F477196

General Info

Members Datasets Scaffolds Average Seq Length
718 659 170 462

Family's Representative Sequence

Representative Sequence 3300049581|Ga0501047_0112404|Ga0501047_0112404_401_1855
Length 484
Sequence MGAGGGTGPLRMNDTLMAATDLQQPKSPSVETPGAVDTMRHAWRRFWRRVSLYMPKRLYARSLIIVIAPMFLLQSVVAFVFMERNWQTVTLLLSQSVVRDIAAIIDVMETYPHDADYANIIRIAQDRMQLKVDLLPPDPLPPPGPKPFFSTLDEPLSSEITRQINRPFWIDTVGNSKIIEVRIQLENKVLRVFVRRSQAYASNMQVFLLWMIGTSVVLLMIAIPFLRNQIKPILTLAEAAESFGKGRPMPQDFRPRGAEEVRRAGFAFIQMRERIERQIEQRTAMLTGVSHDLRTILTRFKLQLALTGKKGDIEAMNQDIDDMQSMLEGYIAFARGEAAEDTGRFDLNACLNKLTEEAALRKRTISTSLTGDSNVLVRPKAFARLLSNIVGNAFRYARTVEVKAVHGKGSLVVTVDDDGPGIAPAKREEVFKPFVRLDQARNLDSSGTGLGLAIARDIARSHGGDITLEDSPLGGLRAVIRIPA

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
3 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
4 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
5 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
6 2509276019 Ensifer aridi TW10 Isolate Nodule
7 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
8 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
9 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
10 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
11 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
12 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
13 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
14 2512875024 Mesorhizobium loti R88b Isolate Nodule
15 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
16 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
17 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
18 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
19 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
20 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
21 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
22 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
23 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
24 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
25 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
26 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
27 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
28 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
29 2516143018 Ensifer sp. BR816 Isolate Nodule
30 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
31 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
32 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
33 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
34 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
35 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
36 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
37 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
38 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
39 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
40 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
41 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
42 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
43 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
44 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
45 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
46 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
47 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
48 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
49 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
50 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
51 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
52 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
53 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
54 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
55 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
56 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
57 2643221557 Ensifer sp. Root558 Isolate Unclassified
58 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
59 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
60 2643221607 Rhizobium sp. Root73 Isolate Unclassified
61 2643221610 Ensifer sp. Root74 Isolate Unclassified
62 2643221618 Ensifer sp. Root231 Isolate Unclassified
63 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
64 2643221626 Ensifer sp. Root31 Isolate Unclassified
65 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
66 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
67 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
68 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
69 2643221655 Ensifer sp. Root1252 Isolate Unclassified
70 2643221659 Ensifer sp. Root127 Isolate Unclassified
71 2643221668 Ensifer sp. Root423 Isolate Unclassified
72 2643221675 Ensifer sp. Root1298 Isolate Unclassified
73 2643221680 Ensifer sp. Root1312 Isolate Unclassified
74 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
75 2643221688 Rhizobium sp. Root482 Isolate Unclassified
76 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
77 2643221698 Ensifer sp. Root142 Isolate Unclassified
78 2643221712 Ensifer sp. Root258 Isolate Unclassified
79 2643221718 Rhizobium sp. Root268 Isolate Unclassified
80 2643221719 Rhizobium sp. Root274 Isolate Unclassified
81 2643221723 Ensifer sp. Root278 Isolate Unclassified
82 2643221726 Ensifer sp. Root954 Isolate Unclassified
83 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
84 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
85 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
86 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
87 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
88 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
89 2738543024 Aminobacter sp. AP02 Isolate Unclassified
90 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
91 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
92 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
93 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
94 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
95 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
96 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
97 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
98 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
99 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
100 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
101 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
102 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
103 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
104 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
105 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
106 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
107 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
108 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
109 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
110 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
111 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
112 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
113 2844163670 Ensifer sp. 1H6 Isolate Unclassified
114 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
115 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
116 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
117 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
118 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
119 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
120 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
121 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
122 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
123 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
124 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
125 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
126 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
127 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
128 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
129 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
130 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
131 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
132 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
133 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
134 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
135 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
136 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
137 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
138 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
139 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
140 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
141 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
142 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
143 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
144 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
145 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
146 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
147 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
148 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
149 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
150 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
151 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
152 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
153 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
154 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
155 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
156 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
157 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
158 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
159 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
160 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
161 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
162 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
163 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
164 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
165 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
166 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
167 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
168 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
169 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
170 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
171 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
172 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
173 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
174 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
175 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
176 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
177 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
178 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
179 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
180 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
181 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
182 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
183 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
184 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
185 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
186 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
187 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
188 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
189 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
190 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
191 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
192 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
193 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
194 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
195 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
196 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
197 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
198 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
199 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
200 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
201 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
202 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
203 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
204 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
205 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
206 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
207 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
208 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
209 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
210 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
211 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
212 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
213 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
214 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
215 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
216 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
217 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
218 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
219 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
220 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
221 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
222 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
223 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
224 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
225 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
226 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
227 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
228 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
229 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
230 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
231 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
232 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
233 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
234 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
235 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
236 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
237 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
238 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
239 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
240 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
241 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
242 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
243 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
244 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
245 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
246 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
247 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
248 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
249 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
250 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
251 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
252 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
253 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
254 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
255 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
256 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
257 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
258 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
259 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
260 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
261 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
262 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
263 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
264 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
265 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
266 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
267 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
268 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
269 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
270 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
271 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
272 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
273 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
274 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
275 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
276 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
277 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
278 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
279 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
280 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
281 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
282 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
283 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
284 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
285 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
286 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
287 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
288 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
289 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
290 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
291 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
292 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
293 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
294 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
295 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
296 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
297 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
298 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
299 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
300 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
301 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
302 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
303 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
304 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
305 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
306 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
307 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
308 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
309 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
310 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
311 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
312 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
313 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
314 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
315 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
316 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
317 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
318 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
319 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
320 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
321 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
322 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
323 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
324 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
325 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
326 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
327 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
328 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
329 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
330 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
331 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
332 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
333 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
334 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
335 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
336 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
337 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
338 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
339 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
340 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
341 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
342 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
343 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
344 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
345 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
346 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
347 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
348 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
349 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
350 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
351 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
352 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
353 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
354 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
355 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
356 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
357 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
358 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
359 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
360 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
361 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
362 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
363 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
364 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
365 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
366 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
367 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
368 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
369 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
370 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
371 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
372 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
373 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
374 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
375 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
376 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
377 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
378 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
379 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
380 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
381 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
382 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
383 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
384 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
385 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
386 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
387 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
388 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
389 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
390 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
391 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
392 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
393 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
394 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
395 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
396 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
397 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
398 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
399 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
400 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
401 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
402 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
403 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
404 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
405 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
406 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
407 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
408 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
409 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
410 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
411 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
412 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
413 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
414 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
415 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
416 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
417 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
418 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
419 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
420 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
421 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
422 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
423 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
424 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
425 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
426 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
427 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
428 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
429 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
430 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
431 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
432 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
433 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
434 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
435 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
436 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
437 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
438 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
439 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
440 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
441 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
442 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
443 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
444 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
445 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
446 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
447 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
448 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
449 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
450 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
451 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
452 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
453 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
454 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
455 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
456 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
457 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
458 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
459 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
460 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
461 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
462 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
463 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
464 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
465 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
466 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
467 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
468 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
469 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
470 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
471 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
472 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
473 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
474 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
475 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
476 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
477 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
478 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
479 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
480 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
481 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
482 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
483 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
484 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
485 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
486 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
487 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
488 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
489 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
490 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
491 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
492 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
493 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
494 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
495 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
496 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
497 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
498 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
499 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
500 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
501 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
502 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
503 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
504 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
505 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
506 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
507 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
508 3004167301 Mesorhizobium loti 582 Isolate Unclassified
509 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
510 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
511 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
512 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
513 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
514 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
515 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
516 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
517 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
518 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
519 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
520 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
521 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
522 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
523 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
524 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
525 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
526 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
527 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
528 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
529 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
530 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
531 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
532 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
533 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
534 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
535 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
536 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
537 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
538 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
539 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
540 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
541 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
542 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
543 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
544 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
545 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
546 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
547 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
548 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
549 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
550 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
551 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
552 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
553 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
554 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
555 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
556 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
557 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
558 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
559 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
560 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
561 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
562 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
563 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
564 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
565 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
566 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
567 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
568 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
569 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
570 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
571 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
572 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
573 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
574 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
575 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
576 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
577 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
578 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
579 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
580 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
581 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
582 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
583 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
584 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
585 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
586 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
587 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
588 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
589 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
590 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
591 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
592 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
593 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
594 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
595 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
596 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
597 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
598 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
599 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
600 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
601 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
602 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
603 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
604 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
605 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
606 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
607 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
608 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
609 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
610 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
611 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
612 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
613 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
614 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
615 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
616 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
617 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
618 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
619 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
620 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
621 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
622 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
623 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
624 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
625 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
626 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
627 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
628 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
629 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
630 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
631 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
632 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
633 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
634 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
635 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
636 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
637 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
638 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
639 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
640 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
641 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
642 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
643 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
644 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
645 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
646 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
647 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
648 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
649 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
650 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
651 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
652 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
653 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
654 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
655 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
656 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
657 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
658 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
659 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 23.68
Metatranscriptomes 0
Isolates 76.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.99
Nodule 64.76
Rhizoplane 0.56
Rhizosphere 15.46
Stem 0
Stem Tuber 0
Unclassified 13.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10007252 3300001979 Bacteria 4519
2 JGI25156J39149_1003391 3300002705 Bacteria 5241
3 JGI25157J39369_1000755 3300002741 Bacteria 16931
4 JGI25159J45721_1000004 3300002987 Bacteria 215789
5 JGI25165J46597_1000006 3300003214 Bacteria 529784
6 JGI25160J50197_1000021 3300003354 Bacteria 215789
7 JGI25161J50226_1000218 3300003374 Bacteria 36216
8 Ga0055542_1001018 3300003762 Bacteria 17783
9 Ga0055526_1001422 3300003771 Bacteria 17040
10 Ga0055524_1002001 3300003775 Bacteria 10883
11 Ga0055536_1000269 3300003781 Bacteria 39889
12 Ga0055536_1003316 3300003781 Bacteria 8710
13 Ga0055531_10003470 3300003794 Bacteria 10028
14 Ga0055543_1000164 3300004625 Bacteria 55304
15 Ga0065165_1000033 3300005262 Bacteria 215827
16 Ga0068853_100013522 3300005539 Bacteria 6667
17 Ga0075365_10005021 3300006038 Bacteria 7093
18 Ga0075365_10029064 3300006038 Bacteria 3528
19 Ga0075365_10055068 3300006038 Bacteria 2639
20 Ga0075364_10008358 3300006051 Bacteria 6183
21 Ga0075364_10025707 3300006051 Bacteria 3749
22 Ga0075367_10018362 3300006178 Bacteria 3857
23 Ga0075369_10018746 3300006186 Bacteria 2820
24 Ga0105248_10324855 3300009177 Bacteria 1733
25 Ga0105237_10091801 3300009545 Bacteria 3026
26 Ga0105239_10086611 3300010375 Bacteria 3453
27 Ga0105239_10196942 3300010375 Bacteria 2256
28 Ga0157371_10002714 3300013102 Bacteria 16710
29 Ga0157369_10149071 3300013105 Bacteria 2473
30 Ga0171463_1017 3300013249 Bacteria 48649
31 Ga0157374_10322690 3300013296 Bacteria 1530
32 Ga0183363_1050 3300015690 Bacteria 38817
33 Ga0214544_1000010 3300021320 Bacteria 270164
34 Ga0214542_1000023 3300021321 Bacteria 191557
35 Ga0214542_1028547 3300021321 Bacteria 2397
36 Ga0214543_1000019 3300021327 Bacteria 267908
37 Ga0214543_1000022 3300021327 Bacteria 241930
38 Ga0228711_1000026 3300022739 Bacteria 101497
39 Ga0228710_1000005 3300022740 Bacteria 233531
40 Ga0209436_100276 3300025208 Bacteria 23572
41 Ga0209026_1000089 3300025250 Bacteria 175907
42 Ga0209148_1000124 3300025254 Bacteria 185123
43 Ga0209759_1000903 3300025256 Bacteria 22112
44 Ga0209759_1014776 3300025256 Bacteria 2047
45 Ga0209233_1000010 3300025261 Bacteria 1194329
46 Ga0209455_1000062 3300025272 Bacteria 335169
47 Ga0209130_1000017 3300025284 Bacteria 388431
48 Ga0209676_1000876 3300025292 Bacteria 38530
49 Ga0209025_1000161 3300025294 Bacteria 166506
50 Ga0209564_1000013 3300025295 Bacteria 775755
51 Ga0209050_1006499 3300025298 Bacteria 6896
52 Ga0209256_1000153 3300025299 Bacteria 144736
53 Ga0209256_1002058 3300025299 Bacteria 17780
54 Ga0207426_1000006 3300025302 Bacteria 1025969
55 Ga0209257_1008374 3300025304 Bacteria 5900
56 Ga0209257_1021721 3300025304 Bacteria 2320
57 Ga0207647_10005131 3300025904 Bacteria 9642
58 Ga0207695_10069593 3300025913 Bacteria 3601
59 Ga0207695_10078627 3300025913 Bacteria 3346
60 Ga0207671_10076843 3300025914 Bacteria 2499
61 Ga0207639_10014018 3300026041 Bacteria 5625
62 Ga0207678_10108430 3300026067 Bacteria 2369
63 Ga0207678_10146031 3300026067 Bacteria 2019
64 Ga0209281_1000380 3300027111 Bacteria 70330
65 Ga0209281_1000790 3300027111 Bacteria 29937
66 Ga0209282_1000006 3300027666 Bacteria 276998
67 Ga0307515_10000017 3300028794 Bacteria 550465
68 Ga0307515_10001903 3300028794 Bacteria 46429
69 Ga0307515_10016193 3300028794 Bacteria 13668
70 Ga0307515_10193729 3300028794 Bacteria 1933
71 Ga0307513_10002030 3300031456 Bacteria 28510
72 Ga0307513_10085993 3300031456 Bacteria 3226
73 Ga0307408_100074293 3300031548 Bacteria 2522
74 Ga0315914_1000003 3300031967 Bacteria 314370
75 Ga0315913_1000001 3300033430 Bacteria 284459
76 Ga0315915_1000150 3300033464 Bacteria 55572
77 Ga0373925_0007826 3300037068 Bacteria 7782
78 Ga0395899_0000242 3300037312 Bacteria 72733
79 Ga0395900_0000318 3300037418 Bacteria 71328
80 Ga0395898_0000547 3300037466 Bacteria 71322
81 Ga0395905_0000305 3300037471 Bacteria 71315
82 Ga0395905_0000571 3300037471 Bacteria 49947
83 Ga0395905_0007862 3300037471 Bacteria 10560
84 Ga0395905_0062728 3300037471 Bacteria 3476
85 Ga0395901_0000093 3300038443 Bacteria 120300
86 Ga0395901_0051420 3300038443 Bacteria 4284
87 Ga0439436_0000675 3300041404 Bacteria 9161
88 Ga0439438_017582 3300041405 Bacteria 2053
89 Ga0439439_0006761 3300041406 Bacteria 2660
90 Ga0439465_0001804 3300041413 Bacteria 7010
91 Ga0450906_000779 3300042145 Bacteria 6947
92 Ga0439434_0026948 3300042435 Bacteria 1736
93 Ga0466972_0009870 3300044658 Bacteria 4792
94 Ga0466960_0003996 3300044901 Bacteria 5733
95 Ga0495638_0011460 3300046460 Bacteria 6108
96 Ga0495638_0051458 3300046460 Bacteria 2569
97 Ga0495625_0018879 3300046660 Bacteria 5369
98 Ga0495625_0041874 3300046660 Bacteria 3331
99 Ga0496104_0155608 3300048907 Bacteria 2194
100 Ga0496116_0000345 3300048919 Bacteria 73956
101 Ga0496119_0081379 3300048922 Bacteria 1865
102 Ga0496120_0004279 3300048923 Bacteria 12121
103 Ga0496121_0001531 3300048924 Bacteria 38692
104 Ga0496126_0000166 3300048929 Bacteria 152470
105 Ga0496126_0033096 3300048929 Bacteria 4865
106 Ga0496126_0120893 3300048929 Bacteria 2271
107 Ga0501031_0000021 3300049568 Bacteria 95923
108 Ga0501031_0039441 3300049568 Bacteria 3081
109 Ga0501032_0000053 3300049569 Bacteria 100933
110 Ga0501032_0003703 3300049569 Bacteria 11604
111 Ga0501033_0000135 3300049570 Bacteria 71278
112 Ga0501033_0000706 3300049570 Bacteria 30703
113 Ga0501033_0000761 3300049570 Bacteria 29642
114 Ga0501033_0001973 3300049570 Bacteria 17875
115 Ga0501034_0000317 3300049571 Bacteria 85341
116 Ga0501034_0009472 3300049571 Bacteria 10192
117 Ga0501036_0000026 3300049572 Bacteria 100963
118 Ga0501037_0000140 3300049573 Bacteria 67467
119 Ga0501037_0000818 3300049573 Bacteria 23265
120 Ga0501038_0000022 3300049574 Bacteria 151623
121 Ga0501039_0000030 3300049575 Bacteria 130049
122 Ga0501043_0000124 3300049579 Bacteria 70977
123 Ga0501043_0000967 3300049579 Bacteria 25402
124 Ga0501043_0015871 3300049579 Bacteria 5903
125 Ga0501043_0090233 3300049579 Bacteria 2409
126 Ga0501047_0002052 3300049581 Bacteria 19253
127 Ga0501047_0002661 3300049581 Bacteria 16996
128 Ga0501047_0015713 3300049581 Bacteria 7212
129 Ga0501047_0112404 3300049581 Bacteria 2606
130 Ga0501067_0025622 3300049583 Bacteria 3269
131 Ga0501068_0010248 3300049584 Bacteria 5260
132 Ga0501069_0000004 3300049585 Bacteria 192353
133 Ga0501069_0001931 3300049585 Bacteria 10354
134 Ga0501070_0000148 3300049586 Bacteria 64874
135 Ga0501070_0000694 3300049586 Bacteria 30882
136 Ga0501070_0001919 3300049586 Bacteria 18354
137 Ga0501070_0024847 3300049586 Bacteria 5024
138 Ga0501070_0142628 3300049586 Bacteria 1978
139 Ga0501070_0204109 3300049586 Bacteria 1623
140 Ga0501071_0025002 3300049587 Bacteria 4181
141 Ga0501071_0026559 3300049587 Bacteria 4066
142 Ga0501073_0073715 3300049589 Bacteria 2377
143 Ga0501074_0000006 3300049590 Bacteria 112293
144 Ga0501074_0020074 3300049590 Bacteria 4856
145 Ga0501080_0003339 3300049742 Bacteria 14170
146 Ga0501080_0005406 3300049742 Bacteria 11390
147 Ga0501080_0048480 3300049742 Bacteria 3953
148 Ga0501083_0000066 3300049744 Bacteria 71496
149 Ga0501035_0000011 3300049822 Bacteria 305794
150 Ga0501035_0000065 3300049822 Bacteria 129986
151 Ga0501035_0001755 3300049822 Bacteria 21897
152 Ga0501035_0001833 3300049822 Bacteria 21395
153 Ga0501035_0005312 3300049822 Bacteria 12184
154 Ga0501044_0000043 3300049823 Bacteria 151623
155 Ga0501044_0000803 3300049823 Bacteria 37863
156 Ga0501044_0006671 3300049823 Bacteria 12724
157 Ga0501044_0014696 3300049823 Bacteria 8442
158 Ga0501044_0019335 3300049823 Bacteria 7288
159 Ga0501045_0003000 3300049824 Bacteria 11554
160 nmdc:mga00v17_241_c1 3300050491 Bacteria 32423
161 nmdc:mga0yw44_33403_c1 3300050492 Bacteria 3006
162 nmdc:mga0yw44_9634_c1 3300050492 Bacteria 4899
163 nmdc:mga0sz30_52859_c1 3300050516 Bacteria 1725
164 Ga0500559_0003305 3300053136 Bacteria 7999
165 Ga0500573_0000897 3300053140 Bacteria 13507
166 Ga0500616_0015042 3300053153 Bacteria 4434
167 Ga0500620_006007 3300053155 Bacteria 2867
168 Ga0500622_0002353 3300053156 Bacteria 13743
169 Ga0500636_0000003 3300053177 Bacteria 240189
170 Ga0501082_0053386 3300060353 Bacteria 3484

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013102 Ga0157371_10002714 Ga0157371_1000271419 414
2 3300048919 Ga0496116_0000345 Ga0496116_0000345_35308_36687 414
3 3300048929 Ga0496126_0000166 Ga0496126_0000166_89438_90817 414
4 3300049585 Ga0501069_0001931 Ga0501069_0001931_9082_10332 416
5 3300037068 Ga0373925_0007826 Ga0373925_0007826_2603_3976 418
6 3300053156 Ga0500622_0002353 Ga0500622_0002353_252_1658 421
7 iso_pu_bacteria 2643221607 2644050295 423
8 iso_pu_bacteria 2643221636 2644204643 423
9 iso_pu_bacteria 2643221686 2644483215 423
10 iso_pu_bacteria 2551306086 2551691760 424
11 iso_pu_bacteria 2551306087 2551700906 424
12 iso_pu_bacteria 2551306089 2551713306 424
13 iso_pu_bacteria 2551306091 2551726821 424
14 iso_pu_bacteria 2551306092 2551737030 424
15 3300046460 Ga0495638_0051458 Ga0495638_0051458_47_1453 425
16 3300042435 Ga0439434_0026948 Ga0439434_0026948_436_1722 427
17 iso_pu_bacteria 3004195979 3004197145 429
18 3300049569 Ga0501032_0003703 Ga0501032_0003703_10298_11590 430
19 3300037471 Ga0395905_0007862 Ga0395905_0007862_7628_9022 434
20 3300053177 Ga0500636_0000003 Ga0500636_0000003_138546_139925 434
21 3300028794 Ga0307515_10016193 Ga0307515_1001619312 436
22 3300028794 Ga0307515_10193729 Ga0307515_101937292 439
23 3300053136 Ga0500559_0003305 Ga0500559_0003305_2990_4381 439
24 iso_pu_bacteria 2915650412 2915653242 442
25 iso_pu_bacteria 2513237305 2514419414 443
26 iso_pu_bacteria 2693429783 2694631260 443
27 iso_pu_bacteria 2693429784 2694638742 443
28 iso_pu_bacteria 2551306090 2551718979 444
29 3300010375 Ga0105239_10196942 Ga0105239_101969422 445
30 3300037471 Ga0395905_0000571 Ga0395905_0000571_39306_40700 447
31 3300049583 Ga0501067_0025622 Ga0501067_0025622_1876_3219 447
32 iso_pu_bacteria 2791355253 2793280168 447
33 iso_pu_bacteria 2968138860 2968143061 447
34 iso_pu_bacteria 2599185156 2599331955 449
35 iso_pu_bacteria 2842922631 2842924290 449
36 iso_pu_bacteria 2551306093 2551745735 450
37 iso_pu_bacteria 2643221688 2644494362 450
38 iso_pu_bacteria 2881845957 2881849978 450
39 iso_pu_bacteria 8005658619 8005658922 450
40 iso_pu_bacteria 2508501122 2509108206 451
41 iso_pu_bacteria 2513237159 2513997744 451
