F477221

General Info

Members Datasets Scaffolds Average Seq Length
719 257 1438 155

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100291129|Ga0070708_1002911292
Length 176
Sequence MASANRENDPAAVGGVGEERRSLPPTSMDQMFQRIMRGLVATGRPPHYAELARALGMSVEEGRQLLHALMAAYPIGWLHPETDYIASFPPLNGLPTQYRVTVRGEQKWFAQCGFEATSVTWLFPGETVRIDAPCLDCGDPVTVEMRDGRIVRVDPPEVIGHLNYGFGPSRGRPPYL

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
69 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
70 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
84 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
167 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
168 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
169 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
170 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
171 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
172 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
173 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
174 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
175 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
176 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
177 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
178 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
179 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
180 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
181 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
182 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
183 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
184 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
185 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
186 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
187 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
188 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
189 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
190 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
191 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
192 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
193 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
194 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
195 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
196 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
197 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
198 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
199 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
200 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
201 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
202 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
203 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
204 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
205 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
206 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
207 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
208 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
209 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
210 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
211 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
212 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
213 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
214 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
215 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
216 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
230 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
231 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
232 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
233 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
234 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
235 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
236 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
237 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
238 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
239 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
240 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
241 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
242 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
245 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
246 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
247 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
248 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
249 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
250 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
251 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
252 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
253 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
254 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
255 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
256 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
257 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.39
Rhizosphere 98.61
Stem 0
Stem Tuber 0
Unclassified 15.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100291129 3300005445 Bacteria 1537
2 Ga0065707_10018464 3300005295 Bacteria 1443
3 Ga0065707_10578175 3300005295 Bacteria 694
4 Ga0070676_10000793 3300005328 Bacteria 15592
5 Ga0070683_100024363 3300005329 Bacteria 5420
6 Ga0070690_100143054 3300005330 Bacteria 1625
7 Ga0070670_100013632 3300005331 Bacteria 6966
8 Ga0070677_10347851 3300005333 Bacteria 767
9 Ga0068869_100002053 3300005334 Bacteria 12100
10 Ga0068869_100148103 3300005334 Bacteria 1818
11 Ga0068869_100292000 3300005334 Bacteria 1314
12 Ga0068869_100349529 3300005334 Bacteria 1205
13 Ga0070666_10075368 3300005335 Bacteria 2300
14 Ga0070680_100003802 3300005336 Bacteria 11292
15 Ga0070680_100017250 3300005336 Bacteria 5689
16 Ga0070680_100072817 3300005336 Bacteria 2825
17 Ga0070680_100444876 3300005336 Bacteria 1107
18 Ga0070682_100001673 3300005337 Bacteria 12340
19 Ga0068868_100007767 3300005338 Bacteria 7656
20 Ga0070660_100020417 3300005339 Bacteria 4867
21 Ga0070689_100132521 3300005340 Bacteria 1999
22 Ga0070689_100223605 3300005340 Bacteria 1545
23 Ga0070691_10004693 3300005341 Bacteria 6217
24 Ga0070691_10024899 3300005341 Bacteria 2785
25 Ga0070687_100749844 3300005343 Unclassified 687
26 Ga0070661_100006150 3300005344 Bacteria 8272
27 Ga0070692_10006918 3300005345 Bacteria 4960
28 Ga0070692_10021252 3300005345 Bacteria 3155
29 Ga0070692_10114186 3300005345 Bacteria 1498
30 Ga0070692_10567145 3300005345 Bacteria 746
31 Ga0070668_100203687 3300005347 Bacteria 1625
32 Ga0070669_100013243 3300005353 Bacteria 5862
33 Ga0070669_100092574 3300005353 Bacteria 2269
34 Ga0070669_101500649 3300005353 Unclassified 586
35 Ga0070675_100250854 3300005354 Bacteria 1549
36 Ga0070675_102224869 3300005354 Bacteria 505
37 Ga0070671_100287020 3300005355 Bacteria 1400
38 Ga0070673_100134425 3300005364 Bacteria 2080
39 Ga0070688_100065577 3300005365 Bacteria 2308
40 Ga0070688_100348094 3300005365 Unclassified 1084
41 Ga0070659_100005631 3300005366 Bacteria 9007
42 Ga0070703_10007181 3300005406 Bacteria 3127
43 Ga0070703_10051390 3300005406 Bacteria 1319
44 Ga0070709_10690715 3300005434 Unclassified 793
45 Ga0070701_10006578 3300005438 Bacteria 4899
46 Ga0070701_10694818 3300005438 Bacteria 684
47 Ga0070705_100001541 3300005440 Bacteria 12106
48 Ga0070705_100007899 3300005440 Bacteria 5256
49 Ga0070705_100062121 3300005440 Bacteria 2223
50 Ga0070705_100284831 3300005440 Bacteria 1177
51 Ga0070700_100052430 3300005441 Bacteria 2544
52 Ga0070700_100549883 3300005441 Unclassified 897
53 Ga0070700_100605753 3300005441 Bacteria 859
54 Ga0070694_100002862 3300005444 Bacteria 10250
55 Ga0070694_100004074 3300005444 Bacteria 8763
56 Ga0070694_100022916 3300005444 Bacteria 4008
57 Ga0070694_100023248 3300005444 Bacteria 3984
58 Ga0070694_100075106 3300005444 Bacteria 2337
59 Ga0070694_100547000 3300005444 Unclassified 926
60 Ga0070694_100955748 3300005444 Bacteria 710
61 Ga0070708_100018010 3300005445 Bacteria 5906
62 Ga0070708_100066258 3300005445 Bacteria 3241
63 Ga0070708_100136299 3300005445 Bacteria 2274
64 Ga0070708_100230481 3300005445 Bacteria 1738
65 Ga0070708_100269001 3300005445 Bacteria 1603
66 Ga0070708_101140854 3300005445 Unclassified 730
67 Ga0070663_100001620 3300005455 Bacteria 12414
68 Ga0070678_100386538 3300005456 Bacteria 1212
69 Ga0070662_100004269 3300005457 Bacteria 9017
70 Ga0070662_100420095 3300005457 Unclassified 1106
71 Ga0070681_10150940 3300005458 Bacteria 2250
72 Ga0070681_10287195 3300005458 Bacteria 1555
73 Ga0070681_11040980 3300005458 Bacteria 739
74 Ga0068867_100023047 3300005459 Bacteria 4455
75 Ga0068867_100039866 3300005459 Bacteria 3426
76 Ga0068867_100096419 3300005459 Unclassified 2252
77 Ga0068867_100241416 3300005459 Bacteria 1465
78 Ga0068867_100321122 3300005459 Bacteria 1283
79 Ga0068867_100340277 3300005459 Unclassified 1249
80 Ga0070706_100003379 3300005467 Bacteria 15734
81 Ga0070706_100066029 3300005467 Bacteria 3346
82 Ga0070706_100174594 3300005467 Bacteria 2006
83 Ga0070706_100316621 3300005467 Bacteria 1455
84 Ga0070706_100326142 3300005467 Bacteria 1432
85 Ga0070706_100334368 3300005467 Bacteria 1412
86 Ga0070706_100688034 3300005467 Unclassified 949
87 Ga0070707_100027792 3300005468 Bacteria 5382
88 Ga0070707_100051180 3300005468 Bacteria 3959
89 Ga0070707_100072011 3300005468 Bacteria 3330
90 Ga0070707_100377247 3300005468 Unclassified 1378
91 Ga0070707_100457827 3300005468 Bacteria 1236
92 Ga0070707_100475101 3300005468 Bacteria 1211
93 Ga0070707_100719776 3300005468 Bacteria 961
94 Ga0070707_101135365 3300005468 Unclassified 747
95 Ga0070707_101359028 3300005468 Unclassified 677
96 Ga0070698_100003851 3300005471 Bacteria 16502
97 Ga0070698_100005788 3300005471 Bacteria 13523
98 Ga0070698_100050420 3300005471 Unclassified 4244
99 Ga0070698_100848217 3300005471 Unclassified 858
100 Ga0070699_100007462 3300005518 Bacteria 9515
101 Ga0070699_100056661 3300005518 Bacteria 3394
102 Ga0070699_100077283 3300005518 Bacteria 2898
103 Ga0070699_100115982 3300005518 Bacteria 2353
104 Ga0070699_100294477 3300005518 Bacteria 1455
105 Ga0070699_100519045 3300005518 Unclassified 1083
106 Ga0070679_100007343 3300005530 Bacteria 10297
107 Ga0070684_100002889 3300005535 Bacteria 12766
108 Ga0070697_100009746 3300005536 Bacteria 7492
109 Ga0070697_100014889 3300005536 Bacteria 6104
110 Ga0070697_100016680 3300005536 Bacteria 5778
111 Ga0070697_100224848 3300005536 Bacteria 1600
112 Ga0070697_100335275 3300005536 Bacteria 1304
113 Ga0070697_100352351 3300005536 Bacteria 1271
114 Ga0070697_100385714 3300005536 Bacteria 1214
115 Ga0070697_100986157 3300005536 Bacteria 749
116 Ga0068853_100368381 3300005539 Bacteria 1340
117 Ga0070672_100064841 3300005543 Bacteria 2887
118 Ga0070672_100154190 3300005543 Bacteria 1902
119 Ga0070672_101772006 3300005543 Unclassified 555
120 Ga0070686_100181419 3300005544 Bacteria 1496
121 Ga0070695_100000636 3300005545 Bacteria 18606
122 Ga0070695_100006753 3300005545 Bacteria 6791
123 Ga0070695_100084900 3300005545 Bacteria 2101
124 Ga0070695_100091832 3300005545 Bacteria 2029
125 Ga0070695_100219262 3300005545 Bacteria 1370
126 Ga0070695_100328475 3300005545 Unclassified 1139
127 Ga0070696_100002733 3300005546 Bacteria 11715
128 Ga0070696_100005376 3300005546 Bacteria 8543
129 Ga0070696_100025546 3300005546 Bacteria 4017
130 Ga0070696_100155485 3300005546 Unclassified 1681
131 Ga0070696_100159322 3300005546 Bacteria 1662
132 Ga0070693_100000439 3300005547 Bacteria 18760
133 Ga0070704_100011325 3300005549 Bacteria 5464
134 Ga0070704_100059354 3300005549 Bacteria 2729
135 Ga0070704_100068636 3300005549 Bacteria 2565
136 Ga0070704_100075936 3300005549 Bacteria 2456
137 Ga0070704_100090118 3300005549 Unclassified 2283
138 Ga0070704_100601332 3300005549 Bacteria 967
139 Ga0068855_100008335 3300005563 Bacteria 12530
140 Ga0070664_100011490 3300005564 Bacteria 7186
141 Ga0068857_100267344 3300005577 Bacteria 1571
142 Ga0068857_100904282 3300005577 Bacteria 846
143 Ga0068854_100018950 3300005578 Bacteria 4627
144 Ga0068854_100343728 3300005578 Unclassified 1219
145 Ga0068856_100003850 3300005614 Bacteria 15057
146 Ga0070702_100112288 3300005615 Bacteria 1692
147 Ga0070702_100163562 3300005615 Bacteria 1441
148 Ga0070702_101691358 3300005615 Unclassified 526
149 Ga0068852_101628374 3300005616 Unclassified 668
150 Ga0068859_100010219 3300005617 Bacteria 9445
151 Ga0068859_100204139 3300005617 Bacteria 2061
152 Ga0068859_100371890 3300005617 Bacteria 1525
153 Ga0068859_101040541 3300005617 Bacteria 900
154 Ga0068859_101966907 3300005617 Unclassified 645
155 Ga0068864_100690472 3300005618 Bacteria 996
156 Ga0068864_100767891 3300005618 Bacteria 945
157 Ga0068866_10155979 3300005718 Bacteria 1327
158 Ga0068866_10215582 3300005718 Bacteria 1155
159 Ga0068866_10568603 3300005718 Bacteria 761
160 Ga0068861_100048642 3300005719 Bacteria 3207
161 Ga0068861_100268111 3300005719 Bacteria 1465
162 Ga0068861_100599157 3300005719 Bacteria 1011
163 Ga0068870_10000417 3300005840 Bacteria 16024
164 Ga0068863_100076909 3300005841 Bacteria 3157
165 Ga0068858_100411661 3300005842 Unclassified 1300
166 Ga0068858_100495844 3300005842 Bacteria 1180
167 Ga0068860_100061390 3300005843 Bacteria 3571
168 Ga0068860_100180609 3300005843 Bacteria 2039
169 Ga0068862_100002631 3300005844 Bacteria 15813
170 Ga0068862_100039230 3300005844 Bacteria 4021
171 Ga0068862_100264184 3300005844 Bacteria 1572
172 Ga0081455_10000080 3300005937 Bacteria 104190
173 Ga0081455_10136106 3300005937 Bacteria 1914
174 Ga0081455_10213548 3300005937 Archaea 1436
175 Ga0081540_1025877 3300005983 Bacteria 3365
176 Ga0075432_10007150 3300006058 Bacteria 3801
177 Ga0070715_10036832 3300006163 Bacteria 2021
178 Ga0070715_10067314 3300006163 Bacteria 1590
179 Ga0070716_100010320 3300006173 Bacteria 4680
180 Ga0070716_100296261 3300006173 Unclassified 1123
181 Ga0070716_100639768 3300006173 Unclassified 805
182 Ga0070712_100004295 3300006175 Bacteria 8777
183 Ga0070712_100266456 3300006175 Bacteria 1375
184 Ga0075428_100079541 3300006844 Bacteria 3578
185 Ga0075428_100096234 3300006844 Bacteria 3227
186 Ga0075428_100607361 3300006844 Bacteria 1168
187 Ga0075430_100000034 3300006846 Bacteria 70046
188 Ga0075430_100432343 3300006846 Bacteria 1086
189 Ga0075431_100000281 3300006847 Bacteria 39748
190 Ga0075431_100001229 3300006847 Bacteria 23220
191 Ga0075431_100238987 3300006847 Bacteria 1848
192 Ga0075431_100244153 3300006847 Bacteria 1826
193 Ga0075433_10003389 3300006852 Bacteria 12309
194 Ga0075433_10006568 3300006852 Bacteria 9207
195 Ga0075433_10102441 3300006852 Bacteria 2535
196 Ga0075433_10142443 3300006852 Bacteria 2131
197 Ga0075433_10243202 3300006852 Bacteria 1597
198 Ga0075433_11182827 3300006852 Unclassified 664
199 Ga0075434_100007549 3300006871 Bacteria 10075
200 Ga0075434_100020422 3300006871 Bacteria 6426
201 Ga0075434_100028009 3300006871 Bacteria 5532
202 Ga0075434_100049492 3300006871 Bacteria 4173
203 Ga0075434_100061172 3300006871 Bacteria 3746
204 Ga0075434_100227097 3300006871 Bacteria 1886
205 Ga0075434_100281871 3300006871 Bacteria 1681
206 Ga0075434_100315923 3300006871 Bacteria 1583
207 Ga0075434_100322484 3300006871 Unclassified 1565
208 Ga0075434_100749511 3300006871 Unclassified 993
209 Ga0075434_100969398 3300006871 Bacteria 864
210 Ga0075434_101471498 3300006871 Archaea 691
211 Ga0075434_101613707 3300006871 Unclassified 657
212 Ga0075434_101993199 3300006871 Unclassified 586
213 Ga0075429_100010800 3300006880 Bacteria 7897
214 Ga0075429_100043163 3300006880 Bacteria 3923
215 Ga0075429_100077083 3300006880 Bacteria 2904
216 Ga0075429_100152082 3300006880 Bacteria 2026
217 Ga0075429_100179469 3300006880 Bacteria 1856
218 Ga0075429_100236675 3300006880 Bacteria 1599
219 Ga0075429_100258520 3300006880 Bacteria 1524
220 Ga0075429_101228554 3300006880 Bacteria 654
221 Ga0068865_100694530 3300006881 Bacteria 869
222 Ga0075436_100016366 3300006914 Bacteria 5075
223 Ga0075436_100038478 3300006914 Bacteria 3302
224 Ga0075436_100060978 3300006914 Bacteria 2606
225 Ga0075436_100102030 3300006914 Bacteria 1998
226 Ga0075436_100525040 3300006914 Bacteria 868
227 Ga0097620_100010219 3300006931 Bacteria 9445
228 Ga0097620_100204154 3300006931 Bacteria 2061
229 Ga0097620_100371879 3300006931 Bacteria 1525
230 Ga0097620_101040582 3300006931 Bacteria 900
231 Ga0097620_101966864 3300006931 Unclassified 645
232 Ga0075435_100001787 3300007076 Bacteria 13994
233 Ga0075435_100009228 3300007076 Bacteria 7125
234 Ga0075435_100269688 3300007076 Unclassified 1451
235 Ga0075435_100517655 3300007076 Bacteria 1032
236 Ga0075435_100553318 3300007076 Unclassified 996
237 Ga0075435_100659455 3300007076 Bacteria 908
238 Ga0075435_101001654 3300007076 Bacteria 730
239 Ga0075435_101268855 3300007076 Unclassified 645
240 Ga0075435_101353953 3300007076 Bacteria 624
241 Ga0099794_10071394 3300007265 Bacteria 1701
242 Ga0099794_10271816 3300007265 Bacteria 875
243 Ga0099795_10094208 3300007788 Bacteria 1165
244 Ga0111539_10002043 3300009094 Bacteria 26984
245 Ga0111539_10007553 3300009094 Bacteria 13898
246 Ga0111539_10063471 3300009094 Bacteria 4371
247 Ga0111539_10105391 3300009094 Unclassified 3308
248 Ga0111539_10143511 3300009094 Bacteria 2795
249 Ga0111539_10594860 3300009094 Bacteria 1288
250 Ga0111539_12270896 3300009094 Bacteria 629
251 Ga0105245_10129731 3300009098 Bacteria 2364
252 Ga0105247_10111079 3300009101 Bacteria 1765
253 Ga0114129_10019248 3300009147 Bacteria 9725
254 Ga0114129_10098016 3300009147 Bacteria 4058
255 Ga0114129_10113267 3300009147 Bacteria 3741
256 Ga0114129_10164177 3300009147 Bacteria 3032
257 Ga0114129_10210148 3300009147 Bacteria 2631
258 Ga0114129_10707838 3300009147 Bacteria 1294
259 Ga0114129_10900355 3300009147 Bacteria 1121
260 Ga0114129_11123974 3300009147 Bacteria 982
261 Ga0114129_11238079 3300009147 Archaea 928
262 Ga0114129_11851747 3300009147 Bacteria 733
263 Ga0114129_11883024 3300009147 Unclassified 726
264 Ga0105243_10019273 3300009148 Bacteria 5171
265 Ga0105243_10036389 3300009148 Bacteria 3821
266 Ga0105243_10146336 3300009148 Bacteria 2022
267 Ga0105243_10469462 3300009148 Bacteria 1185
268 Ga0105243_11230679 3300009148 Unclassified 763
269 Ga0105243_11652276 3300009148 Bacteria 668
270 Ga0105243_11775230 3300009148 Bacteria 647
271 Ga0105241_10029731 3300009174 Bacteria 4078
272 Ga0105241_10129563 3300009174 Bacteria 2041
273 Ga0105242_10052026 3300009176 Bacteria 3340
274 Ga0105242_10570688 3300009176 Unclassified 1088
275 Ga0105242_10660637 3300009176 Unclassified 1018
276 Ga0105242_11439960 3300009176 Bacteria 718
277 Ga0105248_10162520 3300009177 Bacteria 2518
278 Ga0105248_10387115 3300009177 Bacteria 1574
279 Ga0105248_11626816 3300009177 Unclassified 732
280 Ga0105248_12755837 3300009177 Unclassified 561
281 Ga0105249_10046874 3300009553 Bacteria 3935
282 Ga0105249_10047904 3300009553 Bacteria 3896
283 Ga0105249_10056174 3300009553 Bacteria 3604
284 Ga0105249_10127550 3300009553 Bacteria 2424
285 Ga0105249_10440935 3300009553 Unclassified 1339
286 Ga0105249_10674804 3300009553 Unclassified 1092
287 Ga0105239_10319220 3300010375 Bacteria 1751
288 Ga0105239_10400917 3300010375 Bacteria 1552
289 Ga0157373_10002202 3300013100 Bacteria 14755
290 Ga0157373_10763330 3300013100 Unclassified 711
291 Ga0157373_10895123 3300013100 Bacteria 658
292 Ga0157371_10084346 3300013102 Bacteria 2250
293 Ga0157378_10359087 3300013297 Bacteria 1425
294 Ga0157378_10916902 3300013297 Unclassified 907
295 Ga0157378_11286497 3300013297 Unclassified 772
296 Ga0157378_11719718 3300013297 Bacteria 674
297 Ga0163162_10011523 3300013306 Bacteria 8623
298 Ga0163162_10183251 3300013306 Bacteria 2220
299 Ga0163162_10285271 3300013306 Bacteria 1783
300 Ga0163162_10341099 3300013306 Bacteria 1631
301 Ga0163162_11280483 3300013306 Bacteria 833
302 Ga0157372_10270982 3300013307 Bacteria 1973
303 Ga0157372_10416241 3300013307 Bacteria 1566
304 Ga0157375_10040315 3300013308 Bacteria 4501
305 Ga0157375_10203944 3300013308 Bacteria 2134
306 Ga0157375_10261659 3300013308 Bacteria 1892
307 Ga0157375_11177707 3300013308 Unclassified 899
308 Ga0163163_10492901 3300014325 Bacteria 1287
309 Ga0157380_10144400 3300014326 Bacteria 2049
310 Ga0157380_10253441 3300014326 Bacteria 1594
311 Ga0157380_10582479 3300014326 Bacteria 1104
312 Ga0157380_12693405 3300014326 Unclassified 564
313 Ga0182008_10385127 3300014497 Bacteria 750
314 Ga0157379_10757768 3300014968 Bacteria 914
315 Ga0207642_10324822 3300025899 Bacteria 900
316 Ga0207710_10230974 3300025900 Bacteria 921
317 Ga0207688_10168436 3300025901 Bacteria 1302
318 Ga0207688_10406861 3300025901 Bacteria 844
319 Ga0207680_10127492 3300025903 Bacteria 1673
320 Ga0207680_10557388 3300025903 Bacteria 818
321 Ga0207647_10311128 3300025904 Bacteria 896
322 Ga0207685_10182834 3300025905 Bacteria 973
323 Ga0207645_10000290 3300025907 Bacteria 42058
324 Ga0207643_10000482 3300025908 Bacteria 25722
325 Ga0207684_10003244 3300025910 Bacteria 15956
326 Ga0207684_10016346 3300025910 Bacteria 6372
327 Ga0207684_10068836 3300025910 Bacteria 3008
328 Ga0207684_10140646 3300025910 Bacteria 2074
329 Ga0207684_10363472 3300025910 Bacteria 1245
330 Ga0207684_11290396 3300025910 Unclassified 602
331 Ga0207654_10087613 3300025911 Bacteria 1890
332 Ga0207654_10172564 3300025911 Unclassified 1405
333 Ga0207654_10219482 3300025911 Bacteria 1260
334 Ga0207707_10001856 3300025912 Bacteria 19311
335 Ga0207695_10709250 3300025913 Bacteria 886
336 Ga0207693_10263706 3300025915 Bacteria 1350
337 Ga0207660_10046119 3300025917 Bacteria 3074
338 Ga0207660_10062776 3300025917 Bacteria 2677
339 Ga0207660_10131202 3300025917 Unclassified 1907
340 Ga0207660_10167967 3300025917 Unclassified 1697
341 Ga0207660_10354646 3300025917 Bacteria 1176
342 Ga0207657_10000158 3300025919 Bacteria 69402
343 Ga0207649_10002003 3300025920 Bacteria 11591
344 Ga0207652_10001521 3300025921 Bacteria 20469
345 Ga0207646_10012309 3300025922 Bacteria 8227
346 Ga0207646_10025576 3300025922 Bacteria 5399
347 Ga0207646_10027397 3300025922 Bacteria 5197
348 Ga0207646_10047754 3300025922 Bacteria 3839
349 Ga0207646_10091326 3300025922 Bacteria 2725
350 Ga0207681_10019121 3300025923 Bacteria 4325
351 Ga0207681_10046441 3300025923 Bacteria 2921
352 Ga0207650_10183357 3300025925 Bacteria 1669
353 Ga0207659_10914539 3300025926 Unclassified 754
354 Ga0207659_11869192 3300025926 Bacteria 509
355 Ga0207687_10643002 3300025927 Bacteria 897
356 Ga0207690_10001543 3300025932 Bacteria 14416
357 Ga0207706_10008540 3300025933 Bacteria 9437
358 Ga0207706_10047416 3300025933 Bacteria 3801
359 Ga0207706_10056083 3300025933 Bacteria 3474
360 Ga0207686_10063374 3300025934 Bacteria 2350
361 Ga0207686_10112405 3300025934 Bacteria 1840
362 Ga0207709_10036676 3300025935 Bacteria 2907
363 Ga0207709_10197233 3300025935 Unclassified 1435
364 Ga0207670_10135468 3300025936 Unclassified 1810
365 Ga0207670_10172036 3300025936 Bacteria 1625
366 Ga0207670_10380739 3300025936 Bacteria 1124
367 Ga0207670_11767976 3300025936 Bacteria 526
368 Ga0207669_10408037 3300025937 Unclassified 1066
369 Ga0207704_10264995 3300025938 Unclassified 1297
370 Ga0207704_11694851 3300025938 Bacteria 543
371 Ga0207665_11236660 3300025939 Bacteria 596
372 Ga0207691_10015161 3300025940 Bacteria 7334
373 Ga0207691_11017746 3300025940 Unclassified 691
374 Ga0207711_10211408 3300025941 Bacteria 1772
375 Ga0207711_10458241 3300025941 Bacteria 1187
376 Ga0207711_10665256 3300025941 Bacteria 971
377 Ga0207689_10000425 3300025942 Bacteria 39512
378 Ga0207689_10040379 3300025942 Bacteria 3862
379 Ga0207689_10409390 3300025942 Bacteria 1131
380 Ga0207689_10752059 3300025942 Bacteria 823
381 Ga0207661_10030238 3300025944 Bacteria 4170
382 Ga0207679_10003606 3300025945 Bacteria 9604
383 Ga0207667_10003229 3300025949 Bacteria 20130
384 Ga0207651_10896820 3300025960 Bacteria 789
385 Ga0207712_10013031 3300025961 Bacteria 5326
386 Ga0207712_10032621 3300025961 Bacteria 3515
387 Ga0207712_10241516 3300025961 Bacteria 1455
388 Ga0207668_10257348 3300025972 Bacteria 1421
389 Ga0207668_10447670 3300025972 Unclassified 1101
390 Ga0207668_10705574 3300025972 Unclassified 887
391 Ga0207640_10043658 3300025981 Bacteria 2866
392 Ga0207640_11219760 3300025981 Bacteria 669
393 Ga0207658_10318974 3300025986 Bacteria 1345
394 Ga0207703_10287440 3300026035 Bacteria 1495
395 Ga0207703_10595001 3300026035 Unclassified 1046
396 Ga0207639_10068980 3300026041 Bacteria 2757
397 Ga0207678_10001467 3300026067 Bacteria 21633
398 Ga0207708_10021275 3300026075 Bacteria 4890
399 Ga0207708_11709513 3300026075 Unclassified 552
400 Ga0207702_10082235 3300026078 Bacteria 2799
401 Ga0207702_11304503 3300026078 Bacteria 720
402 Ga0207641_10185378 3300026088 Unclassified 1909
403 Ga0207648_10001313 3300026089 Bacteria 27657
404 Ga0207648_10065151 3300026089 Bacteria 3176
405 Ga0207648_10068928 3300026089 Bacteria 3082
406 Ga0207648_10072453 3300026089 Bacteria 3002
407 Ga0207648_10501739 3300026089 Unclassified 1110
408 Ga0207676_10268284 3300026095 Bacteria 1544
409 Ga0207676_10399403 3300026095 Bacteria 1284
410 Ga0207674_10004140 3300026116 Bacteria 17546
411 Ga0207674_10014924 3300026116 Bacteria 8561
412 Ga0207674_10291874 3300026116 Bacteria 1579
413 Ga0207675_100131809 3300026118 Bacteria 2370
414 Ga0207675_100135053 3300026118 Bacteria 2340
415 Ga0207675_100319581 3300026118 Bacteria 1515
416 Ga0207675_100478487 3300026118 Bacteria 1237
417 Ga0207683_10855890 3300026121 Bacteria 844
418 Ga0209970_1001329 3300027614 Bacteria 4338
419 Ga0209588_1008766 3300027671 Bacteria 3007
420 Ga0209971_1000005 3300027682 Bacteria 108671
421 Ga0209971_1074177 3300027682 Unclassified 827
422 Ga0209966_1000010 3300027695 Bacteria 86172
423 Ga0209998_10000023 3300027717 Bacteria 65076
424 Ga0209974_10000464 3300027876 Bacteria 13490
425 Ga0207428_10000276 3300027907 Bacteria 69031
426 Ga0207428_10002151 3300027907 Bacteria 19792
427 Ga0207428_10341066 3300027907 Bacteria 1104
428 Ga0268265_10020825 3300028380 Bacteria 4583
429 Ga0268265_10195095 3300028380 Bacteria 1752
430 Ga0268265_10684843 3300028380 Bacteria 989
431 Ga0268265_11060640 3300028380 Bacteria 803
432 Ga0268265_11136131 3300028380 Unclassified 777
433 Ga0268264_10498572 3300028381 Bacteria 1187
434 Ga0307408_100026418 3300031548 Bacteria 3989
435 Ga0307408_100034196 3300031548 Bacteria 3558
436 Ga0307408_100039290 3300031548 Bacteria 3344
437 Ga0307408_100137310 3300031548 Bacteria 1914
438 Ga0307406_10178355 3300031901 Bacteria 1544
439 Ga0307407_10066601 3300031903 Bacteria 2125
440 Ga0307407_10705561 3300031903 Bacteria 760
441 Ga0307407_11223838 3300031903 Bacteria 587
442 Ga0307412_10557767 3300031911 Bacteria 963
443 Ga0307409_101570994 3300031995 Bacteria 686
444 Ga0307416_100004866 3300032002 Bacteria 8176
445 Ga0307411_10142688 3300032005 Bacteria 1768
446 Ga0307411_10282796 3300032005 Unclassified 1321
447 Ga0373930_0030737 3300034816 Bacteria 1104
448 Ga0373948_0014616 3300034817 Bacteria 1432
449 Ga0373948_0170063 3300034817 Bacteria 554
450 Ga0373950_0050057 3300034818 Bacteria 819
451 Ga0373958_0110114 3300034819 Bacteria 655
452 Ga0373940_0021007 3300035088 Bacteria 1664
453 Ga0373949_0048902 3300035090 Bacteria 1060
454 Ga0373952_0030493 3300035092 Bacteria 1194
455 Ga0373932_0021309 3300035112 Bacteria 1710
456 Ga0373939_0027201 3300035114 Bacteria 1618
457 Ga0373941_0058453 3300035115 Unclassified 1248
458 Ga0373960_0048327 3300035121 Bacteria 1255
459 Ga0373942_0108599 3300035207 Bacteria 856
460 Ga0373961_0111893 3300035241 Bacteria 895
461 Ga0373962_0030135 3300035242 Bacteria 1483
462 Ga0373962_0070683 3300035242 Bacteria 1042
463 Ga0373931_0092538 3300035691 Bacteria 1687
464 Ga0373931_0094613 3300035691 Bacteria 1670
465 Ga0373931_0366816 3300035691 Bacteria 905
466 Ga0439437_010420 3300042000 Bacteria 1057
467 Ga0439448_0000678 3300042005 Bacteria 8135
468 Ga0439448_0178929 3300042005 Bacteria 741
469 Ga0439455_0178317 3300042012 Bacteria 611
470 Ga0439446_0033438 3300042156 Bacteria 1494
471 Ga0439435_0138644 3300042436 Unclassified 773
472 Ga0439459_0001810 3300042438 Bacteria 3214
473 Ga0439464_0010970 3300042439 Bacteria 2395
474 Ga0439460_0000314 3300042461 Bacteria 10206
475 Ga0439460_0009192 3300042461 Bacteria 2507
476 Ga0451577_0020330 3300042876 Bacteria 6094
477 Ga0451577_0061662 3300042876 Bacteria 3344
478 Ga0451577_0087844 3300042876 Bacteria 2774
479 Ga0451577_0515744 3300042876 Bacteria 1085
480 Ga0453683_0097736 3300044673 Bacteria 1843
481 Ga0453683_0320893 3300044673 Bacteria 993
482 Ga0453683_0910121 3300044673 Unclassified 582
483 Ga0453684_0018602 3300044712 Bacteria 10651
484 Ga0453684_0090401 3300044712 Bacteria 3783
485 Ga0453684_0158659 3300044712 Bacteria 2678
486 Ga0453684_1358738 3300044712 Unclassified 739
487 Ga0451576_0020221 3300045051 Bacteria 7250
488 Ga0451576_0025380 3300045051 Bacteria 6383
489 Ga0451576_0093511 3300045051 Bacteria 3126
490 Ga0451576_0199353 3300045051 Bacteria 2090
491 Ga0451576_0391163 3300045051 Bacteria 1457
492 Ga0451576_0432344 3300045051 Bacteria 1381
493 Ga0451576_0566413 3300045051 Bacteria 1193
494 Ga0451576_0891470 3300045051 Bacteria 933
495 Ga0451576_1215025 3300045051 Bacteria 787
496 Ga0495603_0299028 3300046455 Bacteria 924
497 Ga0495580_0056808 3300046472 Bacteria 2756
498 Ga0495580_0072895 3300046472 Bacteria 2397
499 Ga0495580_0225730 3300046472 Bacteria 1286
500 Ga0495584_0339515 3300046491 Bacteria 763
501 Ga0495642_0020490 3300046528 Bacteria 2597
502 Ga0495659_0176816 3300046664 Bacteria 868
503 Ga0495669_0047771 3300046684 Bacteria 1913
