090120_1158_1994 | 273 |
| 676 | 3300000549 | LJQas_1004111 | LJQas_10041112 | 274 |
| 677 | 3300005327 | Ga0070658_10151055 | Ga0070658_101510551 | 274 |
| 678 | 3300005329 | Ga0070683_100028945 | Ga0070683_1000289451 | 274 |
| 679 | 3300005336 | Ga0070680_100015319 | Ga0070680_1000153192 | 274 |
| 680 | 3300005339 | Ga0070660_100186885 | Ga0070660_1001868852 | 274 |
| 681 | 3300005458 | Ga0070681_10002829 | Ga0070681_100028296 | 274 |
| 682 | 3300005530 | Ga0070679_100034677 | Ga0070679_1000346772 | 274 |
| 683 | 3300005539 | Ga0068853_100040299 | Ga0068853_1000402993 | 274 |
| 684 | 3300005563 | Ga0068855_100360871 | Ga0068855_1003608712 | 274 |
| 685 | 3300005564 | Ga0070664_100040090 | Ga0070664_1000400903 | 274 |
| 686 | 3300005616 | Ga0068852_100002783 | Ga0068852_1000027839 | 274 |
| 687 | 3300005981 | Ga0081538_10011600 | Ga0081538_100116003 | 274 |
| 688 | 3300005981 | Ga0081538_10014377 | Ga0081538_100143776 | 274 |
| 689 | 3300005983 | Ga0081540_1056995 | Ga0081540_10569951 | 274 |
| 690 | 3300006844 | Ga0075428_100046970 | Ga0075428_1000469706 | 274 |
| 691 | 3300006846 | Ga0075430_100001607 | Ga0075430_10000160717 | 274 |
| 692 | 3300006880 | Ga0075429_100017712 | Ga0075429_1000177124 | 274 |
| 693 | 3300009545 | Ga0105237_10072649 | Ga0105237_100726492 | 274 |
| 694 | 3300009551 | Ga0105238_10023960 | Ga0105238_100239603 | 274 |
| 695 | 3300013102 | Ga0157371_10165552 | Ga0157371_101655522 | 274 |
| 696 | 3300013104 | Ga0157370_10034555 | Ga0157370_100345552 | 274 |
| 697 | 3300013105 | Ga0157369_10042338 | Ga0157369_100423383 | 274 |
| 698 | 3300013307 | Ga0157372_10031201 | Ga0157372_100312013 | 274 |
| 699 | 3300025912 | Ga0207707_10004145 | Ga0207707_100041459 | 274 |
| 700 | 3300025914 | Ga0207671_10123956 | Ga0207671_101239562 | 274 |
| 701 | 3300025917 | Ga0207660_10016594 | Ga0207660_100165944 | 274 |
| 702 | 3300025921 | Ga0207652_10019049 | Ga0207652_100190495 | 274 |
| 703 | 3300025924 | Ga0207694_10032291 | Ga0207694_100322914 | 274 |
| 704 | 3300025944 | Ga0207661_10006000 | Ga0207661_100060002 | 274 |
| 705 | 3300026041 | Ga0207639_10102459 | Ga0207639_101024592 | 274 |
| 706 | 3300026116 | Ga0207674_10112077 | Ga0207674_101120772 | 274 |
| 707 | 3300026142 | Ga0207698_10010173 | Ga0207698_100101733 | 274 |
| 708 | 3300037466 | Ga0395898_0233643 | Ga0395898_0233643_868_1707 | 274 |
| 709 | 3300038443 | Ga0395901_0009881 | Ga0395901_0009881_2566_3405 | 274 |
| 710 | 3300048911 | Ga0496108_0157546 | Ga0496108_0157546_747_1586 | 274 |
| 711 | 3300048912 | Ga0496109_0010650 | Ga0496109_0010650_2786_3625 | 274 |
| 712 | 3300048914 | Ga0496111_0082506 | Ga0496111_0082506_74_913 | 274 |
| 713 | 3300048916 | Ga0496113_0039799 | Ga0496113_0039799_498_1337 | 274 |
| 714 | 3300049572 | Ga0501036_0213675 | Ga0501036_0213675_495_1331 | 274 |
| 715 | 3300049588 | Ga0501072_0324477 | Ga0501072_0324477_164_1000 | 274 |
| 716 | 3300050508 | nmdc:mga09592_33101_c1 | nmdc:mga09592_33101_c1_2693_3532 | 274 |
| 717 | 3300050509 | nmdc:mga0qj67_13160_c1 | nmdc:mga0qj67_13160_c1_3533_4372 | 274 |
| 718 | 3300050510 | nmdc:mga06r32_38703_c1 | nmdc:mga06r32_38703_c1_605_1444 | 274 |
| 719 | 3300061734 | Ga0530510_0014384 | Ga0530510_0014384_4366_5202 | 274 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8tzj-assembly1.cif.gz_A | cryo-em structure of vibrio cholerae ftse/ftsx complex | 0.9787 | 25 | 240 |
| 2pcj-assembly1.cif.gz_B | crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 | 0.9585 | 24 | 242 |
| 8tzj-assembly1.cif.gz_A | cryo-em structure of vibrio cholerae ftse/ftsx complex | 0.9569 | 25 | 240 |
| 8idd-assembly1.cif.gz_B | cryo-em structure of mycobacterium tuberculosis atp bound ftsex/ripc complex in peptidisc | 0.9529 | 25 | 244 |
| 6z67-assembly3.cif.gz_E | ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution | 0.9514 | 24 | 250 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0A9R7_1_220_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.975 | 26 | 239 | 3.40.50.300 |
| af_O05779_1_226_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9679 | 25 | 248 | 3.40.50.300 |
| 2pclA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.959 | 24 | 242 | 3.40.50.300 |
| af_P75957_1_229_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9574 | 24 | 239 | 3.40.50.300 |
| af_O05779_1_226_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9553 | 25 | 248 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A377TL40-F1-model_v4 | Methionine ABC transporter ATP-binding protein (EC 3.6.3.-) | 0.973 | 76 | 210 |
GO:0005524
GO:0005886 GO:0016887 |
| AF-A0A3D3VDK4-F1-model_v4 | Cell division ATP-binding protein FtsE | 0.9716 | 24 | 175 |
GO:0005524
GO:0005886 GO:0016887 GO:0022857 GO:0051301 |
| AF-A0A3A5JIQ6-F1-model_v4 | ATP-binding cassette domain-containing protein | 0.9655 | 59 | 187 |
GO:0005524
GO:0016887 |
| AF-K1SC20-F1-model_v4 | ABC superfamily ATP binding cassette transporter, ABC protein | 0.9625 | 24 | 220 |
GO:0005524
GO:0005886 GO:0016887 GO:0022857 |
| AF-V9Y1K6-F1-model_v4 | MacB-like periplasmic core domain protein | 0.9578 | 109 | 244 |
GO:0005524
GO:0005886 GO:0016887 GO:0022857 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar