F477225

General Info

Members Datasets Scaffolds Average Seq Length
719 299 719 278

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100468003|Ga0070665_1004680032
Length 330
Sequence MLHGALQARGPPARILTPMAAPTRSRRISSTPLRPRKRKDKTPAAPPKPAAVGPVPKXDAPPAPVIEFRGVAKEYDSGDIGVEQATFTVARGDFVFFVGPSGSGKSTLIRLLIKELDPTGGTIRVAGLNLSEITEKGVPYYRRNLGVVFQDFKLLPNRTVYDNVAYALQVTGHSRKEIRAKVPDILRLTGLATKLHNFPDQLSGGEQQRVSIARAFVNHPPLLVADEPTGNLDPETSIGIMQLLYRINRTGTTVVVATHDREMVDRMRRRVIQLEQGRVIRDEAAGFYVGDESTREFAARMRDGDPGPDADLPVSRAGKEIDALPREHDG

Samples

Sample ID Description Type Environment
1 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
161 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
162 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
163 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
164 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
165 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
166 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
167 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
168 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
169 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
170 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
171 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
172 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
173 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
174 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
175 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
176 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
177 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
178 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
179 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
180 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
181 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
182 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
183 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
184 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
185 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
186 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
187 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
188 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
189 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
190 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
191 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
192 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
193 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
194 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
195 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
196 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
197 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
198 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
199 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
200 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
201 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
202 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
203 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
204 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
205 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
206 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
207 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
208 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
209 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
210 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
211 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
212 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
213 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
214 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
215 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
216 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
217 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
218 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
219 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
220 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
221 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
222 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
223 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
224 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
225 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
226 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
227 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
228 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
229 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
230 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
231 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
232 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
233 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
234 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
235 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
236 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
237 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
238 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
239 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
240 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
241 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
242 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
243 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
244 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
245 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
246 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
247 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
248 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
249 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
250 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
251 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
252 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
253 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
254 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
255 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
256 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
257 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
267 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
268 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
269 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
270 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
271 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
272 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
273 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
274 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
275 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
276 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
277 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
279 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
280 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
281 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
282 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
283 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
284 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
285 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
286 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
287 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
288 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
289 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
290 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
291 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
292 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
293 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
294 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
295 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
296 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
297 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
298 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
299 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.58
Metatranscriptomes 0.42
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.2
Nodule 0
Rhizoplane 16.27
Rhizosphere 79.97
Stem 0
Stem Tuber 0
Unclassified 0.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1004111 3300000549 Bacteria 1911
2 JGI25407J50210_10001587 3300003373 Bacteria 5183
3 Ga0070658_10015503 3300005327 Bacteria 6096
4 Ga0070658_10151055 3300005327 Bacteria 1945
5 Ga0070683_100028945 3300005329 Bacteria 5010
6 Ga0070683_100037483 3300005329 Bacteria 4438
7 Ga0070683_100110974 3300005329 Bacteria 2587
8 Ga0068869_100058170 3300005334 Bacteria 2825
9 Ga0068869_100119666 3300005334 Bacteria 2013
10 Ga0070680_100015319 3300005336 Bacteria 6007
11 Ga0070680_100043211 3300005336 Bacteria 3660
12 Ga0070682_100011195 3300005337 Bacteria 5119
13 Ga0070682_100050574 3300005337 Bacteria 2595
14 Ga0070682_100058674 3300005337 Bacteria 2428
15 Ga0068868_100011835 3300005338 Bacteria 6361
16 Ga0068868_100016431 3300005338 Bacteria 5496
17 Ga0068868_100016773 3300005338 Bacteria 5446
18 Ga0068868_100018104 3300005338 Bacteria 5259
19 Ga0068868_100030208 3300005338 Bacteria 4155
20 Ga0068868_100089212 3300005338 Bacteria 2482
21 Ga0068868_100200232 3300005338 Bacteria 1664
22 Ga0070660_100002839 3300005339 Bacteria 11929
23 Ga0070660_100006060 3300005339 Bacteria 8359
24 Ga0070660_100009392 3300005339 Bacteria 6875
25 Ga0070660_100186885 3300005339 Bacteria 1678
26 Ga0070689_100072393 3300005340 Bacteria 2694
27 Ga0070689_100173892 3300005340 Bacteria 1746
28 Ga0070691_10044147 3300005341 Bacteria 2113
29 Ga0070687_100056701 3300005343 Bacteria 2051
30 Ga0070687_100154329 3300005343 Bacteria 1351
31 Ga0070661_100025148 3300005344 Bacteria 4277
32 Ga0070661_100027674 3300005344 Bacteria 4085
33 Ga0070692_10005288 3300005345 Bacteria 5484
34 Ga0070692_10056320 3300005345 Bacteria 2058
35 Ga0070668_100051335 3300005347 Bacteria 3177
36 Ga0070668_100060266 3300005347 Bacteria 2938
37 Ga0070668_100229392 3300005347 Bacteria 1534
38 Ga0070675_100011764 3300005354 Bacteria 6854
39 Ga0070675_100044247 3300005354 Bacteria 3640
40 Ga0070674_100013587 3300005356 Bacteria 5038
41 Ga0070674_100071502 3300005356 Bacteria 2454
42 Ga0070674_100398636 3300005356 Bacteria 1124
43 Ga0070673_100121356 3300005364 Bacteria 2181
44 Ga0070673_100178412 3300005364 Bacteria 1817
45 Ga0070688_100045380 3300005365 Bacteria 2715
46 Ga0070688_100151967 3300005365 Bacteria 1583
47 Ga0070688_100158909 3300005365 Bacteria 1551
48 Ga0070659_100000030 3300005366 Bacteria 128662
49 Ga0070659_100003072 3300005366 Bacteria 11853
50 Ga0070659_100007128 3300005366 Bacteria 8109
51 Ga0070659_100090951 3300005366 Bacteria 2446
52 Ga0070659_100483829 3300005366 Bacteria 1053
53 Ga0070709_10154429 3300005434 Bacteria 1589
54 Ga0070714_100018715 3300005435 Bacteria 5634
55 Ga0070714_100130846 3300005435 Bacteria 2243
56 Ga0070710_10000002 3300005437 Bacteria 290371
57 Ga0070710_10052656 3300005437 Bacteria 2290
58 Ga0070701_10180337 3300005438 Bacteria 1236
59 Ga0070711_100002079 3300005439 Bacteria 11310
60 Ga0070711_100058046 3300005439 Bacteria 2682
61 Ga0070711_100195817 3300005439 Bacteria 1556
62 Ga0070705_100002095 3300005440 Bacteria 10161
63 Ga0070705_100181033 3300005440 Bacteria 1428
64 Ga0070700_100005075 3300005441 Bacteria 6943
65 Ga0070700_100007134 3300005441 Bacteria 6015
66 Ga0070708_100357294 3300005445 Bacteria 1377
67 Ga0070678_100007985 3300005456 Bacteria 6308
68 Ga0070678_100294040 3300005456 Bacteria 1378
69 Ga0070681_10002829 3300005458 Bacteria 16032
70 Ga0070681_10128134 3300005458 Bacteria 2471
71 Ga0068867_100079020 3300005459 Bacteria 2475
72 Ga0068867_100161951 3300005459 Bacteria 1765
73 Ga0070685_10010229 3300005466 Bacteria 4869
74 Ga0070679_100034677 3300005530 Bacteria 5002
75 Ga0070679_100156115 3300005530 Bacteria 2257
76 Ga0070684_100030701 3300005535 Bacteria 4569
77 Ga0070684_100044176 3300005535 Bacteria 3852
78 Ga0070684_100093670 3300005535 Bacteria 2674
79 Ga0070684_100165382 3300005535 Bacteria 2008
80 Ga0070684_100330208 3300005535 Bacteria 1401
81 Ga0068853_100040299 3300005539 Bacteria 3985
82 Ga0068853_100367488 3300005539 Bacteria 1341
83 Ga0068853_100500022 3300005539 Bacteria 1148
84 Ga0070672_100010299 3300005543 Bacteria 6479
85 Ga0070672_100346972 3300005543 Bacteria 1265
86 Ga0070686_100011251 3300005544 Bacteria 5070
87 Ga0070686_100031311 3300005544 Bacteria 3251
88 Ga0070686_100059709 3300005544 Bacteria 2458
89 Ga0070686_100120057 3300005544 Bacteria 1804
90 Ga0070695_100307511 3300005545 Bacteria 1174
91 Ga0070696_100104892 3300005546 Bacteria 2030
92 Ga0070693_100003310 3300005547 Bacteria 7490
93 Ga0070693_100004855 3300005547 Bacteria 6416
94 Ga0070693_100393552 3300005547 Bacteria 959
95 Ga0070665_100156636 3300005548 Bacteria 2279
96 Ga0070665_100468003 3300005548 Bacteria 1271
97 Ga0070704_100128137 3300005549 Bacteria 1962
98 Ga0070704_100425733 3300005549 Bacteria 1138
99 Ga0068855_100015445 3300005563 Bacteria 9192
100 Ga0068855_100144755 3300005563 Bacteria 2707
101 Ga0068855_100360871 3300005563 Bacteria 1599
102 Ga0070664_100011830 3300005564 Bacteria 7084
103 Ga0070664_100040090 3300005564 Bacteria 3948
104 Ga0068857_100114993 3300005577 Bacteria 2420
105 Ga0068857_100203076 3300005577 Bacteria 1807
106 Ga0068857_100279007 3300005577 Bacteria 1537
107 Ga0068854_100007323 3300005578 Bacteria 7053
108 Ga0068856_100012430 3300005614 Bacteria 8242
109 Ga0068856_100015647 3300005614 Bacteria 7333
110 Ga0068856_100072879 3300005614 Bacteria 3400
111 Ga0068856_100082171 3300005614 Bacteria 3197
112 Ga0068856_100377130 3300005614 Bacteria 1437
113 Ga0068856_100497696 3300005614 Bacteria 1240
114 Ga0070702_100017387 3300005615 Bacteria 3709
115 Ga0070702_100037221 3300005615 Bacteria 2701
116 Ga0068852_100002783 3300005616 Bacteria 12113
117 Ga0068852_100028449 3300005616 Bacteria 4575
118 Ga0068852_100047959 3300005616 Bacteria 3648
119 Ga0068852_100365820 3300005616 Bacteria 1412
120 Ga0068859_100048594 3300005617 Bacteria 4261
121 Ga0068864_100048394 3300005618 Bacteria 3655
122 Ga0068866_10019503 3300005718 Bacteria 3089
123 Ga0068861_100176344 3300005719 Bacteria 1775
124 Ga0068851_10083152 3300005834 Bacteria 1675
125 Ga0068858_100100629 3300005842 Bacteria 2695
126 Ga0068858_100211165 3300005842 Bacteria 1837
127 Ga0068858_100225716 3300005842 Bacteria 1775
128 Ga0068860_100406954 3300005843 Bacteria 1347
129 Ga0081538_10003315 3300005981 Bacteria 15262
130 Ga0081538_10011600 3300005981 Bacteria 7127
131 Ga0081538_10014377 3300005981 Bacteria 6200
132 Ga0081538_10018210 3300005981 Bacteria 5288
133 Ga0081538_10165775 3300005981 Bacteria 973
134 Ga0081540_1003590 3300005983 Bacteria 12182
135 Ga0081540_1056995 3300005983 Bacteria 1892
136 Ga0081539_10005785 3300005985 Bacteria 12319
137 Ga0081539_10031344 3300005985 Bacteria 3279
138 Ga0070717_10000006 3300006028 Bacteria 353403
139 Ga0070717_10006501 3300006028 Bacteria 8600
140 Ga0075365_10000962 3300006038 Bacteria 12225
141 Ga0075365_10034978 3300006038 Bacteria 3248
142 Ga0075365_10039533 3300006038 Bacteria 3072
143 Ga0075365_10044634 3300006038 Bacteria 2905
144 Ga0075365_10051144 3300006038 Bacteria 2728
145 Ga0075365_10189924 3300006038 Bacteria 1437
146 Ga0075363_100004856 3300006048 Bacteria 5938
147 Ga0075363_100068459 3300006048 Bacteria 1925
148 Ga0075364_10141452 3300006051 Bacteria 1619
149 Ga0070716_100104670 3300006173 Bacteria 1742
150 Ga0070712_100000003 3300006175 Bacteria 253696
151 Ga0070712_100001897 3300006175 Bacteria 12763
152 Ga0070712_100023236 3300006175 Bacteria 4094
153 Ga0070712_100160520 3300006175 Bacteria 1735
154 Ga0070712_100412302 3300006175 Bacteria 1118
155 Ga0097621_100008265 3300006237 Bacteria 7488
156 Ga0075428_100046970 3300006844 Bacteria 4743
157 Ga0075428_100182529 3300006844 Bacteria 2271
158 Ga0075430_100001607 3300006846 Bacteria 18432
159 Ga0075430_100008213 3300006846 Bacteria 8816
160 Ga0075430_100022815 3300006846 Bacteria 5323
161 Ga0075430_100182603 3300006846 Bacteria 1745
162 Ga0075431_100016842 3300006847 Bacteria 7422
163 Ga0075431_100039664 3300006847 Bacteria 4852
164 Ga0075433_10038711 3300006852 Bacteria 4120
165 Ga0075433_10241478 3300006852 Bacteria 1603
166 Ga0075433_10273631 3300006852 Bacteria 1497
167 Ga0075434_100000636 3300006871 Bacteria 27160
168 Ga0075434_100006423 3300006871 Bacteria 10771
169 Ga0075434_100015967 3300006871 Bacteria 7214
170 Ga0075434_100054927 3300006871 Bacteria 3957
171 Ga0075434_100061463 3300006871 Bacteria 3737
172 Ga0075434_100063702 3300006871 Bacteria 3670
173 Ga0075429_100017712 3300006880 Bacteria 6160
174 Ga0075429_100045049 3300006880 Bacteria 3838
175 Ga0068865_100021350 3300006881 Bacteria 4208
176 Ga0068865_100044283 3300006881 Bacteria 3046
177 Ga0068865_100284557 3300006881 Bacteria 1317
178 Ga0075436_100014111 3300006914 Bacteria 5470
179 Ga0075436_100017851 3300006914 Bacteria 4858
180 Ga0097620_100048592 3300006931 Bacteria 4261
181 Ga0075435_100005632 3300007076 Bacteria 8775
182 Ga0075435_100030324 3300007076 Bacteria 4251
183 Ga0075435_100107500 3300007076 Bacteria 2317
184 Ga0075435_100169154 3300007076 Bacteria 1844
185 Ga0075435_100214833 3300007076 Bacteria 1632
186 Ga0075435_100352758 3300007076 Bacteria 1261
187 Ga0105240_10194152 3300009093 Bacteria 2385
188 Ga0111539_10018708 3300009094 Bacteria 8577
189 Ga0111539_10126830 3300009094 Bacteria 2989
190 Ga0111539_10177351 3300009094 Bacteria 2489
191 Ga0105245_10000236 3300009098 Bacteria 52639
192 Ga0105245_10000669 3300009098 Bacteria 31081
193 Ga0105245_10002692 3300009098 Bacteria 15989
194 Ga0105245_10011183 3300009098 Bacteria 7811
195 Ga0105245_10011861 3300009098 Bacteria 7579
196 Ga0105245_10061512 3300009098 Bacteria 3385
197 Ga0105245_10062746 3300009098 Bacteria 3353
198 Ga0105247_10016729 3300009101 Bacteria 4397
199 Ga0105247_10121695 3300009101 Bacteria 1691
200 Ga0105247_10215442 3300009101 Bacteria 1297
201 Ga0114129_10034007 3300009147 Bacteria 7200
202 Ga0114129_10039784 3300009147 Bacteria 6632
203 Ga0114129_10090382 3300009147 Bacteria 4245
204 Ga0114129_10165540 3300009147 Bacteria 3018
205 Ga0105243_10011229 3300009148 Bacteria 6776
206 Ga0105243_10014153 3300009148 Bacteria 6034
207 Ga0105243_10053195 3300009148 Bacteria 3211
208 Ga0105241_10015056 3300009174 Bacteria 5665
209 Ga0105242_10038913 3300009176 Bacteria 3827
210 Ga0105242_10165807 3300009176 Bacteria 1938
211 Ga0105242_10572011 3300009176 Bacteria 1087
212 Ga0105248_10080383 3300009177 Bacteria 3664
213 Ga0105248_10199240 3300009177 Bacteria 2256
214 Ga0105237_10072649 3300009545 Bacteria 3434
215 Ga0105238_10005424 3300009551 Bacteria 12598
216 Ga0105238_10023960 3300009551 Bacteria 6222
217 Ga0105238_10028177 3300009551 Bacteria 5723
218 Ga0105249_10003833 3300009553 Bacteria 12976
219 Ga0105249_10118212 3300009553 Bacteria 2516
220 Ga0105249_10139158 3300009553 Bacteria 2326
221 Ga0105239_10110942 3300010375 Bacteria 3040
222 Ga0105239_10316419 3300010375 Bacteria 1759
223 Ga0105246_10004873 3300011119 Bacteria 8178
224 Ga0105246_10005282 3300011119 Bacteria 7859
225 Ga0157371_10165552 3300013102 Bacteria 1579
226 Ga0157370_10034555 3300013104 Bacteria 4920
227 Ga0157369_10042338 3300013105 Bacteria 4968
228 Ga0157369_10098405 3300013105 Bacteria 3120
229 Ga0157374_10006355 3300013296 Bacteria 10025
230 Ga0157374_10131411 3300013296 Bacteria 2423
231 Ga0163162_10065255 3300013306 Bacteria 3687
232 Ga0163162_10193734 3300013306 Bacteria 2160
233 Ga0163162_10497588 3300013306 Bacteria 1349
234 Ga0157372_10025827 3300013307 Bacteria 6388
235 Ga0157372_10031201 3300013307 Bacteria 5835
236 Ga0157372_10049481 3300013307 Bacteria 4673
237 Ga0157372_10056335 3300013307 Bacteria 4392
238 Ga0157372_10392538 3300013307 Bacteria 1617
239 Ga0157375_10019870 3300013308 Bacteria 6123
240 Ga0157375_10090423 3300013308 Bacteria 3120
241 Ga0157375_10312405 3300013308 Bacteria 1736
242 Ga0157380_10076674 3300014326 Bacteria 2722
243 Ga0157377_10002213 3300014745 Bacteria 8546
244 Ga0157377_10077639 3300014745 Bacteria 1934
245 Ga0157379_10027726 3300014968 Bacteria 5042
246 Ga0157379_10091082 3300014968 Bacteria 2735
247 Ga0157376_10056472 3300014969 Bacteria 3280
248 Ga0206350_10446008 3300020080 Bacteria 1578
249 Ga0206354_11046704 3300020081 Bacteria 2149
250 Ga0206353_10712527 3300020082 Bacteria 2465
251 Ga0207656_10017778 3300025321 Bacteria 2790
252 Ga0207692_10000005 3300025898 Bacteria 370169
253 Ga0207688_10001553 3300025901 Bacteria 12080
254 Ga0207688_10007739 3300025901 Bacteria 5852
255 Ga0207688_10017211 3300025901 Bacteria 3927
256 Ga0207688_10029668 3300025901 Bacteria 3012
257 Ga0207688_10038782 3300025901 Bacteria 2645
258 Ga0207688_10038988 3300025901 Bacteria 2639
259 Ga0207688_10089694 3300025901 Bacteria 1764
260 Ga0207647_10046087 3300025904 Bacteria 2717
261 Ga0207685_10003722 3300025905 Bacteria 3756
262 Ga0207699_10173291 3300025906 Bacteria 1445
263 Ga0207643_10055277 3300025908 Bacteria 2257
264 Ga0207705_10034442 3300025909 Bacteria 3621
265 Ga0207654_10059151 3300025911 Bacteria 2234
266 Ga0207707_10004145 3300025912 Bacteria 12836
267 Ga0207707_10300819 3300025912 Bacteria 1387
268 Ga0207671_10002598 3300025914 Bacteria 19077
269 Ga0207671_10123956 3300025914 Bacteria 1977
270 Ga0207693_10000009 3300025915 Bacteria 168990
271 Ga0207693_10000677 3300025915 Bacteria 30611
272 Ga0207693_10023429 3300025915 Bacteria 4902
273 Ga0207693_10070645 3300025915 Bacteria 2732
274 Ga0207663_10000923 3300025916 Bacteria 13422
275 Ga0207663_10073810 3300025916 Bacteria 2209
276 Ga0207660_10016594 3300025917 Bacteria 4877
277 Ga0207660_10064262 3300025917 Bacteria 2649
278 Ga0207660_10270672 3300025917 Bacteria 1346
279 Ga0207662_10046814 3300025918 Bacteria 2560
280 Ga0207662_10162044 3300025918 Bacteria 1429
281 Ga0207662_10207557 3300025918 Bacteria 1270
282 Ga0207657_10003779 3300025919 Bacteria 16095
283 Ga0207657_10008221 3300025919 Bacteria 10622
284 Ga0207657_10010856 3300025919 Bacteria 9060
285 Ga0207657_10056990 3300025919 Bacteria 3370
286 Ga0207649_10023612 3300025920 Bacteria 3564
287 Ga0207652_10019049 3300025921 Bacteria 5637
288 Ga0207681_10008907 3300025923 Bacteria 6127
289 Ga0207694_10032291 3300025924 Bacteria 4006
290 Ga0207694_10065931 3300025924 Bacteria 2824