504 Ga0495669_0146391 3300046684 Bacteria 1117
505 Ga0495636_0373710 3300047318 Unclassified 676
506 Ga0496102_0007307 3300048905 Bacteria 9429
507 Ga0496102_1131318 3300048905 Unclassified 703
508 Ga0496104_0892055 3300048907 Bacteria 794
509 Ga0496106_0060116 3300048909 Bacteria 2880
510 Ga0496106_1061289 3300048909 Bacteria 636
511 Ga0496107_0085910 3300048910 Bacteria 2296
512 Ga0496110_0473549 3300048913 Bacteria 1141
513 Ga0496111_0850065 3300048914 Bacteria 659
514 Ga0496112_0218919 3300048915 Bacteria 1860
515 Ga0496113_0415113 3300048916 Bacteria 1081
516 Ga0501299_095204 3300049522 Unclassified 683
517 Ga0501031_0357848 3300049568 Bacteria 945
518 Ga0501032_0319516 3300049569 Bacteria 1002
519 Ga0501033_0117179 3300049570 Bacteria 1935
520 Ga0501033_0262998 3300049570 Bacteria 1221
521 Ga0501033_0814189 3300049570 Bacteria 631
522 Ga0501036_0144176 3300049572 Bacteria 2009
523 Ga0501036_0611248 3300049572 Unclassified 904
524 Ga0501036_0949446 3300049572 Bacteria 705
525 Ga0501036_1193533 3300049572 Bacteria 620
526 Ga0501037_0524867 3300049573 Bacteria 801
527 Ga0501038_0184818 3300049574 Bacteria 1680
528 Ga0501038_0726646 3300049574 Bacteria 742
529 Ga0501038_0774743 3300049574 Bacteria 714
530 Ga0501039_0155566 3300049575 Bacteria 1796
531 Ga0501039_0210052 3300049575 Bacteria 1531
532 Ga0501039_0345818 3300049575 Bacteria 1169
533 Ga0501039_0419009 3300049575 Bacteria 1052
534 Ga0501039_0621844 3300049575 Unclassified 846
535 Ga0501039_0786284 3300049575 Unclassified 743
536 Ga0501039_0947231 3300049575 Bacteria 670
537 Ga0501040_0026323 3300049576 Bacteria 3912
538 Ga0501040_0075516 3300049576 Bacteria 2329
539 Ga0501040_0076278 3300049576 Bacteria 2318
540 Ga0501040_0101684 3300049576 Bacteria 2005
541 Ga0501040_0315227 3300049576 Bacteria 1118
542 Ga0501041_0011242 3300049577 Bacteria 5289
543 Ga0501041_0159947 3300049577 Bacteria 1408
544 Ga0501041_0246972 3300049577 Bacteria 1122
545 Ga0501041_0319184 3300049577 Unclassified 980
546 Ga0501041_0493600 3300049577 Bacteria 779
547 Ga0501042_0005993 3300049578 Bacteria 7868
548 Ga0501042_0057825 3300049578 Bacteria 2767
549 Ga0501042_0171699 3300049578 Unclassified 1564
550 Ga0501042_0351755 3300049578 Bacteria 1066
551 Ga0501042_0372617 3300049578 Unclassified 1033
552 Ga0501043_0352345 3300049579 Bacteria 1118
553 Ga0501046_0001215 3300049580 Bacteria 24954
554 Ga0501046_0230206 3300049580 Bacteria 1370
555 Ga0501046_0335770 3300049580 Bacteria 1099
556 Ga0501046_0834752 3300049580 Bacteria 645
557 Ga0501046_0961231 3300049580 Unclassified 594
558 Ga0501046_0982382 3300049580 Unclassified 586
559 Ga0501048_0003092 3300049582 Bacteria 12693
560 Ga0501048_0557232 3300049582 Bacteria 822
561 Ga0501067_0058067 3300049583 Bacteria 2143
562 Ga0501068_0273894 3300049584 Unclassified 1078
563 Ga0501068_0686071 3300049584 Bacteria 669
564 Ga0501068_0745954 3300049584 Bacteria 641
565 Ga0501068_0791675 3300049584 Bacteria 622
566 Ga0501070_0338160 3300049586 Bacteria 1223
567 Ga0501070_0819961 3300049586 Unclassified 730
568 Ga0501071_0078047 3300049587 Bacteria 2420
569 Ga0501071_0139077 3300049587 Bacteria 1808
570 Ga0501071_0280335 3300049587 Bacteria 1261
571 Ga0501071_0302233 3300049587 Bacteria 1213
572 Ga0501071_0341413 3300049587 Bacteria 1139
573 Ga0501071_0547476 3300049587 Bacteria 889
574 Ga0501072_0012951 3300049588 Bacteria 6381
575 Ga0501072_0109297 3300049588 Unclassified 2200
576 Ga0501072_0115943 3300049588 Bacteria 2133
577 Ga0501072_0168463 3300049588 Bacteria 1748
578 Ga0501072_0473286 3300049588 Unclassified 992
579 Ga0501072_0673704 3300049588 Bacteria 814
580 Ga0501074_0003061 3300049590 Bacteria 11789
581 Ga0501074_0114202 3300049590 Bacteria 1932
582 Ga0501074_0127291 3300049590 Bacteria 1823
583 Ga0501074_0214874 3300049590 Bacteria 1370
584 Ga0501074_0869184 3300049590 Unclassified 635
585 Ga0501075_0185274 3300049591 Bacteria 1588
586 Ga0501075_0209333 3300049591 Bacteria 1487
587 Ga0501075_0230422 3300049591 Bacteria 1413
588 Ga0501075_0377033 3300049591 Unclassified 1081
589 Ga0501076_0019298 3300049592 Bacteria 5210
590 Ga0501076_0059592 3300049592 Bacteria 3037
591 Ga0501076_0152449 3300049592 Bacteria 1880
592 Ga0501076_0188647 3300049592 Unclassified 1682
593 Ga0501076_0222472 3300049592 Bacteria 1542
594 Ga0501076_0267343 3300049592 Bacteria 1400
595 Ga0501076_0300220 3300049592 Bacteria 1316
596 Ga0501076_0401878 3300049592 Bacteria 1126
597 Ga0501077_0057986 3300049593 Bacteria 2458
598 Ga0501077_0109311 3300049593 Bacteria 1752
599 Ga0501077_0361130 3300049593 Bacteria 927
600 Ga0501077_0392313 3300049593 Bacteria 887
601 Ga0501077_0440374 3300049593 Unclassified 834
602 Ga0501079_0001522 3300049741 Bacteria 16405
603 Ga0501079_0041460 3300049741 Bacteria 3554
604 Ga0501079_0043307 3300049741 Bacteria 3474
605 Ga0501079_0762764 3300049741 Unclassified 761
606 Ga0501080_0013705 3300049742 Bacteria 7466
607 Ga0501080_0037206 3300049742 Bacteria 4544
608 Ga0501080_0231465 3300049742 Bacteria 1689
609 Ga0501080_0721672 3300049742 Bacteria 878
610 Ga0501080_0801028 3300049742 Unclassified 826
611 Ga0501081_0002787 3300049743 Bacteria 11084
612 Ga0501081_0007340 3300049743 Bacteria 7155
613 Ga0501081_0010136 3300049743 Bacteria 6149
614 Ga0501081_0078980 3300049743 Bacteria 2301
615 Ga0501081_0405674 3300049743 Bacteria 1009
616 Ga0501081_0594472 3300049743 Unclassified 828
617 Ga0501081_1181392 3300049743 Bacteria 579
618 Ga0501083_0022373 3300049744 Bacteria 4388
619 Ga0501083_0195764 3300049744 Bacteria 1319
620 Ga0501035_0095058 3300049822 Bacteria 2620
621 Ga0501035_0585371 3300049822 Unclassified 911
622 Ga0501035_0649979 3300049822 Bacteria 855
623 Ga0501044_1103412 3300049823 Bacteria 663
624 Ga0501045_0124625 3300049824 Bacteria 1913
625 Ga0501045_0417446 3300049824 Unclassified 998
626 Ga0501045_0419771 3300049824 Bacteria 995
627 Ga0501045_0434612 3300049824 Bacteria 976
628 Ga0501045_1104305 3300049824 Bacteria 580
629 nmdc:mga05p37_1023567_c1 3300050507 Bacteria 874
630 nmdc:mga05p37_31017_c1 3300050507 Bacteria 6528
631 nmdc:mga05p37_373856_c1 3300050507 Bacteria 1672
632 nmdc:mga05p37_38013_c1 3300050507 Bacteria 5903
633 nmdc:mga05p37_427775_c1 3300050507 Bacteria 1539
634 nmdc:mga05p37_53621_c1 3300050507 Bacteria 4959
635 nmdc:mga05p37_564309_c1 3300050507 Bacteria 1293
636 nmdc:mga05p37_56888_c1 3300050507 Bacteria 4816
637 nmdc:mga05p37_71433_c1 3300050507 Bacteria 4270
638 nmdc:mga05p37_749931_c1 3300050507 Bacteria 1076
639 nmdc:mga05p37_924934_c1 3300050507 Bacteria 937
640 nmdc:mga09592_1232_c1 3300050508 Bacteria 20495
641 nmdc:mga09592_241146_c1 3300050508 Bacteria 1566
642 nmdc:mga09592_250046_c1 3300050508 Unclassified 1537
643 nmdc:mga09592_311085_c1 3300050508 Archaea 1365
644 nmdc:mga09592_32265_c1 3300050508 Bacteria 4367
645 nmdc:mga09592_33628_c1 3300050508 Bacteria 4281
646 nmdc:mga09592_786920_c1 3300050508 Bacteria 805
647 nmdc:mga0qj67_52361_c1 3300050509 Bacteria 3231
648 nmdc:mga0qj67_5451_c1 3300050509 Bacteria 9294
649 nmdc:mga06r32_1480353_c1 3300050510 Unclassified 619
650 nmdc:mga06r32_2190_c1 3300050510 Bacteria 17506
651 nmdc:mga06r32_22649_c1 3300050510 Bacteria 5810
652 nmdc:mga08y16_113120_c1 3300050511 Bacteria 2826
653 nmdc:mga08y16_1158404_c1 3300050511 Bacteria 746
654 nmdc:mga08y16_34111_c1 3300050511 Bacteria 5346
655 nmdc:mga08y16_82960_c1 3300050511 Unclassified 3341
656 nmdc:mga08y16_93993_c1 3300050511 Bacteria 3124