291 Ga0207694_10234359 3300025924 Bacteria 1499
292 Ga0207659_10024972 3300025926 Bacteria 4011
293 Ga0207659_10149866 3300025926 Bacteria 1820
294 Ga0207687_10021202 3300025927 Bacteria 4316
295 Ga0207687_10021270 3300025927 Bacteria 4309
296 Ga0207687_10024845 3300025927 Bacteria 4005
297 Ga0207687_10033628 3300025927 Bacteria 3478
298 Ga0207687_10158762 3300025927 Bacteria 1733
299 Ga0207687_10180603 3300025927 Bacteria 1635
300 Ga0207664_10020701 3300025929 Bacteria 4882
301 Ga0207664_10025169 3300025929 Bacteria 4479
302 Ga0207664_10145218 3300025929 Bacteria 2011
303 Ga0207690_10000117 3300025932 Bacteria 65570
304 Ga0207690_10022756 3300025932 Bacteria 3902
305 Ga0207690_10025889 3300025932 Bacteria 3690
306 Ga0207690_10406397 3300025932 Bacteria 1087
307 Ga0207706_10036331 3300025933 Bacteria 4376
308 Ga0207706_10074834 3300025933 Bacteria 2978
309 Ga0207686_10080861 3300025934 Bacteria 2119
310 Ga0207686_10230988 3300025934 Bacteria 1341
311 Ga0207709_10005840 3300025935 Bacteria 6958
312 Ga0207709_10110145 3300025935 Bacteria 1839
313 Ga0207709_10126245 3300025935 Bacteria 1736
314 Ga0207709_10247100 3300025935 Bacteria 1301
315 Ga0207670_10160274 3300025936 Bacteria 1679
316 Ga0207669_10038693 3300025937 Bacteria 2749
317 Ga0207669_10076194 3300025937 Bacteria 2128
318 Ga0207669_10107922 3300025937 Bacteria 1858
319 Ga0207665_10011859 3300025939 Bacteria 5724
320 Ga0207665_10103539 3300025939 Bacteria 1991
321 Ga0207665_10326612 3300025939 Bacteria 1153
322 Ga0207691_10013609 3300025940 Bacteria 7776
323 Ga0207691_10399733 3300025940 Bacteria 1172
324 Ga0207711_10036972 3300025941 Bacteria 4144
325 Ga0207711_10264528 3300025941 Bacteria 1581
326 Ga0207689_10040927 3300025942 Bacteria 3834
327 Ga0207689_10127255 3300025942 Bacteria 2095
328 Ga0207689_10168900 3300025942 Bacteria 1803
329 Ga0207661_10006000 3300025944 Bacteria 8578
330 Ga0207661_10369603 3300025944 Bacteria 1296
331 Ga0207667_10009530 3300025949 Bacteria 11426
332 Ga0207651_10023152 3300025960 Bacteria 3814
333 Ga0207651_10084276 3300025960 Bacteria 2302
334 Ga0207712_10053320 3300025961 Bacteria 2836
335 Ga0207712_10083145 3300025961 Bacteria 2336
336 Ga0207668_10029600 3300025972 Bacteria 3590
337 Ga0207668_10435735 3300025972 Bacteria 1115
338 Ga0207640_10063200 3300025981 Bacteria 2459
339 Ga0207640_10166235 3300025981 Bacteria 1638
340 Ga0207640_10168167 3300025981 Bacteria 1630
341 Ga0207658_10139516 3300025986 Bacteria 1960
342 Ga0207677_10019594 3300026023 Bacteria 4090
343 Ga0207677_10048251 3300026023 Bacteria 2866
344 Ga0207677_10099408 3300026023 Bacteria 2136
345 Ga0207677_10177324 3300026023 Bacteria 1673
346 Ga0207703_10031376 3300026035 Bacteria 4201
347 Ga0207703_10207607 3300026035 Bacteria 1744
348 Ga0207639_10011957 3300026041 Bacteria 6039
349 Ga0207639_10102459 3300026041 Bacteria 2317
350 Ga0207639_10420039 3300026041 Bacteria 1209
351 Ga0207678_10033655 3300026067 Bacteria 4464
352 Ga0207678_10318092 3300026067 Bacteria 1339
353 Ga0207708_10000144 3300026075 Bacteria 56710
354 Ga0207708_10017396 3300026075 Bacteria 5412
355 Ga0207708_10040352 3300026075 Bacteria 3559
356 Ga0207708_10042499 3300026075 Bacteria 3465
357 Ga0207708_10050119 3300026075 Bacteria 3179
358 Ga0207702_10006854 3300026078 Bacteria 9769
359 Ga0207702_10011114 3300026078 Bacteria 7514
360 Ga0207702_10419561 3300026078 Bacteria 1294
361 Ga0207648_10013626 3300026089 Bacteria 7549
362 Ga0207648_10029561 3300026089 Bacteria 4859
363 Ga0207648_10092619 3300026089 Bacteria 2642
364 Ga0207676_10070542 3300026095 Bacteria 2802
365 Ga0207676_10392776 3300026095 Bacteria 1294
366 Ga0207674_10048068 3300026116 Bacteria 4370
367 Ga0207674_10079071 3300026116 Bacteria 3293
368 Ga0207674_10112077 3300026116 Bacteria 2702
369 Ga0207674_10150976 3300026116 Bacteria 2281
370 Ga0207675_100059882 3300026118 Bacteria 3554
371 Ga0207675_100476186 3300026118 Bacteria 1240
372 Ga0207683_10049732 3300026121 Bacteria 3671
373 Ga0207683_10067654 3300026121 Bacteria 3152
374 Ga0207683_10239541 3300026121 Bacteria 1655
375 Ga0207683_10266811 3300026121 Bacteria 1563
376 Ga0207698_10010173 3300026142 Bacteria 6029
377 Ga0207698_10075761 3300026142 Bacteria 2690
378 Ga0207698_10227370 3300026142 Bacteria 1691
379 Ga0207428_10031421 3300027907 Bacteria 4379
380 Ga0207428_10194245 3300027907 Bacteria 1529
381 Ga0207428_10397494 3300027907 Bacteria 1009
382 Ga0268266_10083156 3300028379 Bacteria 2794
383 Ga0268265_10128993 3300028380 Bacteria 2098
384 Ga0307408_100219996 3300031548 Bacteria 1549
385 Ga0307405_10141401 3300031731 Bacteria 1679
386 Ga0307413_10281500 3300031824 Bacteria 1251
387 Ga0307410_10074333 3300031852 Bacteria 2366
388 Ga0307410_10099595 3300031852 Bacteria 2081
389 Ga0307410_10416688 3300031852 Bacteria 1088
390 Ga0307410_10498983 3300031852 Bacteria 1001
391 Ga0307406_10011316 3300031901 Bacteria 5061
392 Ga0307406_10015221 3300031901 Bacteria 4446
393 Ga0307406_10022093 3300031901 Bacteria 3772
394 Ga0307407_10115833 3300031903 Bacteria 1690
395 Ga0307407_10122250 3300031903 Bacteria 1652
396 Ga0307412_10110799 3300031911 Bacteria 1959
397 Ga0307412_10239301 3300031911 Bacteria 1403
398 Ga0307409_100006140 3300031995 Bacteria 7026
399 Ga0307409_100012655 3300031995 Bacteria 5387
400 Ga0307409_100017381 3300031995 Bacteria 4792
401 Ga0307409_100035690 3300031995 Bacteria 3646
402 Ga0307409_100058844 3300031995 Bacteria 2987
403 Ga0307409_100731779 3300031995 Bacteria 991
404 Ga0307416_100039385 3300032002 Bacteria 3658
405 Ga0307416_100060389 3300032002 Bacteria 3087
406 Ga0307416_100303348 3300032002 Bacteria 1589
407 Ga0307416_100448243 3300032002 Bacteria 1342
408 Ga0307416_100587841 3300032002 Bacteria 1191
409 Ga0307414_10022264 3300032004 Bacteria 3994
410 Ga0307414_10227233 3300032004 Bacteria 1536
411 Ga0307411_10031520 3300032005 Bacteria 3263
412 Ga0307411_10099204 3300032005 Bacteria 2055
413 Ga0307415_100011611 3300032126 Bacteria 5051
414 Ga0307415_100019604 3300032126 Bacteria 4111
415 Ga0307415_100033263 3300032126 Bacteria 3346
416 Ga0307415_100188307 3300032126 Bacteria 1626
417 Ga0307415_100398446 3300032126 Bacteria 1174
418 Ga0373959_0045130 3300034820 Bacteria 937
419 Ga0373934_0049208 3300035086 Bacteria 1669
420 Ga0373932_0031565 3300035112 Bacteria 1477
421 Ga0373936_0009851 3300035113 Bacteria 3606
422 Ga0373954_0069833 3300035118 Bacteria 1668
423 Ga0373960_0016150 3300035121 Bacteria 1917
424 Ga0373943_0170746 3300035170 Bacteria 1190
425 Ga0373946_0008723 3300035171 Bacteria 3722
426 Ga0316574_0165461 3300035398 Bacteria 1424
427 Ga0373931_0053879 3300035691 Bacteria 2148
428 Ga0373933_0013238 3300035724 Bacteria 4570
429 Ga0373933_0067728 3300035724 Bacteria 2167
430 Ga0373947_0055033 3300035725 Bacteria 2402
431 Ga0373937_0022802 3300036401 Bacteria 5632
432 Ga0373937_0188724 3300036401 Bacteria 1936
433 Ga0373925_0005631 3300037068 Bacteria 9318
434 Ga0395898_0083790 3300037466 Bacteria 3073
435 Ga0395898_0124830 3300037466 Bacteria 2466
436 Ga0395898_0147321 3300037466 Bacteria 2253
437 Ga0395898_0177416 3300037466 Bacteria 2036
438 Ga0395898_0233643 3300037466 Bacteria 1753
439 Ga0395901_0009881 3300038443 Bacteria 9672
440 Ga0395901_0053969 3300038443 Bacteria 4177
441 Ga0451843_1319959 3300041509 Bacteria 1129
442 Ga0439455_0020927 3300042012 Bacteria 1555
443 Ga0466972_0109468 3300044658 Bacteria 1306
444 Ga0466966_0101772 3300044684 Bacteria 1776
445 Ga0466963_0150345 3300044694 Bacteria 1616
446 Ga0466968_0056779 3300044735 Bacteria 1682
447 Ga0466957_0042969 3300044842 Bacteria 2735
448 Ga0466960_0000174 3300044901 Bacteria 22018
449 Ga0466959_0179553 3300045049 Bacteria 1481
450 Ga0466958_0031892 3300045836 Bacteria 3132
451 Ga0466967_0038279 3300045976 Bacteria 4111
452 Ga0466967_0054442 3300045976 Bacteria 3521
453 Ga0466967_0289579 3300045976 Bacteria 1573
454 Ga0466967_0295385 3300045976 Bacteria 1558
455 Ga0466967_0342291 3300045976 Bacteria 1446
456 Ga0495603_0146233 3300046455 Bacteria 1374
457 Ga0495629_0100205 3300046459 Bacteria 2022
458 Ga0495641_0001756 3300046461 Bacteria 18044
459 Ga0495641_0012982 3300046461 Bacteria 4613
460 Ga0495653_0001652 3300046463 Bacteria 17517
461 Ga0495653_0103366 3300046463 Bacteria 2060
462 Ga0495650_0000055 3300046471 Bacteria 308438
463 Ga0495582_0001910 3300046473 Bacteria 11714
464 Ga0495582_0188450 3300046473 Bacteria 1176
465 Ga0495584_0037880 3300046491 Bacteria 2438
466 Ga0495584_0046639 3300046491 Bacteria 2186
467 Ga0495594_0013912 3300046499 Bacteria 4210
468 Ga0495607_0079110 3300046501 Bacteria 1812
469 Ga0495608_0004420 3300046511 Bacteria 10069
470 Ga0495618_0000275 3300046514 Bacteria 37279
471 Ga0495630_0000383 3300046517 Bacteria 34741
472 Ga0495630_0293037 3300046517 Bacteria 1243
473 Ga0495642_0099935 3300046528 Bacteria 1234
474 Ga0495642_0107161 3300046528 Bacteria 1193
475 Ga0495652_0309001 3300046529 Bacteria 1146
476 Ga0495665_0005873 3300046531 Bacteria 6615
477 Ga0495640_0009765 3300046533 Bacteria 7454
478 Ga0495587_0048849 3300046536 Bacteria 2505
479 Ga0495645_0000055 3300046543 Bacteria 82861
480 Ga0495645_0004740 3300046543 Bacteria 9297
481 Ga0495634_0002112 3300046642 Bacteria 16780
482 Ga0495588_0119533 3300046674 Bacteria 1389
483 Ga0495657_0000013 3300046675 Bacteria 195590
484 Ga0495657_0116321 3300046675 Bacteria 1688
485 Ga0495599_0093005 3300046678 Bacteria 1881
486 Ga0495623_0059210 3300046679 Bacteria 2406
487 Ga0495646_0109692 3300046680 Bacteria 1572
488 Ga0495658_0094478 3300046683 Bacteria 1776
489 Ga0495613_0018875 3300046689 Bacteria 5137
490 Ga0495613_0135268 3300046689 Bacteria 1764
491 Ga0495624_0005867 3300046690 Bacteria 8782
492 Ga0495670_0080011 3300046691 Bacteria 1664
493 Ga0495600_0005156 3300046809 Bacteria 7855
494 Ga0495581_0011509 3300047315 Bacteria 5119
495 Ga0495604_0059967 3300047317 Bacteria 2915
496 Ga0495604_0063123 3300047317 Bacteria 2826
497 Ga0495674_0038746 3300047319 Bacteria 4276
498 Ga0495674_0101617 3300047319 Bacteria 2446
499 Ga0495674_0103411 3300047319 Bacteria 2421
500 Ga0495672_0110334 3300047320 Bacteria 1477
501 Ga0495676_0009683 3300047321 Bacteria 8760
502 Ga0495676_0067715 3300047321 Bacteria 2761
503 Ga0495680_0077905 3300047322 Bacteria 2509
504 Ga0495684_0005578 3300047471 Bacteria 9802
505 Ga0495684_0012288 3300047471 Bacteria 6604
506 Ga0495593_0012033 3300047673 Bacteria 4959
507 Ga0495602_0238271 3300048088 Bacteria 1362
508 Ga0495614_0100680 3300048089 Bacteria 1263
509 Ga0496100_0002167 3300048903 Bacteria 9890
510 Ga0496100_0011204 3300048903 Bacteria 5097
511 Ga0496100_0032264 3300048903 Bacteria 3264
512 Ga0496100_0098436 3300048903 Bacteria 2010
513 Ga0496100_0101786 3300048903 Bacteria 1981
514 Ga0496101_0006752 3300048904 Bacteria 7403
515 Ga0496101_0011824 3300048904 Bacteria 5806
516 Ga0496101_0026891 3300048904 Bacteria 4001
517 Ga0496101_0038877 3300048904 Bacteria 3380
518 Ga0496101_0039470 3300048904 Bacteria 3358
519 Ga0496101_0146541 3300048904 Bacteria 1803
520 Ga0496101_0383043 3300048904 Bacteria 1106
521 Ga0496102_0022208 3300048905 Bacteria 5620
522 Ga0496102_0033117 3300048905 Bacteria 4643
523 Ga0496102_0042276 3300048905 Bacteria 4130