657 nmdc:mga0n895_10097_c1 3300050512 Bacteria 8312
658 nmdc:mga0n895_1241776_c1 3300050512 Unclassified 718
659 nmdc:mga0n895_1323515_c1 3300050512 Archaea 691
660 nmdc:mga0n895_1362905_c1 3300050512 Unclassified 679
661 nmdc:mga0n895_15398_c1 3300050512 Bacteria 6971
662 nmdc:mga0n895_263814_c1 3300050512 Bacteria 1748
663 nmdc:mga0n895_33008_c1 3300050512 Bacteria 4972
664 nmdc:mga0n895_538100_c1 3300050512 Bacteria 1175
665 nmdc:mga0n895_559006_c1 3300050512 Bacteria 1149
666 nmdc:mga0n895_63951_c1 3300050512 Bacteria 3639
667 nmdc:mga0n895_72925_c1 3300050512 Bacteria 3408
668 nmdc:mga0n895_772592_c1 3300050512 Bacteria 953
669 nmdc:mga0rr50_279909_c1 3300050513 Bacteria 1392
670 nmdc:mga0rr50_34163_c1 3300050513 Bacteria 3640
671 nmdc:mga0rr50_34819_c1 3300050513 Bacteria 3610
672 nmdc:mga0rr50_405061_c1 3300050513 Bacteria 1153
673 nmdc:mga0rr50_476179_c1 3300050513 Bacteria 1060
674 nmdc:mga0rr50_505669_c1 3300050513 Unclassified 1028
675 nmdc:mga0rr50_652772_c1 3300050513 Bacteria 898
676 nmdc:mga0rr50_65554_c1 3300050513 Unclassified 2751
677 nmdc:mga0rr50_909062_c1 3300050513 Bacteria 750
678 nmdc:mga08x19_13439_c1 3300050514 Bacteria 4951
679 nmdc:mga08x19_219595_c1 3300050514 Bacteria 1306
680 nmdc:mga08x19_24360_c1 3300050514 Unclassified 3760
681 nmdc:mga08x19_312030_c1 3300050514 Bacteria 1093
682 nmdc:mga08x19_64213_c1 3300050514 Unclassified 2383
683 nmdc:mga08x19_96553_c1 3300050514 Bacteria 1341
684 nmdc:mga0a205_142361_c1 3300050515 Bacteria 2298
685 nmdc:mga0a205_148426_c1 3300050515 Bacteria 2245
686 nmdc:mga0a205_182366_c1 3300050515 Bacteria 1993
687 nmdc:mga0a205_18346_c1 3300050515 Bacteria 6576
688 nmdc:mga0a205_21467_c1 3300050515 Bacteria 6108
689 nmdc:mga0a205_354695_c1 3300050515 Bacteria 1334
690 nmdc:mga0a205_48154_c1 3300050515 Bacteria 4114
691 nmdc:mga0a205_493699_c1 3300050515 Bacteria 1081
692 nmdc:mga0a205_57051_c1 3300050515 Bacteria 3771
693 nmdc:mga0a205_8519_c1 3300050515 Bacteria 9325
694 nmdc:mga0a205_890979_c1 3300050515 Unclassified 737
695 nmdc:mga0a205_99508_c1 3300050515 Bacteria 2806
696 Ga0501084_0007636 3300054114 Bacteria 8918
697 Ga0501084_0011856 3300054114 Bacteria 7215
698 Ga0501084_0024808 3300054114 Bacteria 5004
699 Ga0501084_0376331 3300054114 Bacteria 1200
700 Ga0501084_0688237 3300054114 Unclassified 862
701 Ga0501084_0743704 3300054114 Unclassified 826
702 Ga0501084_0756738 3300054114 Unclassified 818
703 Ga0501084_0806842 3300054114 Bacteria 790
704 Ga0501084_0827122 3300054114 Bacteria 780
705 Ga0590071_056128 3300059421 Bacteria 958
706 Ga0501082_0001952 3300060353 Bacteria 18158
707 Ga0501082_0068634 3300060353 Bacteria 3052
708 Ga0501082_0249661 3300060353 Bacteria 1544
709 Ga0501082_0258293 3300060353 Bacteria 1515
710 Ga0501082_0827430 3300060353 Unclassified 810
711 Ga0501082_1277725 3300060353 Unclassified 641
712 Ga0530510_0014411 3300061734 Bacteria 5574
713 Ga0530510_0032918 3300061734 Bacteria 3731
714 Ga0530510_0104733 3300061734 Bacteria 2070
715 Ga0530510_0108372 3300061734 Bacteria 2033
716 Ga0530510_0109391 3300061734 Bacteria 2024
717 Ga0530510_0214673 3300061734 Bacteria 1429
718 Ga0530510_0306282 3300061734 Bacteria 1189
719 Ga0530510_0362032 3300061734 Unclassified 1090
720 Ga0070708_100291129
721 Ga0065707_10018464
722 Ga0065707_10578175
723 Ga0070676_10000793
724 Ga0070683_100024363
725 Ga0070690_100143054
726 Ga0070670_100013632
727 Ga0070677_10347851
728 Ga0068869_100002053
729 Ga0068869_100148103
730 Ga0068869_100292000
731 Ga0068869_100349529
732 Ga0070666_10075368
733 Ga0070680_100003802
734 Ga0070680_100017250
735 Ga0070680_100072817
736 Ga0070680_100444876
737 Ga0070682_100001673
738 Ga0068868_100007767
739 Ga0070660_100020417
740 Ga0070689_100132521
741 Ga0070689_100223605
742 Ga0070691_10004693
743 Ga0070691_10024899
744 Ga0070687_100749844
745 Ga0070661_100006150
746 Ga0070692_10006918
747 Ga0070692_10021252
748 Ga0070692_10114186
749 Ga0070692_10567145
750 Ga0070668_100203687
751 Ga0070669_100013243
752 Ga0070669_100092574
753 Ga0070669_101500649
754 Ga0070675_100250854
755 Ga0070675_102224869
756 Ga0070671_100287020
757 Ga0070673_100134425
758 Ga0070688_100065577
759 Ga0070688_100348094
760 Ga0070659_100005631
761 Ga0070703_10007181
762 Ga0070703_10051390
763 Ga0070709_10690715
764 Ga0070701_10006578
765 Ga0070701_10694818
766 Ga0070705_100001541
767 Ga0070705_100007899
768 Ga0070705_100062121
769 Ga0070705_100284831
770 Ga0070700_100052430
771 Ga0070700_100549883
772 Ga0070700_100605753
773 Ga0070694_100002862
774 Ga0070694_100004074
775 Ga0070694_100022916
776 Ga0070694_100023248
777 Ga0070694_100075106
778 Ga0070694_100547000
779 Ga0070694_100955748
780 Ga0070708_100018010
781 Ga0070708_100066258
782 Ga0070708_100136299
783 Ga0070708_100230481
784 Ga0070708_100269001
785 Ga0070708_101140854
786 Ga0070663_100001620
787 Ga0070678_100386538
788 Ga0070662_100004269
789 Ga0070662_100420095
790 Ga0070681_10150940
791 Ga0070681_10287195
792 Ga0070681_11040980
793 Ga0068867_100023047
794 Ga0068867_100039866
795 Ga0068867_100096419
796 Ga0068867_100241416
797 Ga0068867_100321122
798 Ga0068867_100340277
799 Ga0070706_100003379
800 Ga0070706_100066029
801 Ga0070706_100174594
802 Ga0070706_100316621
803 Ga0070706_100326142
804 Ga0070706_100334368
805 Ga0070706_100688034
806 Ga0070707_100027792
807 Ga0070707_100051180
808 Ga0070707_100072011
809 Ga0070707_100377247
810 Ga0070707_100457827
811 Ga0070707_100475101
812 Ga0070707_100719776
813 Ga0070707_101135365
814 Ga0070707_101359028
815 Ga0070698_100003851
816 Ga0070698_100005788
817 Ga0070698_100050420
818 Ga0070698_100848217
819 Ga0070699_100007462
820 Ga0070699_100056661
821 Ga0070699_100077283
822 Ga0070699_100115982
823 Ga0070699_100294477
824 Ga0070699_100519045
825 Ga0070679_100007343
826 Ga0070684_100002889
827 Ga0070697_100009746
828 Ga0070697_100014889
829 Ga0070697_100016680
830 Ga0070697_100224848
831 Ga0070697_100335275
832 Ga0070697_100352351
833 Ga0070697_100385714
834 Ga0070697_100986157
835 Ga0068853_100368381
836 Ga0070672_100064841
837 Ga0070672_100154190
838 Ga0070672_101772006
839 Ga0070686_100181419
840 Ga0070695_100000636
841 Ga0070695_100006753
842 Ga0070695_100084900
843 Ga0070695_100091832
844 Ga0070695_100219262
845 Ga0070695_100328475
846 Ga0070696_100002733
847 Ga0070696_100005376
848 Ga0070696_100025546
849 Ga0070696_100155485
850 Ga0070696_100159322
851 Ga0070693_100000439
852 Ga0070704_100011325
853 Ga0070704_100059354
854 Ga0070704_100068636
855 Ga0070704_100075936
856 Ga0070704_100090118
857 Ga0070704_100601332
858 Ga0068855_100008335
859 Ga0070664_100011490
860 Ga0068857_100267344
861 Ga0068857_100904282
862 Ga0068854_100018950
863 Ga0068854_100343728
864 Ga0068856_100003850
865 Ga0070702_100112288
866 Ga0070702_100163562
867 Ga0070702_101691358
868 Ga0068852_101628374
869 Ga0068859_100010219
870 Ga0068859_100204139
871 Ga0068859_100371890
872 Ga0068859_101040541
873 Ga0068859_101966907
874 Ga0068864_100690472
875 Ga0068864_100767891
876 Ga0068866_10155979
877 Ga0068866_10215582
878 Ga0068866_10568603
879 Ga0068861_100048642
880 Ga0068861_100268111
881 Ga0068861_100599157
882 Ga0068870_10000417
883 Ga0068863_100076909
884 Ga0068858_100411661
885 Ga0068858_100495844
886 Ga0068860_100061390
887 Ga0068860_100180609
888 Ga0068862_100002631
889 Ga0068862_100039230
890 Ga0068862_100264184
891 Ga0081455_10000080
892 Ga0081455_10136106
893 Ga0081455_10213548
894 Ga0081540_1025877