524 Ga0496102_0042518 3300048905 Bacteria 4118
525 Ga0496102_0054325 3300048905 Bacteria 3652
526 Ga0496102_0111015 3300048905 Bacteria 2556
527 Ga0496102_0439328 3300048905 Bacteria 1224
528 Ga0496103_0003871 3300048906 Bacteria 9110
529 Ga0496104_0009675 3300048907 Bacteria 8588
530 Ga0496104_0021058 3300048907 Bacteria 5981
531 Ga0496104_0078185 3300048907 Bacteria 3152
532 Ga0496104_0095259 3300048907 Bacteria 2848
533 Ga0496104_0358553 3300048907 Bacteria 1370
534 Ga0496105_0007598 3300048908 Bacteria 8404
535 Ga0496105_0008495 3300048908 Bacteria 7976
536 Ga0496105_0009077 3300048908 Bacteria 7756
537 Ga0496105_0113541 3300048908 Bacteria 2235
538 Ga0496106_0014712 3300048909 Bacteria 5784
539 Ga0496106_0015042 3300048909 Bacteria 5726
540 Ga0496106_0023269 3300048909 Bacteria 4602
541 Ga0496106_0026304 3300048909 Bacteria 4332
542 Ga0496106_0039874 3300048909 Bacteria 3516
543 Ga0496106_0077830 3300048909 Bacteria 2543
544 Ga0496106_0219337 3300048909 Bacteria 1517
545 Ga0496106_0417143 3300048909 Bacteria 1079
546 Ga0496106_0493712 3300048909 Bacteria 983
547 Ga0496107_0000676 3300048910 Bacteria 19307
548 Ga0496107_0000968 3300048910 Bacteria 17040
549 Ga0496107_0011247 3300048910 Bacteria 6228
550 Ga0496107_0015369 3300048910 Bacteria 5364
551 Ga0496107_0018306 3300048910 Bacteria 4932
552 Ga0496107_0049358 3300048910 Bacteria 3033
553 Ga0496107_0063448 3300048910 Bacteria 2677
554 Ga0496107_0117311 3300048910 Bacteria 1960
555 Ga0496107_0172955 3300048910 Bacteria 1603
556 Ga0496107_0299641 3300048910 Bacteria 1196
557 Ga0496108_0006986 3300048911 Bacteria 9137
558 Ga0496108_0007007 3300048911 Bacteria 9129
559 Ga0496108_0008398 3300048911 Bacteria 8378
560 Ga0496108_0024246 3300048911 Bacteria 4995
561 Ga0496108_0024404 3300048911 Bacteria 4978
562 Ga0496108_0027324 3300048911 Bacteria 4710
563 Ga0496108_0157546 3300048911 Bacteria 1961
564 Ga0496109_0003243 3300048912 Bacteria 13555
565 Ga0496109_0010650 3300048912 Bacteria 7865
566 Ga0496109_0015282 3300048912 Bacteria 6684
567 Ga0496109_0025326 3300048912 Bacteria 5286
568 Ga0496109_0036413 3300048912 Bacteria 4441
569 Ga0496109_0041860 3300048912 Bacteria 4149
570 Ga0496109_0064843 3300048912 Bacteria 3343
571 Ga0496109_0098725 3300048912 Bacteria 2707
572 Ga0496109_0125036 3300048912 Bacteria 2397
573 Ga0496109_0179980 3300048912 Bacteria 1985
574 Ga0496109_0299880 3300048912 Bacteria 1515
575 Ga0496109_0411686 3300048912 Bacteria 1277
576 Ga0496110_0000249 3300048913 Bacteria 34963
577 Ga0496110_0006837 3300048913 Bacteria 9067
578 Ga0496110_0015865 3300048913 Bacteria 6281
579 Ga0496110_0019361 3300048913 Bacteria 5725
580 Ga0496110_0022529 3300048913 Bacteria 5350
581 Ga0496110_0070941 3300048913 Bacteria 3088
582 Ga0496110_0117161 3300048913 Bacteria 2398
583 Ga0496110_0177265 3300048913 Bacteria 1935
584 Ga0496110_0224482 3300048913 Bacteria 1708
585 Ga0496111_0007128 3300048914 Bacteria 7303
586 Ga0496111_0008400 3300048914 Bacteria 6831
587 Ga0496111_0008466 3300048914 Bacteria 6812
588 Ga0496111_0017764 3300048914 Bacteria 4919
589 Ga0496111_0023258 3300048914 Bacteria 4350
590 Ga0496111_0045772 3300048914 Bacteria 3148
591 Ga0496111_0052043 3300048914 Bacteria 2956
592 Ga0496111_0082506 3300048914 Bacteria 2348
593 Ga0496111_0122108 3300048914 Bacteria 1924
594 Ga0496112_0005086 3300048915 Bacteria 11301
595 Ga0496112_0012867 3300048915 Bacteria 7702
596 Ga0496112_0013233 3300048915 Bacteria 7612
597 Ga0496112_0020728 3300048915 Bacteria 6236
598 Ga0496112_0027218 3300048915 Bacteria 5513
599 Ga0496112_0035922 3300048915 Bacteria 4830
600 Ga0496112_0057311 3300048915 Bacteria 3835
601 Ga0496112_0060568 3300048915 Bacteria 3730
602 Ga0496112_0209138 3300048915 Bacteria 1909
603 Ga0496112_0407770 3300048915 Bacteria 1298
604 Ga0496113_0001761 3300048916 Bacteria 12286
605 Ga0496113_0005823 3300048916 Bacteria 7731
606 Ga0496113_0009943 3300048916 Bacteria 6268
607 Ga0496113_0012175 3300048916 Bacteria 5773
608 Ga0496113_0025680 3300048916 Bacteria 4202
609 Ga0496113_0030345 3300048916 Bacteria 3914
610 Ga0496113_0039799 3300048916 Bacteria 3461
611 Ga0496113_0053053 3300048916 Bacteria 3031
612 Ga0496113_0090120 3300048916 Bacteria 2362
613 Ga0496113_0176570 3300048916 Bacteria 1692
614 Ga0496113_0225787 3300048916 Bacteria 1493
615 Ga0496114_0004855 3300048917 Bacteria 10475
616 Ga0496114_0011620 3300048917 Bacteria 7041
617 Ga0496114_0013857 3300048917 Bacteria 6464
618 Ga0496114_0013883 3300048917 Bacteria 6457
619 Ga0496114_0179660 3300048917 Bacteria 1847
620 Ga0496114_0388449 3300048917 Bacteria 1236
621 Ga0496115_0000282 3300048918 Bacteria 43855
622 Ga0496115_0000581 3300048918 Bacteria 28187
623 Ga0496115_0001432 3300048918 Bacteria 17093
624 Ga0496115_0072769 3300048918 Bacteria 2789
625 Ga0496115_0082680 3300048918 Bacteria 2617
626 Ga0496119_0065632 3300048922 Bacteria 2149
627 Ga0496121_0040393 3300048924 Bacteria 4094
628 Ga0496122_0257017 3300048925 Bacteria 972
629 Ga0501031_0112382 3300049568 Bacteria 1779
630 Ga0501032_0081123 3300049569 Bacteria 2158
631 Ga0501034_0098077 3300049571 Bacteria 2926
632 Ga0501034_0303232 3300049571 Bacteria 1533
633 Ga0501034_0315712 3300049571 Bacteria 1496
634 Ga0501036_0213675 3300049572 Bacteria 1620
635 Ga0501036_0261959 3300049572 Bacteria 1448
636 Ga0501036_0446203 3300049572 Bacteria 1078
637 Ga0501037_0071404 3300049573 Bacteria 2525
638 Ga0501039_0218320 3300049575 Bacteria 1499
639 Ga0501040_0130181 3300049576 Bacteria 1769
640 Ga0501046_0053408 3300049580 Bacteria 3183
641 Ga0501048_0015944 3300049582 Bacteria 5544
642 Ga0501048_0329665 3300049582 Bacteria 1087
643 Ga0501067_0022371 3300049583 Bacteria 3498
644 Ga0501067_0156833 3300049583 Bacteria 1268
645 Ga0501068_0073264 3300049584 Bacteria 2092
646 Ga0501069_0012787 3300049585 Bacteria 4469
647 Ga0501069_0019101 3300049585 Bacteria 3703
648 Ga0501070_0077618 3300049586 Bacteria 2748
649 Ga0501070_0189058 3300049586 Bacteria 1693
650 Ga0501071_0131830 3300049587 Bacteria 1857
651 Ga0501071_0135237 3300049587 Bacteria 1834
652 Ga0501072_0070913 3300049588 Bacteria 2752
653 Ga0501072_0251474 3300049588 Bacteria 1407
654 Ga0501072_0256926 3300049588 Bacteria 1391
655 Ga0501072_0324477 3300049588 Bacteria 1223
656 Ga0501074_0046749 3300049590 Bacteria 3129
657 Ga0501074_0244943 3300049590 Bacteria 1275
658 Ga0501074_0408916 3300049590 Bacteria 962
659 Ga0501076_0059543 3300049592 Bacteria 3038
660 Ga0501217_065903 3300049661 Bacteria 977
661 Ga0501080_0049265 3300049742 Bacteria 3921
662 Ga0501081_0093453 3300049743 Bacteria 2118
663 Ga0501035_0146741 3300049822 Bacteria 2048
664 Ga0501044_0191857 3300049823 Bacteria 2005
665 nmdc:mga03n38_38433_c1 3300050490 Bacteria 2070
666 nmdc:mga03n38_94137_c1 3300050490 Bacteria 1432
667 nmdc:mga00v17_263711_c1 3300050491 Bacteria 1118
668 nmdc:mga00v17_263733_c1 3300050491 Bacteria 1118
669 nmdc:mga00v17_58993_c1 3300050491 Bacteria 2353
670 nmdc:mga00v17_91480_c1 3300050491 Bacteria 1911
671 nmdc:mga0yw44_26748_c1 3300050492 Bacteria 3299
672 nmdc:mga0yw44_59410_c1 3300050492 Bacteria 2339
673 nmdc:mga0yw44_87694_c1 3300050492 Bacteria 1962
674 nmdc:mga06z11_32083_c1 3300050494 Bacteria 2558
675 nmdc:mga05p37_157690_c1 3300050507 Bacteria 2773
676 nmdc:mga05p37_29983_c1 3300050507 Bacteria 6637
677 nmdc:mga05p37_43891_c1 3300050507 Bacteria 5500
678 nmdc:mga05p37_541883_c1 3300050507 Bacteria 1327
679 nmdc:mga05p37_8891_c1 3300050507 Bacteria 11867
680 nmdc:mga05p37_936144_c1 3300050507 Bacteria 929
681 nmdc:mga09592_33101_c1 3300050508 Bacteria 4312
682 nmdc:mga09592_4149_c2 3300050508 Bacteria 11364
683 nmdc:mga09592_525199_c1 3300050508 Bacteria 1018
684 nmdc:mga0qj67_13160_c1 3300050509 Bacteria 6247
685 nmdc:mga0qj67_40801_c1 3300050509 Bacteria 3648
686 nmdc:mga06r32_2689_c1 3300050510 Bacteria 15905
687 nmdc:mga06r32_38703_c1 3300050510 Bacteria 4521
688 nmdc:mga06r32_550707_c1 3300050510 Bacteria 1127
689 nmdc:mga08y16_105446_c1 3300050511 Bacteria 2934
690 nmdc:mga08y16_132920_c1 3300050511 Bacteria 2586
691 nmdc:mga08y16_196867_c1 3300050511 Bacteria 2089
692 nmdc:mga08y16_207803_c1 3300050511 Bacteria 2028
693 nmdc:mga0n895_1093_c1 3300050512 Bacteria 19814
694 nmdc:mga0n895_136566_c1 3300050512 Bacteria 2479
695 nmdc:mga0n895_43869_c1 3300050512 Bacteria 4360
696 nmdc:mga0n895_5709_c1 3300050512 Bacteria 10435
697 nmdc:mga0n895_91965_c1 3300050512 Bacteria 3037
698 nmdc:mga0rr50_110528_c1 3300050513 Bacteria 2174
699 nmdc:mga0rr50_339934_c1 3300050513 Bacteria 1261
700 nmdc:mga0rr50_425_c1 3300050513 Bacteria 22784
701 nmdc:mga0rr50_44590_c1 3300050513 Bacteria 3253
702 nmdc:mga08x19_113433_c1 3300050514 Bacteria 1810
703 nmdc:mga08x19_16617_c1 3300050514 Bacteria 4491
704 nmdc:mga0a205_124255_c2 3300050515 Bacteria 1887
705 nmdc:mga0a205_137590_c1 3300050515 Bacteria 2343
706 nmdc:mga0a205_185042_c1 3300050515 Bacteria 1976
707 nmdc:mga0a205_47351_c1 3300050515 Bacteria 4148
708 nmdc:mga0a205_53201_c1 3300050515 Bacteria 3907
709 nmdc:mga0a205_64442_c1 3300050515 Bacteria 3539
710 Ga0495601_0029656 3300053077 Bacteria 3395
711 Ga0495612_0000222 3300053078 Bacteria 24117
712 Ga0495619_0177212 3300053085 Bacteria 1474
713 Ga0500556_0000593 3300053104 Bacteria 23858
714 Ga0500616_0006676 3300053153 Bacteria 7498
715 Ga0500616_0010552 3300053153 Bacteria 5519
716 Ga0500599_010383 3300053736 Bacteria 1231
717 Ga0501082_0004346 3300060353 Bacteria 12388
718 Ga0530510_0014384 3300061734 Bacteria 5580
719 Ga0530510_0116220 3300061734 Bacteria 1961

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005338 Ga0068868_100016773 Ga0068868_1000167732 235
2 3300005339 Ga0070660_100006060 Ga0070660_1000060601 235
3 3300005364 Ga0070673_100121356 Ga0070673_1001213562 235
4 3300005366 Ga0070659_100090951 Ga0070659_1000909513 235
5 3300005434 Ga0070709_10154429 Ga0070709_101544292 235
6 3300005438 Ga0070701_10180337 Ga0070701_101803372 235
7 3300005440 Ga0070705_100181033 Ga0070705_1001810332 235
8 3300005445 Ga0070708_100357294 Ga0070708_1003572942 235
9 3300005456 Ga0070678_100007985 Ga0070678_1000079853 235
10 3300005543 Ga0070672_100346972 Ga0070672_1003469721 235
11 3300005544 Ga0070686_100059709 Ga0070686_1000597092 235
12 3300005547 Ga0070693_100003310 Ga0070693_1000033103 235
13 3300005563 Ga0068855_100015445 Ga0068855_1000154458 235
14 3300005614 Ga0068856_100015647 Ga0068856_1000156475 235
15 3300005617 Ga0068859_100048594 Ga0068859_1000485943 235
16 3300005618 Ga0068864_100048394 Ga0068864_1000483944 235
17 3300005842 Ga0068858_100211165 Ga0068858_1002111652 235
18 3300006028 Ga0070717_10006501 Ga0070717_100065015 235
19 3300006173 Ga0070716_100104670 Ga0070716_1001046702 235
20 3300006175 Ga0070712_100160520 Ga0070712_1001605202 235
21 3300006871 Ga0075434_100000636 Ga0075434_10000063614 235
22 3300006881 Ga0068865_100044283 Ga0068865_1000442833 235
23 3300006914 Ga0075436_100014111 Ga0075436_1000141112 235
24 3300006931 Ga0097620_100048592 Ga0097620_1000485923 235
25 3300007076 Ga0075435_100005632 Ga0075435_1000056322 235
26 3300009093 Ga0105240_10194152 Ga0105240_101941523 235
27 3300009098 Ga0105245_10011861 Ga0105245_100118612 235
28 3300009101 Ga0105247_10016729 Ga0105247_100167293 235
29 3300009176 Ga0105242_10038913 Ga0105242_100389133 235
30 3300009177 Ga0105248_10080383 Ga0105248_100803832 235
31 3300009551 Ga0105238_10005424 Ga0105238_100054245 235
32 3300009553 Ga0105249_10118212 Ga0105249_101182122 235
33 3300011119 Ga0105246_10005282 Ga0105246_100052826 235
34 3300013105 Ga0157369_10098405 Ga0157369_100984052 235
35 3300013306 Ga0163162_10193734 Ga0163162_101937343 235
36 3300013307 Ga0157372_10056335 Ga0157372_100563354 235
37 3300013308 Ga0157375_10312405 Ga0157375_103124052 235
38 3300025901 Ga0207688_10007739 Ga0207688_100077392 235
39 3300025904 Ga0207647_10046087 Ga0207647_100460873 235
40 3300025905 Ga0207685_10003722 Ga0207685_100037222 235
41 3300025906 Ga0207699_10173291 Ga0207699_101732911 235
42 3300025911 Ga0207654_10059151 Ga0207654_100591512 235
43 3300025919 Ga0207657_10003779 Ga0207657_100037799 235
44 3300025924 Ga0207694_10065931 Ga0207694_100659313 235
45 3300025927 Ga0207687_10021202 Ga0207687_100212024 235
46 3300025929 Ga0207664_10145218 Ga0207664_101452182 235
47 3300025933 Ga0207706_10074834 Ga0207706_100748342 235
48 3300025934 Ga0207686_10230988 Ga0207686_102309882 235
49 3300025935 Ga0207709_10126245 Ga0207709_101262452 235
50 3300025939 Ga0207665_10011859 Ga0207665_100118593 235
51 3300025940 Ga0207691_10399733 Ga0207691_103997331 235
52 3300025941 Ga0207711_10264528 Ga0207711_102645282 235
53 3300025949 Ga0207667_10009530 Ga0207667_100095304 235
54 3300025960 Ga0207651_10084276 Ga0207651_100842762 235
55 3300026035 Ga0207703_10207607 Ga0207703_102076072 235
56 3300026078 Ga0207702_10006854 Ga0207702_100068545 235
57 3300026078 Ga0207702_10419561 Ga0207702_104195612 235
58 3300026121 Ga0207683_10049732 Ga0207683_100497324 235
59 3300034820 Ga0373959_0045130 Ga0373959_0045130_10_822 235
60 3300035086 Ga0373934_0049208 Ga0373934_0049208_702_1511 235
61 3300035113 Ga0373936_0009851 Ga0373936_0009851_769_1578 235
62 3300035118 Ga0373954_0069833 Ga0373954_0069833_781_1590 235
63 3300035170 Ga0373943_0170746 Ga0373943_0170746_208_1020 235
64 3300035171 Ga0373946_0008723 Ga0373946_0008723_1962_2771 235
65 3300035724 Ga0373933_0013238 Ga0373933_0013238_1920_2729 235
66 3300035725 Ga0373947_0055033 Ga0373947_0055033_462_1271 235
67 3300036401 Ga0373937_0022802 Ga0373937_0022802_18_827 235
68 3300037068 Ga0373925_0005631 Ga0373925_0005631_8272_9081 235
69 3300046461 Ga0495641_0001756 Ga0495641_0001756_4264_5073 235
70 3300046463 Ga0495653_0103366 Ga0495653_0103366_688_1497 235
71 3300046473 Ga0495582_0001910 Ga0495582_0001910_6768_7577 235
72 3300046499 Ga0495594_0013912 Ga0495594_0013912_319_1128 235
73 3300046511 Ga0495608_0004420 Ga0495608_0004420_7222_8031 235
74 3300046517 Ga0495630_0293037 Ga0495630_0293037_192_1001 235
75 3300046531 Ga0495665_0005873 Ga0495665_0005873_1100_1909 235
76 3300046533 Ga0495640_0009765 Ga0495640_0009765_4061_4870 235
77 3300046536 Ga0495587_0048849 Ga0495587_0048849_322_1131 235
78 3300046642 Ga0495634_0002112 Ga0495634_0002112_12563_13372 235
79 3300046674 Ga0495588_0119533 Ga0495588_0119533_303_1112 235
80 3300046675 Ga0495657_0116321 Ga0495657_0116321_80_889 235
81 3300046678 Ga0495599_0093005 Ga0495599_0093005_341_1150 235
82 3300046679 Ga0495623_0059210 Ga0495623_0059210_1383_2192 235
83 3300046680 Ga0495646_0109692 Ga0495646_0109692_414_1223 235
84 3300046689 Ga0495613_0018875 Ga0495613_0018875_390_1199 235
85 3300046690 Ga0495624_0005867 Ga0495624_0005867_7256_8065 235
86 3300046809 Ga0495600_0005156 Ga0495600_0005156_2364_3173 235
87 3300047315 Ga0495581_0011509 Ga0495581_0011509_298_1107 235
88 3300047317 Ga0495604_0063123 Ga0495604_0063123_1993_2802 235
89 3300047319 Ga0495674_0038746 Ga0495674_0038746_1229_2038 235
90 3300047319 Ga0495674_0103411 Ga0495674_0103411_741_1550 235
91 3300047321 Ga0495676_0009683 Ga0495676_0009683_324_1133 235
92 3300047321 Ga0495676_0067715 Ga0495676_0067715_1334_2143 235
93 3300047322 Ga0495680_0077905 Ga0495680_0077905_688_1497 235
94 3300047471 Ga0495684_0005578 Ga0495684_0005578_7501_8310 235
95 3300047673 Ga0495593_0012033 Ga0495593_0012033_2035_2844 235
96 3300048088 Ga0495602_0238271 Ga0495602_0238271_294_1103 235
97 3300048903 Ga0496100_0098436 Ga0496100_0098436_996_1808 235
98 3300048904 Ga0496101_0026891 Ga0496101_0026891_321_1145 235
99 3300048904 Ga0496101_0038877 Ga0496101_0038877_1862_2674 235
100 3300048905 Ga0496102_0439328 Ga0496102_0439328_308_1132 235
101 3300048907 Ga0496104_0078185 Ga0496104_0078185_802_1614 235
102 3300048909 Ga0496106_0015042 Ga0496106_0015042_1724_2548 235
103 3300048909 Ga0496106_0023269 Ga0496106_0023269_2543_3355 235
104 3300048909 Ga0496106_0493712 Ga0496106_0493712_87_899 235
105 3300048910 Ga0496107_0000676 Ga0496107_0000676_16155_16967 235
106 3300048910 Ga0496107_0015369 Ga0496107_0015369_1644_2468 235
107 3300048911 Ga0496108_0008398 Ga0496108_0008398_4996_5820 235
108 3300048912 Ga0496109_0003243 Ga0496109_0003243_7354_8178 235
109 3300048912 Ga0496109_0098725 Ga0496109_0098725_1249_2061 235
110 3300048913 Ga0496110_0000249 Ga0496110_0000249_33845_34657 235
111 3300048913 Ga0496110_0006837 Ga0496110_0006837_1377_2201 235
112 3300048914 Ga0496111_0008466 Ga0496111_0008466_311_1135 235
113 3300048914 Ga0496111_0045772 Ga0496111_0045772_1731_2543 235
114 3300048915 Ga0496112_0005086 Ga0496112_0005086_3118_3930 235
115 3300048915 Ga0496112_0012867 Ga0496112_0012867_5405_6229 235
116 3300048916 Ga0496113_0009943 Ga0496113_0009943_3868_4692 235
117 3300048916 Ga0496113_0025680 Ga0496113_0025680_311_1123 235
118 3300048917 Ga0496114_0011620 Ga0496114_0011620_4885_5709 235
119 3300048917 Ga0496114_0179660 Ga0496114_0179660_696_1508 235
120 3300050512 nmdc:mga0n895_1093_c1 nmdc:mga0n895_1093_c1_16207_17019 235
121 3300050513 nmdc:mga0rr50_425_c1 nmdc:mga0rr50_425_c1_5271_6083 235
122 3300050514 nmdc:mga08x19_16617_c1 nmdc:mga08x19_16617_c1_1885_2697 235
123 3300050515 nmdc:mga0a205_124255_c2 nmdc:mga0a205_124255_c2_226_1038 235
124 3300053085 Ga0495619_0177212 Ga0495619_0177212_101_910 235
125 3300005435 Ga0070714_100018715 Ga0070714_1000187153 236
126 3300025929 Ga0207664_10025169 Ga0207664_100251692 236
127 3300005544 Ga0070686_100120057 Ga0070686_1001200572 239
128 3300005843 Ga0068860_100406954 Ga0068860_1004069542 239
129 3300005535 Ga0070684_100330208 Ga0070684_1003302082 242
130 3300005577 Ga0068857_100203076 Ga0068857_1002030762 242
131 3300005614 Ga0068856_100082171 Ga0068856_1000821711 242
132 3300005614 Ga0068856_100377130 Ga0068856_1003771302 242
133 3300006871 Ga0075434_100015967 Ga0075434_1000159677 242
134 3300006914 Ga0075436_100017851 Ga0075436_1000178513 242
135 3300013296 Ga0157374_10131411 Ga0157374_101314113 242
136 3300020082 Ga0206353_10712527 Ga0206353_107125272 242
137 3300025912 Ga0207707_10300819 Ga0207707_103008191 242
138 3300035724 Ga0373933_0067728 Ga0373933_0067728_1201_2013 242
139 3300036401 Ga0373937_0188724 Ga0373937_0188724_357_1256 242
140 3300044694 Ga0466963_0150345 Ga0466963_0150345_50_862 242
141 3300044842 Ga0466957_0042969 Ga0466957_0042969_1044_1856 242
142 3300045836 Ga0466958_0031892 Ga0466958_0031892_460_1272 242
143 3300045976 Ga0466967_0038279 Ga0466967_0038279_1244_2056 242
144 3300047319 Ga0495674_0101617 Ga0495674_0101617_790_1602 242
145 3300048907 Ga0496104_0358553 Ga0496104_0358553_332_1144 242
146 3300048911 Ga0496108_0006986 Ga0496108_0006986_5527_6339 242
147 3300048912 Ga0496109_0025326 Ga0496109_0025326_136_948 242
148 3300048913 Ga0496110_0224482 Ga0496110_0224482_416_1228 242
149 3300048914 Ga0496111_0052043 Ga0496111_0052043_667_1479 242
150 3300048915 Ga0496112_0035922 Ga0496112_0035922_2838_3650 242
151 3300048917 Ga0496114_0013857 Ga0496114_0013857_4959_5771 242
152 3300049583 Ga0501067_0022371 Ga0501067_0022371_1275_2087 242
153 3300049585 Ga0501069_0019101 Ga0501069_0019101_1404_2216 242
154 3300050512 nmdc:mga0n895_91965_c1 nmdc:mga0n895_91965_c1_1341_2153 242
155 3300050514 nmdc:mga08x19_113433_c1 nmdc:mga08x19_113433_c1_13_825 242
156 3300050515 nmdc:mga0a205_64442_c1 nmdc:mga0a205_64442_c1_1932_2744 242
157 3300005329 Ga0070683_100037483 Ga0070683_1000374833 243
158 3300005336 Ga0070680_100043211 Ga0070680_1000432112 243
159 3300005337 Ga0070682_100050574 Ga0070682_1000505742 243
160 3300005338 Ga0068868_100011835 Ga0068868_1000118354 243
161 3300005340 Ga0070689_100072393 Ga0070689_1000723932 243
162 3300005341 Ga0070691_10044147 Ga0070691_100441472 243
163 3300005345 Ga0070692_10056320 Ga0070692_100563202 243
164 3300005356 Ga0070674_100398636 Ga0070674_1003986361 243
165 3300005365 Ga0070688_100151967 Ga0070688_1001519672 243
166 3300005366 Ga0070659_100007128 Ga0070659_1000071283 243
167 3300005459 Ga0068867_100161951 Ga0068867_1001619512 243
168 3300005535 Ga0070684_100093670 Ga0070684_1000936702 243
169 3300005539 Ga0068853_100367488 Ga0068853_1003674881 243
170 3300005545 Ga0070695_100307511 Ga0070695_1003075112 243
171 3300005546 Ga0070696_100104892 Ga0070696_1001048922 243
172 3300005547 Ga0070693_100004855 Ga0070693_1000048553 243
173 3300005549 Ga0070704_100425733 Ga0070704_1004257331 243
174 3300005563 Ga0068855_100144755 Ga0068855_1001447552 243
175 3300005564 Ga0070664_100011830 Ga0070664_1000118305 243
176 3300005577 Ga0068857_100114993 Ga0068857_1001149932 243
177 3300005615 Ga0070702_100017387 Ga0070702_1000173872 243
178 3300005616 Ga0068852_100028449 Ga0068852_1000284494 243
179 3300006175 Ga0070712_100412302 Ga0070712_1004123022 243
180 3300006237 Ga0097621_100008265 Ga0097621_1000082654 243
181 3300006871 Ga0075434_100063702 Ga0075434_1000637023 243
182 3300006881 Ga0068865_100284557 Ga0068865_1002845572 243
183 3300007076 Ga0075435_100030324 Ga0075435_1000303242 243
184 3300009098 Ga0105245_10062746 Ga0105245_100627463 243
185 3300009174 Ga0105241_10015056 Ga0105241_100150563 243
186 3300009176 Ga0105242_10165807 Ga0105242_101658072 243
187 3300009551 Ga0105238_10028177 Ga0105238_100281772 243
188 3300010375 Ga0105239_10316419 Ga0105239_103164192 243
189 3300013306 Ga0163162_10065255 Ga0163162_100652553 243
190 3300013307 Ga0157372_10025827 Ga0157372_100258274 243
191 3300020080 Ga0206350_10446008 Ga0206350_104460082 243
192 3300020081 Ga0206354_11046704 Ga0206354_110467042 243
193 3300025917 Ga0207660_10064262 Ga0207660_100642622 243
194 3300025934 Ga0207686_10080861 Ga0207686_100808613 243
195 3300025942 Ga0207689_10168900 Ga0207689_101689002 243
196 3300025981 Ga0207640_10168167 Ga0207640_101681672 243
197 3300026023 Ga0207677_10019594 Ga0207677_100195944 243
198 3300026067 Ga0207678_10318092 Ga0207678_103180922 243
199 3300026075 Ga0207708_10042499 Ga0207708_100424993 243
200 3300026078 Ga0207702_10011114 Ga0207702_100111143 243
201 3300026116 Ga0207674_10079071 Ga0207674_100790713 243
202 3300026118 Ga0207675_100476186 Ga0207675_1004761862 243
203 3300026142 Ga0207698_10227370 Ga0207698_102273702 243
204 3300048904 Ga0496101_0383043 Ga0496101_0383043_221_1087 243
205 3300048905 Ga0496102_0042276 Ga0496102_0042276_539_1405 243
206 3300048909 Ga0496106_0077830 Ga0496106_0077830_1637_2503 243
207 3300048910 Ga0496107_0063448 Ga0496107_0063448_887_1753 243
208 3300048913 Ga0496110_0070941 Ga0496110_0070941_1769_2635 243
209 3300048915 Ga0496112_0407770 Ga0496112_0407770_128_925 243
210 3300048916 Ga0496113_0053053 Ga0496113_0053053_582_1379 243
211 3300048917 Ga0496114_0013883 Ga0496114_0013883_536_1402 243
212 3300048918 Ga0496115_0082680 Ga0496115_0082680_245_1111 243
213 3300050512 nmdc:mga0n895_136566_c1 nmdc:mga0n895_136566_c1_423_1289 243
214 3300050513 nmdc:mga0rr50_44590_c1 nmdc:mga0rr50_44590_c1_200_1066 243
215 3300050515 nmdc:mga0a205_47351_c1 nmdc:mga0a205_47351_c1_883_1749 243
216 3300005459 Ga0068867_100079020 Ga0068867_1000790203 244
217 3300005535 Ga0070684_100165382 Ga0070684_1001653822 244
218 3300025901 Ga0207688_10089694 Ga0207688_100896942 244
219 3300025972 Ga0207668_10435735 Ga0207668_104357351 244
220 3300026075 Ga0207708_10050119 Ga0207708_100501192 244
221 3300026089 Ga0207648_10013626 Ga0207648_100136265 244
222 3300045049 Ga0466959_0179553 Ga0466959_0179553_222_1142 247
223 3300048909 Ga0496106_0417143 Ga0496106_0417143_87_887 247
224 3300005437 Ga0070710_10000002 Ga0070710_10000002252 249
225 3300025898 Ga0207692_10000005 Ga0207692_10000005154 249
226 3300005338 Ga0068868_100200232 Ga0068868_1002002322 250
227 3300048910 Ga0496107_0117311 Ga0496107_0117311_343_1176 250
228 3300025944 Ga0207661_10369603 Ga0207661_103696032 251
229 3300048903 Ga0496100_0002167 Ga0496100_0002167_8575_9552 251
230 3300005440 Ga0070705_100002095 Ga0070705_1000020955 252
231 3300005339 Ga0070660_100009392 Ga0070660_1000093924 253
232 3300005439 Ga0070711_100002079 Ga0070711_1000020794 253
233 3300005530 Ga0070679_100156115 Ga0070679_1001561152 253
234 3300025919 Ga0207657_10056990 Ga0207657_100569902 253
235 3300005366 Ga0070659_100000030 Ga0070659_100000030132 254
236 3300005539 Ga0068853_100500022 Ga0068853_1005000222 254
237 3300006038 Ga0075365_10000962 Ga0075365_100009629 254
238 3300025923 Ga0207681_10008907 Ga0207681_100089071 254
239 3300025932 Ga0207690_10000117 Ga0207690_100001176 254
240 3300031852 Ga0307410_10416688 Ga0307410_104166882 254
241 3300031995 Ga0307409_100017381 Ga0307409_1000173813 254
242 3300032126 Ga0307415_100011611 Ga0307415_1000116113 254
243 3300050492 nmdc:mga0yw44_26748_c1 nmdc:mga0yw44_26748_c1_515_1312 254
244 3300005337 Ga0070682_100058674 Ga0070682_1000586743 255
245 3300005338 Ga0068868_100030208 Ga0068868_1000302084 255
246 3300005343 Ga0070687_100056701 Ga0070687_1000567012 255
247 3300005549 Ga0070704_100128137 Ga0070704_1001281372 255
248 3300005718 Ga0068866_10019503 Ga0068866_100195032 255
249 3300005842 Ga0068858_100225716 Ga0068858_1002257162 255
250 3300006846 Ga0075430_100008213 Ga0075430_1000082131 255
251 3300009098 Ga0105245_10061512 Ga0105245_100615123 255
252 3300009148 Ga0105243_10014153 Ga0105243_100141534 255
253 3300011119 Ga0105246_10004873 Ga0105246_100048737 255
254 3300025901 Ga0207688_10038782 Ga0207688_100387822 255
255 3300025927 Ga0207687_10180603 Ga0207687_101806032 255
256 3300026041 Ga0207639_10420039 Ga0207639_104200391 255
257 3300031824 Ga0307413_10281500 Ga0307413_102815002 255
258 3300031852 Ga0307410_10074333 Ga0307410_100743332 255
259 3300031852 Ga0307410_10099595 Ga0307410_100995952 255
260 3300031901 Ga0307406_10011316 Ga0307406_100113164 255
261 3300031903 Ga0307407_10115833 Ga0307407_101158332 255
262 3300031911 Ga0307412_10110799 Ga0307412_101107993 255
263 3300031911 Ga0307412_10239301 Ga0307412_102393012 255
264 3300031995 Ga0307409_100035690 Ga0307409_1000356903 255
265 3300031995 Ga0307409_100731779 Ga0307409_1007317791 255
266 3300032002 Ga0307416_100060389 Ga0307416_1000603894 255
267 3300032004 Ga0307414_10227233 Ga0307414_102272332 255
268 3300032005 Ga0307411_10031520 Ga0307411_100315203 255
269 3300048905 Ga0496102_0054325 Ga0496102_0054325_2321_3223 255
270 3300048912 Ga0496109_0411686 Ga0496109_0411686_303_1205 255
271 3300050508 nmdc:mga09592_4149_c2 nmdc:mga09592_4149_c2_7465_8319 255
272 3300005340 Ga0070689_100173892 Ga0070689_1001738922 256
273 3300005456 Ga0070678_100294040 Ga0070678_1002940402 256
274 3300005548 Ga0070665_100156636 Ga0070665_1001566362 256
275 3300009098 Ga0105245_10000236 Ga0105245_100002363 256
276 3300009101 Ga0105247_10121695 Ga0105247_101216951 256
277 3300009176 Ga0105242_10572011 Ga0105242_105720111 256
278 3300009553 Ga0105249_10139158 Ga0105249_101391583 256
279 3300013306 Ga0163162_10497588 Ga0163162_104975881 256
280 3300013308 Ga0157375_10019870 Ga0157375_100198706 256
281 3300014969 Ga0157376_10056472 Ga0157376_100564723 256
282 3300025935 Ga0207709_10247100 Ga0207709_102471002 256
283 3300026089 Ga0207648_10029561 Ga0207648_100295612 256
284 3300044735 Ga0466968_0056779 Ga0466968_0056779_655_1461 256
285 3300046514 Ga0495618_0000275 Ga0495618_0000275_18062_19012 256
286 3300048903 Ga0496100_0011204 Ga0496100_0011204_349_1152 256
287 3300048904 Ga0496101_0011824 Ga0496101_0011824_1973_2776 256
288 3300048905 Ga0496102_0022208 Ga0496102_0022208_977_1780 256
289 3300048906 Ga0496103_0003871 Ga0496103_0003871_5697_6500 256
290 3300048907 Ga0496104_0021058 Ga0496104_0021058_610_1413 256
291 3300048908 Ga0496105_0009077 Ga0496105_0009077_1316_2119 256
292 3300048909 Ga0496106_0039874 Ga0496106_0039874_1737_2540 256
293 3300048910 Ga0496107_0000968 Ga0496107_0000968_2077_2880 256
294 3300048912 Ga0496109_0041860 Ga0496109_0041860_1449_2252 256
295 3300048913 Ga0496110_0019361 Ga0496110_0019361_4123_4926 256
296 3300048914 Ga0496111_0007128 Ga0496111_0007128_2382_3185 256
297 3300048915 Ga0496112_0027218 Ga0496112_0027218_3414_4217 256
298 3300048916 Ga0496113_0005823 Ga0496113_0005823_1150_1953 256
299 3300048917 Ga0496114_0004855 Ga0496114_0004855_1074_1877 256
300 3300048918 Ga0496115_0001432 Ga0496115_0001432_6206_7009 256
301 3300048925 Ga0496122_0257017 Ga0496122_0257017_54_863 256
302 3300049569 Ga0501032_0081123 Ga0501032_0081123_515_1321 256
303 3300049571 Ga0501034_0303232 Ga0501034_0303232_244_1050 256
304 3300049573 Ga0501037_0071404 Ga0501037_0071404_798_1604 256
305 3300049575 Ga0501039_0218320 Ga0501039_0218320_662_1468 256
306 3300049582 Ga0501048_0015944 Ga0501048_0015944_4657_5463 256
307 3300049584 Ga0501068_0073264 Ga0501068_0073264_1074_1880 256
308 3300049590 Ga0501074_0408916 Ga0501074_0408916_62_868 256
309 3300049822 Ga0501035_0146741 Ga0501035_0146741_256_1062 256
310 3300049823 Ga0501044_0191857 Ga0501044_0191857_1173_1979 256
311 3300053078 Ga0495612_0000222 Ga0495612_0000222_19103_20056 256
312 3300053104 Ga0500556_0000593 Ga0500556_0000593_17509_18318 256
313 3300053153 Ga0500616_0006676 Ga0500616_0006676_1954_2763 256
314 3300053736 Ga0500599_010383 Ga0500599_010383_55_864 256
315 3300060353 Ga0501082_0004346 Ga0501082_0004346_3725_4531 256
316 3300005435 Ga0070714_100130846 Ga0070714_1001308462 257
317 3300006028 Ga0070717_10000006 Ga0070717_100000068 257
318 3300025929 Ga0207664_10020701 Ga0207664_100207014 257
319 3300026023 Ga0207677_10177324 Ga0207677_101773242 257
320 3300026116 Ga0207674_10048068 Ga0207674_100480682 257
321 3300045976 Ga0466967_0342291 Ga0466967_0342291_385_1203 257
322 3300048918 Ga0496115_0000282 Ga0496115_0000282_15828_16658 257
323 3300005981 Ga0081538_10018210 Ga0081538_100182104 258
324 3300006038 Ga0075365_10034978 Ga0075365_100349784 258
325 3300006038 Ga0075365_10189924 Ga0075365_101899242 258
326 3300006051 Ga0075364_10141452 Ga0075364_101414522 258
327 3300025916 Ga0207663_10000923 Ga0207663_100009237 258
328 3300032002 Ga0307416_100303348 Ga0307416_1003033481 258
329 3300045976 Ga0466967_0295385 Ga0466967_0295385_189_1007 258
330 3300048903 Ga0496100_0032264 Ga0496100_0032264_288_1172 258
331 3300048910 Ga0496107_0049358 Ga0496107_0049358_149_991 258
332 3300049571 Ga0501034_0315712 Ga0501034_0315712_356_1189 258
333 3300049583 Ga0501067_0156833 Ga0501067_0156833_37_870 258
334 3300049585 Ga0501069_0012787 Ga0501069_0012787_3139_3972 258
335 3300049586 Ga0501070_0077618 Ga0501070_0077618_1295_2128 258
336 3300049586 Ga0501070_0189058 Ga0501070_0189058_837_1667 258
337 3300049587 Ga0501071_0131830 Ga0501071_0131830_714_1547 258
338 3300049588 Ga0501072_0251474 Ga0501072_0251474_107_940 258
339 3300049588 Ga0501072_0256926 Ga0501072_0256926_160_1083 258
340 3300049590 Ga0501074_0046749 Ga0501074_0046749_1265_2098 258
341 3300049742 Ga0501080_0049265 Ga0501080_0049265_1583_2416 258
342 3300050491 nmdc:mga00v17_263711_c1 nmdc:mga00v17_263711_c1_190_990 258
343 3300050491 nmdc:mga00v17_263733_c1 nmdc:mga00v17_263733_c1_129_929 258
344 3300050491 nmdc:mga00v17_91480_c1 nmdc:mga00v17_91480_c1_154_954 258
345 3300050492 nmdc:mga0yw44_87694_c1 nmdc:mga0yw44_87694_c1_670_1470 258
346 3300005327 Ga0070658_10015503 Ga0070658_100155036 259
347 3300005329 Ga0070683_100110974 Ga0070683_1001109743 259
348 3300005338 Ga0068868_100016431 Ga0068868_1000164312 259
349 3300005339 Ga0070660_100002839 Ga0070660_1000028393 259
350 3300005343 Ga0070687_100154329 Ga0070687_1001543291 259
351 3300005344 Ga0070661_100027674 Ga0070661_1000276743 259
352 3300005345 Ga0070692_10005288 Ga0070692_100052884 259
353 3300005347 Ga0070668_100051335 Ga0070668_1000513351 259
354 3300005354 Ga0070675_100011764 Ga0070675_1000117645 259
355 3300005356 Ga0070674_100013587 Ga0070674_1000135872 259
356 3300005365 Ga0070688_100045380 Ga0070688_1000453803 259
357 3300005366 Ga0070659_100003072 Ga0070659_1000030726 259
358 3300005439 Ga0070711_100058046 Ga0070711_1000580463 259
359 3300005441 Ga0070700_100005075 Ga0070700_1000050755 259
360 3300005466 Ga0070685_10010229 Ga0070685_100102295 259
361 3300005535 Ga0070684_100030701 Ga0070684_1000307013 259
362 3300005543 Ga0070672_100010299 Ga0070672_1000102992 259
363 3300005544 Ga0070686_100031311 Ga0070686_1000313113 259
364 3300005577 Ga0068857_100279007 Ga0068857_1002790072 259
365 3300005578 Ga0068854_100007323 Ga0068854_1000073236 259
366 3300005842 Ga0068858_100100629 Ga0068858_1001006292 259
367 3300006038 Ga0075365_10039533 Ga0075365_100395333 259
368 3300006048 Ga0075363_100004856 Ga0075363_1000048562 259
369 3300009094 Ga0111539_10126830 Ga0111539_101268303 259
370 3300009094 Ga0111539_10177351 Ga0111539_101773512 259
371 3300009098 Ga0105245_10011183 Ga0105245_100111833 259
372 3300009148 Ga0105243_10011229 Ga0105243_100112296 259
373 3300009148 Ga0105243_10053195 Ga0105243_100531952 259
374 3300010375 Ga0105239_10110942 Ga0105239_101109423 259
375 3300014968 Ga0157379_10091082 Ga0157379_100910822 259
376 3300025908 Ga0207643_10055277 Ga0207643_100552773 259
377 3300025918 Ga0207662_10207557 Ga0207662_102075571 259
378 3300025919 Ga0207657_10010856 Ga0207657_100108565 259
379 3300025920 Ga0207649_10023612 Ga0207649_100236122 259
380 3300025924 Ga0207694_10234359 Ga0207694_102343592 259
381 3300025926 Ga0207659_10149866 Ga0207659_101498662 259
382 3300025927 Ga0207687_10033628 Ga0207687_100336283 259
383 3300025932 Ga0207690_10022756 Ga0207690_100227563 259
384 3300025932 Ga0207690_10406397 Ga0207690_104063972 259
385 3300025935 Ga0207709_10005840 Ga0207709_100058404 259
386 3300025935 Ga0207709_10110145 Ga0207709_101101452 259
387 3300025937 Ga0207669_10038693 Ga0207669_100386933 259
388 3300025939 Ga0207665_10326612 Ga0207665_103266122 259
389 3300025940 Ga0207691_10013609 Ga0207691_100136096 259
390 3300025960 Ga0207651_10023152 Ga0207651_100231521 259
391 3300025961 Ga0207712_10083145 Ga0207712_100831451 259
392 3300025972 Ga0207668_10029600 Ga0207668_100296001 259
393 3300025981 Ga0207640_10166235 Ga0207640_101662351 259
394 3300026035 Ga0207703_10031376 Ga0207703_100313762 259
395 3300026041 Ga0207639_10011957 Ga0207639_100119575 259
396 3300026067 Ga0207678_10033655 Ga0207678_100336554 259
397 3300026075 Ga0207708_10017396 Ga0207708_100173965 259
398 3300026116 Ga0207674_10150976 Ga0207674_101509762 259
399 3300027907 Ga0207428_10397494 Ga0207428_103974942 259
400 3300028380 Ga0268265_10128993 Ga0268265_101289931 259
401 3300031548 Ga0307408_100219996 Ga0307408_1002199962 259
402 3300035398 Ga0316574_0165461 Ga0316574_0165461_550_1359 259
403 3300037466 Ga0395898_0124830 Ga0395898_0124830_988_1815 259
404 3300042012 Ga0439455_0020927 Ga0439455_0020927_285_1103 259
405 3300048903 Ga0496100_0101786 Ga0496100_0101786_971_1777 259
406 3300048905 Ga0496102_0111015 Ga0496102_0111015_1343_2149 259
407 3300048909 Ga0496106_0014712 Ga0496106_0014712_303_1109 259
408 3300048910 Ga0496107_0018306 Ga0496107_0018306_3210_4016 259
409 3300048911 Ga0496108_0024246 Ga0496108_0024246_2748_3554 259
410 3300048912 Ga0496109_0064843 Ga0496109_0064843_1948_2754 259
411 3300048913 Ga0496110_0022529 Ga0496110_0022529_281_1087 259
412 3300048914 Ga0496111_0008400 Ga0496111_0008400_4304_5110 259
413 3300048916 Ga0496113_0030345 Ga0496113_0030345_182_988 259
414 3300050490 nmdc:mga03n38_38433_c1 nmdc:mga03n38_38433_c1_623_1429 259
415 3300050491 nmdc:mga00v17_58993_c1 nmdc:mga00v17_58993_c1_302_1108 259
416 3300050492 nmdc:mga0yw44_59410_c1 nmdc:mga0yw44_59410_c1_34_840 259
417 3300050511 nmdc:mga08y16_105446_c1 nmdc:mga08y16_105446_c1_500_1306 259
418 3300053153 Ga0500616_0010552 Ga0500616_0010552_1538_2416 259
419 3300006175 Ga0070712_100000003 Ga0070712_100000003138 260
420 3300025915 Ga0207693_10000009 Ga0207693_1000000946 260
421 3300025918 Ga0207662_10162044 Ga0207662_101620442 260
422 3300046517 Ga0495630_0000383 Ga0495630_0000383_26387_27355 260
423 3300046675 Ga0495657_0000013 Ga0495657_0000013_152841_153809 260
424 3300047320 Ga0495672_0110334 Ga0495672_0110334_296_1150 260
425 3300047471 Ga0495684_0012288 Ga0495684_0012288_2782_3750 260
426 3300048917 Ga0496114_0388449 Ga0496114_0388449_57_911 260
427 3300005334 Ga0068869_100058170 Ga0068869_1000581702 261
428 3300005338 Ga0068868_100018104 Ga0068868_1000181044 261
429 3300005347 Ga0070668_100060266 Ga0070668_1000602662 261
430 3300005347 Ga0070668_100229392 Ga0070668_1002293922 261
431 3300005354 Ga0070675_100044247 Ga0070675_1000442471 261
432 3300005365 Ga0070688_100158909 Ga0070688_1001589091 261
433 3300005366 Ga0070659_100483829 Ga0070659_1004838291 261
434 3300005614 Ga0068856_100072879 Ga0068856_1000728793 261
435 3300005615 Ga0070702_100037221 Ga0070702_1000372212 261
436 3300005616 Ga0068852_100365820 Ga0068852_1003658202 261
437 3300005719 Ga0068861_100176344 Ga0068861_1001763442 261
438 3300005834 Ga0068851_10083152 Ga0068851_100831522 261
439 3300005985 Ga0081539_10005785 Ga0081539_100057857 261
440 3300006844 Ga0075428_100182529 Ga0075428_1001825292 261
441 3300006847 Ga0075431_100016842 Ga0075431_1000168426 261
442 3300006852 Ga0075433_10241478 Ga0075433_102414782 261
443 3300006881 Ga0068865_100021350 Ga0068865_1000213502 261
444 3300009101 Ga0105247_10215442 Ga0105247_102154422 261
445 3300009177 Ga0105248_10199240 Ga0105248_101992402 261
446 3300014326 Ga0157380_10076674 Ga0157380_100766742 261
447 3300025321 Ga0207656_10017778 Ga0207656_100177782 261
448 3300025901 Ga0207688_10017211 Ga0207688_100172113 261
449 3300025901 Ga0207688_10038988 Ga0207688_100389882 261
450 3300025914 Ga0207671_10002598 Ga0207671_100025989 261
451 3300025915 Ga0207693_10023429 Ga0207693_100234293 261
452 3300025916 Ga0207663_10073810 Ga0207663_100738102 261
453 3300025918 Ga0207662_10046814 Ga0207662_100468142 261
454 3300025927 Ga0207687_10021270 Ga0207687_100212702 261
455 3300025927 Ga0207687_10158762 Ga0207687_101587622 261
456 3300025932 Ga0207690_10025889 Ga0207690_100258892 261
457 3300025937 Ga0207669_10107922 Ga0207669_101079222 261
458 3300025941 Ga0207711_10036972 Ga0207711_100369724 261
459 3300025942 Ga0207689_10127255 Ga0207689_101272552 261
460 3300025986 Ga0207658_10139516 Ga0207658_101395162 261
461 3300026075 Ga0207708_10040352 Ga0207708_100403523 261
462 3300026089 Ga0207648_10092619 Ga0207648_100926192 261
463 3300026095 Ga0207676_10070542 Ga0207676_100705422 261
464 3300026118 Ga0207675_100059882 Ga0207675_1000598821 261
465 3300026121 Ga0207683_10067654 Ga0207683_100676542 261
466 3300026121 Ga0207683_10239541 Ga0207683_102395412 261
467 3300026121 Ga0207683_10266811 Ga0207683_102668111 261
468 3300026142 Ga0207698_10075761 Ga0207698_100757613 261
469 3300027907 Ga0207428_10194245 Ga0207428_101942452 261
470 3300032002 Ga0307416_100448243 Ga0307416_1004482432 261
471 3300032126 Ga0307415_100398446 Ga0307415_1003984462 261
472 3300046459 Ga0495629_0100205 Ga0495629_0100205_378_1265 261
473 3300046491 Ga0495584_0046639 Ga0495584_0046639_676_1518 261
474 3300046501 Ga0495607_0079110 Ga0495607_0079110_111_953 261
475 3300046528 Ga0495642_0107161 Ga0495642_0107161_192_1034 261
476 3300046691 Ga0495670_0080011 Ga0495670_0080011_756_1598 261
477 3300048904 Ga0496101_0039470 Ga0496101_0039470_533_1375 261
478 3300048907 Ga0496104_0009675 Ga0496104_0009675_1547_2404 261
479 3300048907 Ga0496104_0095259 Ga0496104_0095259_174_1031 261
480 3300048908 Ga0496105_0008495 Ga0496105_0008495_535_1392 261
481 3300048908 Ga0496105_0113541 Ga0496105_0113541_660_1502 261
482 3300048910 Ga0496107_0299641 Ga0496107_0299641_146_1129 261
483 3300048911 Ga0496108_0007007 Ga0496108_0007007_8211_9053 261
484 3300048911 Ga0496108_0024404 Ga0496108_0024404_643_1485 261
485 3300048912 Ga0496109_0015282 Ga0496109_0015282_2475_3317 261
486 3300048912 Ga0496109_0036413 Ga0496109_0036413_1767_2624 261
487 3300048912 Ga0496109_0125036 Ga0496109_0125036_536_1519 261
488 3300048913 Ga0496110_0015865 Ga0496110_0015865_4534_5376 261
489 3300048914 Ga0496111_0017764 Ga0496111_0017764_1946_2929 261
490 3300048914 Ga0496111_0023258 Ga0496111_0023258_2624_3466 261
491 3300048914 Ga0496111_0122108 Ga0496111_0122108_20_877 261
492 3300048915 Ga0496112_0013233 Ga0496112_0013233_2537_3394 261
493 3300048916 Ga0496113_0001761 Ga0496113_0001761_8602_9444 261
494 3300048916 Ga0496113_0176570 Ga0496113_0176570_669_1652 261
495 3300048918 Ga0496115_0072769 Ga0496115_0072769_1725_2708 261
496 3300050515 nmdc:mga0a205_53201_c1 nmdc:mga0a205_53201_c1_184_1167 261
497 3300005547 Ga0070693_100393552 Ga0070693_1003935521 262
498 3300005983 Ga0081540_1003590 Ga0081540_100359010 262
499 3300005985 Ga0081539_10031344 Ga0081539_100313444 262
500 3300013307 Ga0157372_10392538 Ga0157372_103925382 262
501 3300014968 Ga0157379_10027726 Ga0157379_100277262 262
502 3300025909 Ga0207705_10034442 Ga0207705_100344424 262
503 3300025915 Ga0207693_10070645 Ga0207693_100706452 262
504 3300025919 Ga0207657_10008221 Ga0207657_100082215 262
505 3300025939 Ga0207665_10103539 Ga0207665_101035392 262
506 3300028379 Ga0268266_10083156 Ga0268266_100831562 262
507 3300037466 Ga0395898_0177416 Ga0395898_0177416_835_1686 262
508 3300041509 Ga0451843_1319959 Ga0451843_1319959_104_922 262
509 3300044658 Ga0466972_0109468 Ga0466972_0109468_38_886 262
510 3300044684 Ga0466966_0101772 Ga0466966_0101772_185_1057 262
511 3300044901 Ga0466960_0000174 Ga0466960_0000174_153_1001 262
512 3300046463 Ga0495653_0001652 Ga0495653_0001652_13943_14893 262
513 3300046471 Ga0495650_0000055 Ga0495650_0000055_190705_191574 262
514 3300046543 Ga0495645_0004740 Ga0495645_0004740_2383_3354 262
515 3300048904 Ga0496101_0006752 Ga0496101_0006752_6282_7136 262
516 3300048904 Ga0496101_0146541 Ga0496101_0146541_827_1675 262
517 3300048905 Ga0496102_0042518 Ga0496102_0042518_2983_3837 262
518 3300048909 Ga0496106_0026304 Ga0496106_0026304_625_1479 262
519 3300048909 Ga0496106_0219337 Ga0496106_0219337_455_1321 262
520 3300048910 Ga0496107_0011247 Ga0496107_0011247_5107_5961 262
521 3300048915 Ga0496112_0020728 Ga0496112_0020728_5240_6088 262
522 3300048915 Ga0496112_0060568 Ga0496112_0060568_2658_3524 262
523 3300048915 Ga0496112_0209138 Ga0496112_0209138_485_1351 262
524 3300048916 Ga0496113_0225787 Ga0496113_0225787_363_1211 262
525 3300048918 Ga0496115_0000581 Ga0496115_0000581_21416_22300 262
526 3300048922 Ga0496119_0065632 Ga0496119_0065632_929_1786 262
527 3300048924 Ga0496121_0040393 Ga0496121_0040393_2113_2982 262
528 3300049571 Ga0501034_0098077 Ga0501034_0098077_2030_2878 262
529 3300050510 nmdc:mga06r32_550707_c1 nmdc:mga06r32_550707_c1_166_1014 262
530 3300005337 Ga0070682_100011195 Ga0070682_1000111954 263
531 3300005338 Ga0068868_100089212 Ga0068868_1000892122 263
532 3300005356 Ga0070674_100071502 Ga0070674_1000715023 263
533 3300005437 Ga0070710_10052656 Ga0070710_100526562 263
534 3300005439 Ga0070711_100195817 Ga0070711_1001958172 263
535 3300005544 Ga0070686_100011251 Ga0070686_1000112514 263
536 3300006048 Ga0075363_100068459 Ga0075363_1000684592 263
537 3300006175 Ga0070712_100001897 Ga0070712_1000018979 263
538 3300007076 Ga0075435_100352758 Ga0075435_1003527581 263
539 3300025901 Ga0207688_10029668 Ga0207688_100296681 263
540 3300025915 Ga0207693_10000677 Ga0207693_1000067710 263
541 3300025927 Ga0207687_10024845 Ga0207687_100248454 263
542 3300025936 Ga0207670_10160274 Ga0207670_101602742 263
543 3300025937 Ga0207669_10076194 Ga0207669_100761942 263
544 3300025961 Ga0207712_10053320 Ga0207712_100533202 263
545 3300026023 Ga0207677_10048251 Ga0207677_100482513 263
546 3300046455 Ga0495603_0146233 Ga0495603_0146233_398_1279 263
547 3300046461 Ga0495641_0012982 Ga0495641_0012982_1211_2092 263
548 3300046473 Ga0495582_0188450 Ga0495582_0188450_122_1003 263
549 3300046529 Ga0495652_0309001 Ga0495652_0309001_286_1131 263
550 3300046543 Ga0495645_0000055 Ga0495645_0000055_25855_26784 263
551 3300046683 Ga0495658_0094478 Ga0495658_0094478_35_916 263
552 3300047317 Ga0495604_0059967 Ga0495604_0059967_1784_2629 263
553 3300048910 Ga0496107_0172955 Ga0496107_0172955_665_1531 263
554 3300048912 Ga0496109_0299880 Ga0496109_0299880_83_952 263
555 3300048913 Ga0496110_0177265 Ga0496110_0177265_591_1562 263
556 3300050490 nmdc:mga03n38_94137_c1 nmdc:mga03n38_94137_c1_189_1070 263
557 3300050494 nmdc:mga06z11_32083_c1 nmdc:mga06z11_32083_c1_219_1100 263
558 3300050513 nmdc:mga0rr50_339934_c1 nmdc:mga0rr50_339934_c1_210_1091 263
559 3300053077 Ga0495601_0029656 Ga0495601_0029656_1127_1972 263
560 3300006871 Ga0075434_100006423 Ga0075434_1000064234 264
561 3300037466 Ga0395898_0083790 Ga0395898_0083790_642_1523 266
562 3300038443 Ga0395901_0053969 Ga0395901_0053969_462_1343 266
563 3300045976 Ga0466967_0054442 Ga0466967_0054442_1076_1888 266
564 3300006871 Ga0075434_100054927 Ga0075434_1000549273 267
565 3300007076 Ga0075435_100169154 Ga0075435_1001691542 267
566 3300014745 Ga0157377_10077639 Ga0157377_100776392 267
567 3300046491 Ga0495584_0037880 Ga0495584_0037880_1069_1959 267
568 3300050511 nmdc:mga08y16_207803_c1 nmdc:mga08y16_207803_c1_408_1373 267
569 3300050512 nmdc:mga0n895_43869_c1 nmdc:mga0n895_43869_c1_1844_2809 267
570 3300050515 nmdc:mga0a205_185042_c1 nmdc:mga0a205_185042_c1_352_1215 267