895 Ga0075432_10007150
896 Ga0070715_10036832
897 Ga0070715_10067314
898 Ga0070716_100010320
899 Ga0070716_100296261
900 Ga0070716_100639768
901 Ga0070712_100004295
902 Ga0070712_100266456
903 Ga0075428_100079541
904 Ga0075428_100096234
905 Ga0075428_100607361
906 Ga0075430_100000034
907 Ga0075430_100432343
908 Ga0075431_100000281
909 Ga0075431_100001229
910 Ga0075431_100238987
911 Ga0075431_100244153
912 Ga0075433_10003389
913 Ga0075433_10006568
914 Ga0075433_10102441
915 Ga0075433_10142443
916 Ga0075433_10243202
917 Ga0075433_11182827
918 Ga0075434_100007549
919 Ga0075434_100020422
920 Ga0075434_100028009
921 Ga0075434_100049492
922 Ga0075434_100061172
923 Ga0075434_100227097
924 Ga0075434_100281871
925 Ga0075434_100315923
926 Ga0075434_100322484
927 Ga0075434_100749511
928 Ga0075434_100969398
929 Ga0075434_101471498
930 Ga0075434_101613707
931 Ga0075434_101993199
932 Ga0075429_100010800
933 Ga0075429_100043163
934 Ga0075429_100077083
935 Ga0075429_100152082
936 Ga0075429_100179469
937 Ga0075429_100236675
938 Ga0075429_100258520
939 Ga0075429_101228554
940 Ga0068865_100694530
941 Ga0075436_100016366
942 Ga0075436_100038478
943 Ga0075436_100060978
944 Ga0075436_100102030
945 Ga0075436_100525040
946 Ga0097620_100010219
947 Ga0097620_100204154
948 Ga0097620_100371879
949 Ga0097620_101040582
950 Ga0097620_101966864
951 Ga0075435_100001787
952 Ga0075435_100009228
953 Ga0075435_100269688
954 Ga0075435_100517655
955 Ga0075435_100553318
956 Ga0075435_100659455
957 Ga0075435_101001654
958 Ga0075435_101268855
959 Ga0075435_101353953
960 Ga0099794_10071394
961 Ga0099794_10271816
962 Ga0099795_10094208
963 Ga0111539_10002043
964 Ga0111539_10007553
965 Ga0111539_10063471
966 Ga0111539_10105391
967 Ga0111539_10143511
968 Ga0111539_10594860
969 Ga0111539_12270896
970 Ga0105245_10129731
971 Ga0105247_10111079
972 Ga0114129_10019248
973 Ga0114129_10098016
974 Ga0114129_10113267
975 Ga0114129_10164177
976 Ga0114129_10210148
977 Ga0114129_10707838
978 Ga0114129_10900355
979 Ga0114129_11123974
980 Ga0114129_11238079
981 Ga0114129_11851747
982 Ga0114129_11883024
983 Ga0105243_10019273
984 Ga0105243_10036389
985 Ga0105243_10146336
986 Ga0105243_10469462
987 Ga0105243_11230679
988 Ga0105243_11652276
989 Ga0105243_11775230
990 Ga0105241_10029731
991 Ga0105241_10129563
992 Ga0105242_10052026
993 Ga0105242_10570688
994 Ga0105242_10660637
995 Ga0105242_11439960
996 Ga0105248_10162520
997 Ga0105248_10387115
998 Ga0105248_11626816
999 Ga0105248_12755837
1000 Ga0105249_10046874
1001 Ga0105249_10047904
1002 Ga0105249_10056174
1003 Ga0105249_10127550
1004 Ga0105249_10440935
1005 Ga0105249_10674804
1006 Ga0105239_10319220
1007 Ga0105239_10400917
1008 Ga0157373_10002202
1009 Ga0157373_10763330
1010 Ga0157373_10895123
1011 Ga0157371_10084346
1012 Ga0157378_10359087
1013 Ga0157378_10916902
1014 Ga0157378_11286497
1015 Ga0157378_11719718
1016 Ga0163162_10011523
1017 Ga0163162_10183251
1018 Ga0163162_10285271
1019 Ga0163162_10341099
1020 Ga0163162_11280483
1021 Ga0157372_10270982
1022 Ga0157372_10416241
1023 Ga0157375_10040315
1024 Ga0157375_10203944
1025 Ga0157375_10261659
1026 Ga0157375_11177707
1027 Ga0163163_10492901
1028 Ga0157380_10144400
1029 Ga0157380_10253441
1030 Ga0157380_10582479
1031 Ga0157380_12693405
1032 Ga0182008_10385127
1033 Ga0157379_10757768
1034 Ga0207642_10324822
1035 Ga0207710_10230974
1036 Ga0207688_10168436
1037 Ga0207688_10406861
1038 Ga0207680_10127492
1039 Ga0207680_10557388
1040 Ga0207647_10311128
1041 Ga0207685_10182834
1042 Ga0207645_10000290
1043 Ga0207643_10000482
1044 Ga0207684_10003244
1045 Ga0207684_10016346
1046 Ga0207684_10068836
1047 Ga0207684_10140646
1048 Ga0207684_10363472
1049 Ga0207684_11290396
1050 Ga0207654_10087613
1051 Ga0207654_10172564
1052 Ga0207654_10219482
1053 Ga0207707_10001856
1054 Ga0207695_10709250
1055 Ga0207693_10263706
1056 Ga0207660_10046119
1057 Ga0207660_10062776
1058 Ga0207660_10131202
1059 Ga0207660_10167967
1060 Ga0207660_10354646
1061 Ga0207657_10000158
1062 Ga0207649_10002003
1063 Ga0207652_10001521
1064 Ga0207646_10012309
1065 Ga0207646_10025576
1066 Ga0207646_10027397
1067 Ga0207646_10047754
1068 Ga0207646_10091326
1069 Ga0207681_10019121
1070 Ga0207681_10046441
1071 Ga0207650_10183357
1072 Ga0207659_10914539
1073 Ga0207659_11869192
1074 Ga0207687_10643002
1075 Ga0207690_10001543
1076 Ga0207706_10008540
1077 Ga0207706_10047416
1078 Ga0207706_10056083
1079 Ga0207686_10063374
1080 Ga0207686_10112405
1081 Ga0207709_10036676
1082 Ga0207709_10197233
1083 Ga0207670_10135468
1084 Ga0207670_10172036
1085 Ga0207670_10380739
1086 Ga0207670_11767976
1087 Ga0207669_10408037
1088 Ga0207704_10264995
1089 Ga0207704_11694851
1090 Ga0207665_11236660
1091 Ga0207691_10015161
1092 Ga0207691_11017746
1093 Ga0207711_10211408
1094 Ga0207711_10458241
1095 Ga0207711_10665256
1096 Ga0207689_10000425
1097 Ga0207689_10040379
1098 Ga0207689_10409390
1099 Ga0207689_10752059
1100 Ga0207661_10030238
1101 Ga0207679_10003606
1102 Ga0207667_10003229
1103 Ga0207651_10896820
1104 Ga0207712_10013031
1105 Ga0207712_10032621
1106 Ga0207712_10241516
1107 Ga0207668_10257348
1108 Ga0207668_10447670
1109 Ga0207668_10705574
1110 Ga0207640_10043658
1111 Ga0207640_11219760
1112 Ga0207658_10318974
1113 Ga0207703_10287440
1114 Ga0207703_10595001
1115 Ga0207639_10068980
1116 Ga0207678_10001467
1117 Ga0207708_10021275
1118 Ga0207708_11709513
1119 Ga0207702_10082235
1120 Ga0207702_11304503
1121 Ga0207641_10185378
1122 Ga0207648_10001313
1123 Ga0207648_10065151
1124 Ga0207648_10068928
1125 Ga0207648_10072453
1126 Ga0207648_10501739
1127 Ga0207676_10268284
1128 Ga0207676_10399403
1129 Ga0207674_10004140
1130 Ga0207674_10014924
1131 Ga0207674_10291874
1132 Ga0207675_100131809
1133 Ga0207675_100135053
1134 Ga0207675_100319581
1135 Ga0207675_100478487
1136 Ga0207683_10855890
1137 Ga0209970_1001329
1138 Ga0209588_1008766
1139 Ga0209971_1000005
1140 Ga0209971_1074177
1141 Ga0209966_1000010
1142 Ga0209998_10000023
1143 Ga0209974_10000464
1144 Ga0207428_10000276
1145 Ga0207428_10002151
1146 Ga0207428_10341066
1147 Ga0268265_10020825
1148 Ga0268265_10195095
1149 Ga0268265_10684843
1150 Ga0268265_11060640
1151 Ga0268265_11136131
1152 Ga0268264_10498572
1153 Ga0307408_100026418
1154 Ga0307408_100034196
1155 Ga0307408_100039290
1156 Ga0307408_100137310
1157 Ga0307406_10178355
1158 Ga0307407_10066601
1159 Ga0307407_10705561
1160 Ga0307407_11223838
1161 Ga0307412_10557767
1162 Ga0307409_101570994
1163 Ga0307416_100004866
1164 Ga0307411_10142688
1165 Ga0307411_10282796
1166 Ga0373930_0030737
1167 Ga0373948_0014616
1168 Ga0373948_0170063
1169 Ga0373950_0050057
1170 Ga0373958_0110114
1171 Ga0373940_0021007
1172 Ga0373949_0048902
1173 Ga0373952_0030493
1174 Ga0373932_0021309
1175 Ga0373939_0027201
1176 Ga0373941_0058453
1177 Ga0373960_0048327
1178 Ga0373942_0108599
1179 Ga0373961_0111893
1180 Ga0373962_0030135
1181 Ga0373962_0070683
1182 Ga0373931_0092538
1183 Ga0373931_0094613
1184 Ga0373931_0366816
1185 Ga0439437_010420
1186 Ga0439448_0000678
1187 Ga0439448_0178929
1188 Ga0439455_0178317
1189 Ga0439446_0033438
1190 Ga0439435_0138644
1191 Ga0439459_0001810
1192 Ga0439464_0010970
1193 Ga0439460_0000314
1194 Ga0439460_0009192
1195 Ga0451577_0020330
1196 Ga0451577_0061662
1197 Ga0451577_0087844
1198 Ga0451577_0515744
1199 Ga0453683_0097736
1200 Ga0453683_0320893
1201 Ga0453683_0910121
1202 Ga0453684_0018602
1203 Ga0453684_0090401
1204 Ga0453684_0158659
1205 Ga0453684_1358738