571 3300005334 Ga0068869_100119666 Ga0068869_1001196662 268
572 3300005344 Ga0070661_100025148 Ga0070661_1000251482 268
573 3300005364 Ga0070673_100178412 Ga0070673_1001784122 268
574 3300005441 Ga0070700_100007134 Ga0070700_1000071344 268
575 3300005548 Ga0070665_100468003 Ga0070665_1004680032 268
576 3300005614 Ga0068856_100012430 Ga0068856_1000124308 268
577 3300005616 Ga0068852_100047959 Ga0068852_1000479594 268
578 3300006038 Ga0075365_10051144 Ga0075365_100511442 268
579 3300006175 Ga0070712_100023236 Ga0070712_1000232362 268
580 3300009098 Ga0105245_10000669 Ga0105245_1000066934 268
581 3300013296 Ga0157374_10006355 Ga0157374_100063552 268
582 3300013307 Ga0157372_10049481 Ga0157372_100494814 268
583 3300013308 Ga0157375_10090423 Ga0157375_100904232 268
584 3300014745 Ga0157377_10002213 Ga0157377_100022134 268
585 3300025901 Ga0207688_10001553 Ga0207688_100015534 268
586 3300025926 Ga0207659_10024972 Ga0207659_100249722 268
587 3300025933 Ga0207706_10036331 Ga0207706_100363312 268
588 3300025942 Ga0207689_10040927 Ga0207689_100409274 268
589 3300026023 Ga0207677_10099408 Ga0207677_100994082 268
590 3300026075 Ga0207708_10000144 Ga0207708_1000014446 268
591 3300026095 Ga0207676_10392776 Ga0207676_103927762 268
592 3300048905 Ga0496102_0033117 Ga0496102_0033117_1215_2180 268
593 3300048908 Ga0496105_0007598 Ga0496105_0007598_3272_4237 268
594 3300048911 Ga0496108_0027324 Ga0496108_0027324_555_1520 268
595 3300048912 Ga0496109_0179980 Ga0496109_0179980_283_1248 268
596 3300048913 Ga0496110_0117161 Ga0496110_0117161_159_1124 268
597 3300048915 Ga0496112_0057311 Ga0496112_0057311_1904_2869 268
598 3300048916 Ga0496113_0012175 Ga0496113_0012175_4462_5427 268
599 3300050511 nmdc:mga08y16_132920_c1 nmdc:mga08y16_132920_c1_559_1524 268
600 3300005981 Ga0081538_10003315 Ga0081538_1000331512 269
601 3300006846 Ga0075430_100022815 Ga0075430_1000228154 270
602 3300006846 Ga0075430_100182603 Ga0075430_1001826031 270
603 3300006852 Ga0075433_10038711 Ga0075433_100387114 270
604 3300006880 Ga0075429_100045049 Ga0075429_1000450494 270
605 3300007076 Ga0075435_100107500 Ga0075435_1001075001 270
606 3300009094 Ga0111539_10018708 Ga0111539_100187083 270
607 3300009098 Ga0105245_10002692 Ga0105245_100026927 270
608 3300009147 Ga0114129_10039784 Ga0114129_100397842 270
609 3300009147 Ga0114129_10090382 Ga0114129_100903822 270
610 3300009147 Ga0114129_10165540 Ga0114129_101655403 270
611 3300009553 Ga0105249_10003833 Ga0105249_100038339 270
612 3300025981 Ga0207640_10063200 Ga0207640_100632003 270
613 3300027907 Ga0207428_10031421 Ga0207428_100314214 270
614 3300031731 Ga0307405_10141401 Ga0307405_101414012 270
615 3300031852 Ga0307410_10498983 Ga0307410_104989831 270
616 3300031995 Ga0307409_100058844 Ga0307409_1000588443 270
617 3300032126 Ga0307415_100019604 Ga0307415_1000196043 270
618 3300032126 Ga0307415_100188307 Ga0307415_1001883072 270
619 3300035112 Ga0373932_0031565 Ga0373932_0031565_407_1219 270
620 3300035121 Ga0373960_0016150 Ga0373960_0016150_206_1018 270
621 3300035691 Ga0373931_0053879 Ga0373931_0053879_818_1630 270
622 3300037466 Ga0395898_0147321 Ga0395898_0147321_645_1457 270
623 3300046689 Ga0495613_0135268 Ga0495613_0135268_554_1435 270
624 3300048089 Ga0495614_0100680 Ga0495614_0100680_198_1079 270
625 3300049568 Ga0501031_0112382 Ga0501031_0112382_85_951 270
626 3300049572 Ga0501036_0261959 Ga0501036_0261959_139_1005 270
627 3300049572 Ga0501036_0446203 Ga0501036_0446203_155_967 270
628 3300049580 Ga0501046_0053408 Ga0501046_0053408_681_1493 270
629 3300049582 Ga0501048_0329665 Ga0501048_0329665_195_1007 270
630 3300049587 Ga0501071_0135237 Ga0501071_0135237_617_1429 270
631 3300049588 Ga0501072_0070913 Ga0501072_0070913_513_1379 270
632 3300049590 Ga0501074_0244943 Ga0501074_0244943_327_1193 270
633 3300049592 Ga0501076_0059543 Ga0501076_0059543_740_1606 270
634 3300049743 Ga0501081_0093453 Ga0501081_0093453_597_1409 270
635 3300050507 nmdc:mga05p37_157690_c1 nmdc:mga05p37_157690_c1_361_1227 270
636 3300050507 nmdc:mga05p37_29983_c1 nmdc:mga05p37_29983_c1_4823_5701 270
637 3300050507 nmdc:mga05p37_541883_c1 nmdc:mga05p37_541883_c1_440_1252 270
638 3300050507 nmdc:mga05p37_8891_c1 nmdc:mga05p37_8891_c1_8537_9349 270
639 3300050508 nmdc:mga09592_525199_c1 nmdc:mga09592_525199_c1_23_835 270
640 3300050509 nmdc:mga0qj67_40801_c1 nmdc:mga0qj67_40801_c1_1655_2467 270
641 3300050510 nmdc:mga06r32_2689_c1 nmdc:mga06r32_2689_c1_1731_2609 270
642 3300050511 nmdc:mga08y16_196867_c1 nmdc:mga08y16_196867_c1_1064_1876 270
643 3300050512 nmdc:mga0n895_5709_c1 nmdc:mga0n895_5709_c1_5654_6532 270
644 3300050513 nmdc:mga0rr50_110528_c1 nmdc:mga0rr50_110528_c1_975_1853 270
645 3300050515 nmdc:mga0a205_137590_c1 nmdc:mga0a205_137590_c1_792_1604 270
646 3300061734 Ga0530510_0116220 Ga0530510_0116220_706_1572 270
647 3300031995 Ga0307409_100006140 Ga0307409_1000061405 271
648 3300032004 Ga0307414_10022264 Ga0307414_100222644 271
649 3300032005 Ga0307411_10099204 Ga0307411_100992042 271
650 3300032126 Ga0307415_100033263 Ga0307415_1000332633 271
651 3300049661 Ga0501217_065903 Ga0501217_065903_87_902 271
652 3300050507 nmdc:mga05p37_43891_c1 nmdc:mga05p37_43891_c1_3229_4074 271
653 3300003373 JGI25407J50210_10001587 JGI25407J50210_100015875 272
654 3300005981 Ga0081538_10165775 Ga0081538_101657751 272
655 3300006038 Ga0075365_10044634 Ga0075365_100446341 272
656 3300006847 Ga0075431_100039664 Ga0075431_1000396647 272
657 3300006852 Ga0075433_10273631 Ga0075433_102736312 272
658 3300006871 Ga0075434_100061463 Ga0075434_1000614632 272
659 3300007076 Ga0075435_100214833 Ga0075435_1002148331 272
660 3300009147 Ga0114129_10034007 Ga0114129_100340074 272
661 3300031901 Ga0307406_10015221 Ga0307406_100152213 272
662 3300031901 Ga0307406_10022093 Ga0307406_100220934 272
663 3300031903 Ga0307407_10122250 Ga0307407_101222502 272
664 3300031995 Ga0307409_100012655 Ga0307409_1000126557 272
665 3300032002 Ga0307416_100039385 Ga0307416_1000393852 272
666 3300032002 Ga0307416_100587841 Ga0307416_1005878412 272
667 3300046528 Ga0495642_0099935 Ga0495642_0099935_134_967 272
668 3300049576 Ga0501040_0130181 Ga0501040_0130181_485_1318 272
669 3300050507 nmdc:mga05p37_936144_c1 nmdc:mga05p37_936144_c1_38_859 272
670 3300005458 Ga0070681_10128134 Ga0070681_101281344 273
671 3300005535 Ga0070684_100044176 Ga0070684_1000441765 273
672 3300005614 Ga0068856_100497696 Ga0068856_1004976962 273
673 3300025917 Ga0207660_10270672 Ga0207660_102706722 273
674 3300045976 Ga0466967_0289579 Ga0466967_0289579_556_1389 273
675 3300048916 Ga0496113_0090120 Ga0496113_0090120_1158_1994 273
676 3300000549 LJQas_1004111 LJQas_10041112 274
677 3300005327 Ga0070658_10151055 Ga0070658_101510551 274
678 3300005329 Ga0070683_100028945 Ga0070683_1000289451 274
679 3300005336 Ga0070680_100015319 Ga0070680_1000153192 274
680 3300005339 Ga0070660_100186885 Ga0070660_1001868852 274
681 3300005458 Ga0070681_10002829 Ga0070681_100028296 274
682 3300005530 Ga0070679_100034677 Ga0070679_1000346772 274
683 3300005539 Ga0068853_100040299 Ga0068853_1000402993 274
684 3300005563 Ga0068855_100360871 Ga0068855_1003608712 274
685 3300005564 Ga0070664_100040090 Ga0070664_1000400903 274
686 3300005616 Ga0068852_100002783 Ga0068852_1000027839 274
687 3300005981 Ga0081538_10011600 Ga0081538_100116003 274
688 3300005981 Ga0081538_10014377 Ga0081538_100143776 274
689 3300005983 Ga0081540_1056995 Ga0081540_10569951 274
690 3300006844 Ga0075428_100046970 Ga0075428_1000469706 274
691 3300006846 Ga0075430_100001607 Ga0075430_10000160717 274
692 3300006880 Ga0075429_100017712 Ga0075429_1000177124 274
693 3300009545 Ga0105237_10072649 Ga0105237_100726492 274
694 3300009551 Ga0105238_10023960 Ga0105238_100239603 274
695 3300013102 Ga0157371_10165552 Ga0157371_101655522 274
696 3300013104 Ga0157370_10034555 Ga0157370_100345552 274
697 3300013105 Ga0157369_10042338 Ga0157369_100423383 274
698 3300013307 Ga0157372_10031201 Ga0157372_100312013 274
699 3300025912 Ga0207707_10004145 Ga0207707_100041459 274
700 3300025914 Ga0207671_10123956 Ga0207671_101239562 274
701 3300025917 Ga0207660_10016594 Ga0207660_100165944 274
702 3300025921 Ga0207652_10019049 Ga0207652_100190495 274
703 3300025924 Ga0207694_10032291 Ga0207694_100322914 274
704 3300025944 Ga0207661_10006000 Ga0207661_100060002 274
705 3300026041 Ga0207639_10102459 Ga0207639_101024592 274
706 3300026116 Ga0207674_10112077 Ga0207674_101120772 274
707 3300026142 Ga0207698_10010173 Ga0207698_100101733 274
708 3300037466 Ga0395898_0233643 Ga0395898_0233643_868_1707 274
709 3300038443 Ga0395901_0009881 Ga0395901_0009881_2566_3405 274
710 3300048911 Ga0496108_0157546 Ga0496108_0157546_747_1586 274
711 3300048912 Ga0496109_0010650 Ga0496109_0010650_2786_3625 274
712 3300048914 Ga0496111_0082506 Ga0496111_0082506_74_913 274
713 3300048916 Ga0496113_0039799 Ga0496113_0039799_498_1337 274
714 3300049572 Ga0501036_0213675 Ga0501036_0213675_495_1331 274
715 3300049588 Ga0501072_0324477 Ga0501072_0324477_164_1000 274
716 3300050508 nmdc:mga09592_33101_c1 nmdc:mga09592_33101_c1_2693_3532 274
717 3300050509 nmdc:mga0qj67_13160_c1 nmdc:mga0qj67_13160_c1_3533_4372 274
718 3300050510 nmdc:mga06r32_38703_c1 nmdc:mga06r32_38703_c1_605_1444 274
719 3300061734 Ga0530510_0014384 Ga0530510_0014384_4366_5202 274

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

82

230

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
8tzj-assembly1.cif.gz_A cryo-em structure of vibrio cholerae ftse/ftsx complex 0.9787 25 240
2pcj-assembly1.cif.gz_B crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 0.9585 24 242
8tzj-assembly1.cif.gz_A cryo-em structure of vibrio cholerae ftse/ftsx complex 0.9569 25 240
8idd-assembly1.cif.gz_B cryo-em structure of mycobacterium tuberculosis atp bound ftsex/ripc complex in peptidisc 0.9529 25 244
6z67-assembly3.cif.gz_E ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution 0.9514 24 250
ID Description Score Start End Superfamily
af_P0A9R7_1_220_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.975 26 239 3.40.50.300
af_O05779_1_226_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9679 25 248 3.40.50.300
2pclA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.959 24 242 3.40.50.300
af_P75957_1_229_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9574 24 239 3.40.50.300
af_O05779_1_226_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9553 25 248 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A377TL40-F1-model_v4 Methionine ABC transporter ATP-binding protein (EC 3.6.3.-) 0.973 76 210 GO:0005524
GO:0005886
GO:0016887
AF-A0A3D3VDK4-F1-model_v4 Cell division ATP-binding protein FtsE 0.9716 24 175 GO:0005524
GO:0005886
GO:0016887
GO:0022857
GO:0051301
AF-A0A3A5JIQ6-F1-model_v4 ATP-binding cassette domain-containing protein 0.9655 59 187 GO:0005524
GO:0016887
AF-K1SC20-F1-model_v4 ABC superfamily ATP binding cassette transporter, ABC protein 0.9625 24 220 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-V9Y1K6-F1-model_v4 MacB-like periplasmic core domain protein 0.9578 109 244 GO:0005524
GO:0005886
GO:0016887
GO:0022857

Feature Viewer

pLDDT pTM Quality
83.91 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map