1206 Ga0451576_0020221
1207 Ga0451576_0025380
1208 Ga0451576_0093511
1209 Ga0451576_0199353
1210 Ga0451576_0391163
1211 Ga0451576_0432344
1212 Ga0451576_0566413
1213 Ga0451576_0891470
1214 Ga0451576_1215025
1215 Ga0495603_0299028
1216 Ga0495580_0056808
1217 Ga0495580_0072895
1218 Ga0495580_0225730
1219 Ga0495584_0339515
1220 Ga0495642_0020490
1221 Ga0495659_0176816
1222 Ga0495669_0047771
1223 Ga0495669_0146391
1224 Ga0495636_0373710
1225 Ga0496102_0007307
1226 Ga0496102_1131318
1227 Ga0496104_0892055
1228 Ga0496106_0060116
1229 Ga0496106_1061289
1230 Ga0496107_0085910
1231 Ga0496110_0473549
1232 Ga0496111_0850065
1233 Ga0496112_0218919
1234 Ga0496113_0415113
1235 Ga0501299_095204
1236 Ga0501031_0357848
1237 Ga0501032_0319516
1238 Ga0501033_0117179
1239 Ga0501033_0262998
1240 Ga0501033_0814189
1241 Ga0501036_0144176
1242 Ga0501036_0611248
1243 Ga0501036_0949446
1244 Ga0501036_1193533
1245 Ga0501037_0524867
1246 Ga0501038_0184818
1247 Ga0501038_0726646
1248 Ga0501038_0774743
1249 Ga0501039_0155566
1250 Ga0501039_0210052
1251 Ga0501039_0345818
1252 Ga0501039_0419009
1253 Ga0501039_0621844
1254 Ga0501039_0786284
1255 Ga0501039_0947231
1256 Ga0501040_0026323
1257 Ga0501040_0075516
1258 Ga0501040_0076278
1259 Ga0501040_0101684
1260 Ga0501040_0315227
1261 Ga0501041_0011242
1262 Ga0501041_0159947
1263 Ga0501041_0246972
1264 Ga0501041_0319184
1265 Ga0501041_0493600
1266 Ga0501042_0005993
1267 Ga0501042_0057825
1268 Ga0501042_0171699
1269 Ga0501042_0351755
1270 Ga0501042_0372617
1271 Ga0501043_0352345
1272 Ga0501046_0001215
1273 Ga0501046_0230206
1274 Ga0501046_0335770
1275 Ga0501046_0834752
1276 Ga0501046_0961231
1277 Ga0501046_0982382
1278 Ga0501048_0003092
1279 Ga0501048_0557232
1280 Ga0501067_0058067
1281 Ga0501068_0273894
1282 Ga0501068_0686071
1283 Ga0501068_0745954
1284 Ga0501068_0791675
1285 Ga0501070_0338160
1286 Ga0501070_0819961
1287 Ga0501071_0078047
1288 Ga0501071_0139077
1289 Ga0501071_0280335
1290 Ga0501071_0302233
1291 Ga0501071_0341413
1292 Ga0501071_0547476
1293 Ga0501072_0012951
1294 Ga0501072_0109297
1295 Ga0501072_0115943
1296 Ga0501072_0168463
1297 Ga0501072_0473286
1298 Ga0501072_0673704
1299 Ga0501074_0003061
1300 Ga0501074_0114202
1301 Ga0501074_0127291
1302 Ga0501074_0214874
1303 Ga0501074_0869184
1304 Ga0501075_0185274
1305 Ga0501075_0209333
1306 Ga0501075_0230422
1307 Ga0501075_0377033
1308 Ga0501076_0019298
1309 Ga0501076_0059592
1310 Ga0501076_0152449
1311 Ga0501076_0188647
1312 Ga0501076_0222472
1313 Ga0501076_0267343
1314 Ga0501076_0300220
1315 Ga0501076_0401878
1316 Ga0501077_0057986
1317 Ga0501077_0109311
1318 Ga0501077_0361130
1319 Ga0501077_0392313
1320 Ga0501077_0440374
1321 Ga0501079_0001522
1322 Ga0501079_0041460
1323 Ga0501079_0043307
1324 Ga0501079_0762764
1325 Ga0501080_0013705
1326 Ga0501080_0037206
1327 Ga0501080_0231465
1328 Ga0501080_0721672
1329 Ga0501080_0801028
1330 Ga0501081_0002787
1331 Ga0501081_0007340
1332 Ga0501081_0010136
1333 Ga0501081_0078980
1334 Ga0501081_0405674
1335 Ga0501081_0594472
1336 Ga0501081_1181392
1337 Ga0501083_0022373
1338 Ga0501083_0195764
1339 Ga0501035_0095058
1340 Ga0501035_0585371
1341 Ga0501035_0649979
1342 Ga0501044_1103412
1343 Ga0501045_0124625
1344 Ga0501045_0417446
1345 Ga0501045_0419771
1346 Ga0501045_0434612
1347 Ga0501045_1104305
1348 nmdc:mga05p37_1023567_c1
1349 nmdc:mga05p37_31017_c1
1350 nmdc:mga05p37_373856_c1
1351 nmdc:mga05p37_38013_c1
1352 nmdc:mga05p37_427775_c1
1353 nmdc:mga05p37_53621_c1
1354 nmdc:mga05p37_564309_c1
1355 nmdc:mga05p37_56888_c1
1356 nmdc:mga05p37_71433_c1
1357 nmdc:mga05p37_749931_c1
1358 nmdc:mga05p37_924934_c1
1359 nmdc:mga09592_1232_c1
1360 nmdc:mga09592_241146_c1
1361 nmdc:mga09592_250046_c1
1362 nmdc:mga09592_311085_c1
1363 nmdc:mga09592_32265_c1
1364 nmdc:mga09592_33628_c1
1365 nmdc:mga09592_786920_c1
1366 nmdc:mga0qj67_52361_c1
1367 nmdc:mga0qj67_5451_c1
1368 nmdc:mga06r32_1480353_c1
1369 nmdc:mga06r32_2190_c1
1370 nmdc:mga06r32_22649_c1
1371 nmdc:mga08y16_113120_c1
1372 nmdc:mga08y16_1158404_c1
1373 nmdc:mga08y16_34111_c1
1374 nmdc:mga08y16_82960_c1
1375 nmdc:mga08y16_93993_c1
1376 nmdc:mga0n895_10097_c1
1377 nmdc:mga0n895_1241776_c1
1378 nmdc:mga0n895_1323515_c1
1379 nmdc:mga0n895_1362905_c1
1380 nmdc:mga0n895_15398_c1
1381 nmdc:mga0n895_263814_c1
1382 nmdc:mga0n895_33008_c1
1383 nmdc:mga0n895_538100_c1
1384 nmdc:mga0n895_559006_c1
1385 nmdc:mga0n895_63951_c1
1386 nmdc:mga0n895_72925_c1
1387 nmdc:mga0n895_772592_c1
1388 nmdc:mga0rr50_279909_c1
1389 nmdc:mga0rr50_34163_c1
1390 nmdc:mga0rr50_34819_c1
1391 nmdc:mga0rr50_405061_c1
1392 nmdc:mga0rr50_476179_c1
1393 nmdc:mga0rr50_505669_c1
1394 nmdc:mga0rr50_652772_c1
1395 nmdc:mga0rr50_65554_c1
1396 nmdc:mga0rr50_909062_c1
1397 nmdc:mga08x19_13439_c1
1398 nmdc:mga08x19_219595_c1
1399 nmdc:mga08x19_24360_c1
1400 nmdc:mga08x19_312030_c1
1401 nmdc:mga08x19_64213_c1
1402 nmdc:mga08x19_96553_c1
1403 nmdc:mga0a205_142361_c1
1404 nmdc:mga0a205_148426_c1
1405 nmdc:mga0a205_182366_c1
1406 nmdc:mga0a205_18346_c1
1407 nmdc:mga0a205_21467_c1
1408 nmdc:mga0a205_354695_c1
1409 nmdc:mga0a205_48154_c1
1410 nmdc:mga0a205_493699_c1
1411 nmdc:mga0a205_57051_c1
1412 nmdc:mga0a205_8519_c1
1413 nmdc:mga0a205_890979_c1
1414 nmdc:mga0a205_99508_c1
1415 Ga0501084_0007636
1416 Ga0501084_0011856
1417 Ga0501084_0024808
1418 Ga0501084_0376331
1419 Ga0501084_0688237
1420 Ga0501084_0743704
1421 Ga0501084_0756738
1422 Ga0501084_0806842
1423 Ga0501084_0827122
1424 Ga0590071_056128
1425 Ga0501082_0001952
1426 Ga0501082_0068634
1427 Ga0501082_0249661
1428 Ga0501082_0258293
1429 Ga0501082_0827430
1430 Ga0501082_1277725
1431 Ga0530510_0014411
1432 Ga0530510_0032918
1433 Ga0530510_0104733
1434 Ga0530510_0108372
1435 Ga0530510_0109391
1436 Ga0530510_0214673
1437 Ga0530510_0306282
1438 Ga0530510_0362032

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03243

MerB

Alkylmercury lyase

91

165

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6bzo-assembly1.cif.gz_F mtb rnap holo/rbpa/fidaxomicin/upstream fork dna 0.9153 9 51
7c17-assembly1.cif.gz_F the cryo-em structure of e. coli cuer transcription activation complex with fully duplex promoter dna 0.9104 9 50
6xll-assembly1.cif.gz_F cryo-em structure of e. coli rnap-promoter initial transcribing complex with 5-nt rna transcript (rpitc-5nt) 0.9047 9 50
6cce-assembly1.cif.gz_F crystal structure of a mycobacterium smegmatis rna polymerase transcription initiation complex with inhibitor kanglemycin a 0.8828 9 51
7w5x-assembly1.cif.gz_F cryo-em structure of soxs-dependent transcription activation complex with zwf promoter dna 0.8752 9 51
ID Description Score Start End Superfamily
2vimA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8527 123 136 3.40.30.10
2f5eB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8477 7 55 1.10.10.10
3k2zA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8246 6 68 1.10.10.10
3keqB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8046 9 51 1.10.10.10
1jhhA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8025 5 68 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A3D1ZI29-F1-model_v4 Uncharacterized protein 0.9301 6 74
AF-A0A3D1ZI29-F1-model_v4 Uncharacterized protein 0.8815 6 74
AF-A0A1F8Y2Y9-F1-model_v4 RNA polymerase sigma factor 70 region 1.1 domain-containing protein 0.8503 7 77
AF-A0A2C9BNM9-F1-model_v4 deleted 0.8384 9 79
AF-A0A6L8SWV5-F1-model_v4 Winged helix-turn-helix transcriptional regulator 0.8325 9 67

Map