42 iso_pu_bacteria 2582581283 2585167382 451
43 iso_pu_bacteria 2582581306 2585265603 451
44 iso_pu_bacteria 2582581865 2585388808 451
45 iso_pu_bacteria 2582581866 2585395488 451
46 iso_pu_bacteria 2643221637 2644208850 451
47 iso_pu_bacteria 2643221689 2644499773 451
48 iso_pu_bacteria 2643221718 2644652380 451
49 iso_pu_bacteria 2791355091 2792620630 451
50 iso_pu_bacteria 2791355092 2792625989 451
51 iso_pu_bacteria 2842521101 2842522008 451
52 iso_pu_bacteria 2913295892 2913299182 451
53 iso_pu_bacteria 2970136068 2970137623 451
54 iso_pu_bacteria 8055431914 8055432465 451
55 3300028794 Ga0307515_10001903 Ga0307515_1000190317 452
56 3300031456 Ga0307513_10085993 Ga0307513_100859933 452
57 iso_pu_bacteria 2509276019 2509376616 452
58 iso_pu_bacteria 2510065057 2510305271 452
59 iso_pu_bacteria 2511231052 2511502409 452
60 iso_pu_bacteria 2512047086 2512533789 452
61 iso_pu_bacteria 2512875026 2512970465 452
62 iso_pu_bacteria 2513237086 2513585055 452
63 iso_pu_bacteria 2513237089 2513601530 452
64 iso_pu_bacteria 2513237091 2513618100 452
65 iso_pu_bacteria 2513237140 2513884522 452
66 iso_pu_bacteria 2513237143 2513904436 452
67 iso_pu_bacteria 2513237156 2513986566 452
68 iso_pu_bacteria 2513237160 2514003025 452
69 iso_pu_bacteria 2515154107 2515609208 452
70 iso_pu_bacteria 2516143018 2516206245 452
71 iso_pu_bacteria 2516653046 2516893786 452
72 iso_pu_bacteria 2517487022 2517570497 452
73 iso_pu_bacteria 2524023207 2524448391 452
74 iso_pu_bacteria 2551306084 2551679423 452
75 iso_pu_bacteria 2551306085 2551683551 452
76 iso_pu_bacteria 2551306085 2551688241 452
77 iso_pu_bacteria 2558860100 2558864023 452
78 iso_pu_bacteria 2585427633 2585996593 452
79 iso_pu_bacteria 2585427634 2586001121 452
80 iso_pu_bacteria 2599185352 2600194773 452
81 iso_pu_bacteria 2643221557 2643804267 452
82 iso_pu_bacteria 2643221610 2644064959 452
83 iso_pu_bacteria 2643221618 2644106985 452
84 iso_pu_bacteria 2643221626 2644148729 452
85 iso_pu_bacteria 2643221655 2644309945 452
86 iso_pu_bacteria 2643221659 2644331091 452
87 iso_pu_bacteria 2643221668 2644376632 452
88 iso_pu_bacteria 2643221675 2644416632 452
89 iso_pu_bacteria 2643221680 2644449672 452
90 iso_pu_bacteria 2643221698 2644543821 452
91 iso_pu_bacteria 2643221712 2644616400 452
92 iso_pu_bacteria 2643221723 2644675895 452
93 iso_pu_bacteria 2643221726 2644689804 452
94 iso_pu_bacteria 2657244999 2657681670 452
95 iso_pu_bacteria 2690316117 2692315364 452
96 iso_pu_bacteria 2751185821 2753462303 452
97 iso_pu_bacteria 2791355094 2792638930 452
98 iso_pu_bacteria 2802428858 2802716822 452
99 iso_pu_bacteria 2802428859 2802725634 452
100 iso_pu_bacteria 2802428860 2802730276 452
101 iso_pu_bacteria 2802428861 2802737753 452
102 iso_pu_bacteria 2802428862 2802742857 452
103 iso_pu_bacteria 2802428863 2802750281 452
104 iso_pu_bacteria 2802429268 2804752858 452
105 iso_pu_bacteria 2838074704 2838076708 452
106 iso_pu_bacteria 2844163670 2844164093 452
107 iso_pu_bacteria 2847417321 2847419575 452
108 iso_pu_bacteria 2848992105 2848994577 452
109 iso_pu_bacteria 2850079185 2850081615 452
110 iso_pu_bacteria 2855825444 2855826511 452
111 iso_pu_bacteria 2855839649 2855841902 452
112 iso_pu_bacteria 2855872281 2855872325 452
113 iso_pu_bacteria 2858800743 2858803701 452
114 iso_pu_bacteria 2896384573 2896392149 452
115 iso_pu_bacteria 2915980308 2915982934 452
116 iso_pu_bacteria 2915986958 2915989534 452
117 iso_pu_bacteria 2915993759 2915998399 452
118 iso_pu_bacteria 2916000859 2916003860 452
119 iso_pu_bacteria 2916007675 2916011784 452
120 iso_pu_bacteria 2916014648 2916019622 452
121 iso_pu_bacteria 2916021584 2916023776 452
122 iso_pu_bacteria 2916028427 2916031924 452
123 iso_pu_bacteria 2916035215 2916037630 452
124 iso_pu_bacteria 2916041962 2916046101 452
125 iso_pu_bacteria 2916048683 2916050326 452
126 iso_pu_bacteria 2916055098 2916058015 452
127 iso_pu_bacteria 2916061851 2916066392 452
128 iso_pu_bacteria 2916068649 2916068825 452
129 iso_pu_bacteria 2916076590 2916082312 452
130 iso_pu_bacteria 2920760137 2920761368 452
131 iso_pu_bacteria 2920822456 2920825417 452
132 iso_pu_bacteria 2921201388 2921203896 452
133 iso_pu_bacteria 2921208531 2921211782 452
134 iso_pu_bacteria 2921237296 2921243004 452
135 iso_pu_bacteria 2921244191 2921246047 452
136 iso_pu_bacteria 2921250672 2921253783 452
137 iso_pu_bacteria 2921257292 2921260856 452
138 iso_pu_bacteria 2921263974 2921266876 452
139 iso_pu_bacteria 2921282425 2921286475 452
140 iso_pu_bacteria 2921289301 2921294996 452
141 iso_pu_bacteria 2921296804 2921300199 452
142 iso_pu_bacteria 2924144063 2924147476 452
143 iso_pu_bacteria 2924150972 2924156806 452
144 iso_pu_bacteria 2924158325 2924160905 452
145 iso_pu_bacteria 2924165586 2924171520 452
146 iso_pu_bacteria 2924172951 2924175396 452
147 iso_pu_bacteria 2924179722 2924182595 452
148 iso_pu_bacteria 2924186466 2924189187 452
149 iso_pu_bacteria 2924193448 2924197023 452
150 iso_pu_bacteria 2924200457 2924206938 452
151 iso_pu_bacteria 2924207177 2924208028 452
152 iso_pu_bacteria 2924214083 2924214420 452
153 iso_pu_bacteria 2924221636 2924228472 452
154 iso_pu_bacteria 2924228884 2924232244 452
155 iso_pu_bacteria 2936996657 2937002671 452
156 iso_pu_bacteria 2937002841 2937005684 452
157 iso_pu_bacteria 2937009748 2937012261 452
158 iso_pu_bacteria 2937016420 2937019256 452
159 iso_pu_bacteria 2937023124 2937027535 452
160 iso_pu_bacteria 2937029754 2937030985 452
161 iso_pu_bacteria 2937036028 2937038382 452
162 iso_pu_bacteria 2937042894 2937048148 452
163 iso_pu_bacteria 2937049772 2937054159 452
164 iso_pu_bacteria 2937056579 2937061112 452
165 iso_pu_bacteria 2937063883 2937069002 452
166 iso_pu_bacteria 2937071275 2937074573 452
167 iso_pu_bacteria 2937078374 2937080589 452
168 iso_pu_bacteria 2937084907 2937090762 452
169 iso_pu_bacteria 2937091812 2937098021 452
170 iso_pu_bacteria 2937098957 2937102364 452
171 iso_pu_bacteria 2937106411 2937111983 452
172 iso_pu_bacteria 2937113482 2937117785 452
173 iso_pu_bacteria 2937119839 2937122961 452
174 iso_pu_bacteria 2937126314 2937131782 452
175 iso_pu_bacteria 2941499720 2941504802 452
176 iso_pu_bacteria 2957375807 2957380797 452
177 iso_pu_bacteria 2957382221 2957385382 452
178 iso_pu_bacteria 2957388812 2957392038 452
179 iso_pu_bacteria 2957395598 2957401816 452
180 iso_pu_bacteria 2957402308 2957405848 452
181 iso_pu_bacteria 2957408893 2957414407 452
182 iso_pu_bacteria 2957415311 2957420408 452
183 iso_pu_bacteria 2957422303 2957425430 452
184 iso_pu_bacteria 2957430029 2957433436 452
185 iso_pu_bacteria 2957437181 2957440618 452
186 iso_pu_bacteria 2957443900 2957445616 452
187 iso_pu_bacteria 2957450854 2957457158 452
188 iso_pu_bacteria 2957457609 2957460527 452
189 iso_pu_bacteria 2957464669 2957469009 452
190 iso_pu_bacteria 2957471148 2957473005 452
191 iso_pu_bacteria 2957478035 2957481380 452
192 iso_pu_bacteria 2957484790 2957487889 452
193 iso_pu_bacteria 2957491536 2957493060 452
194 iso_pu_bacteria 2957498199 2957500004 452
195 iso_pu_bacteria 2957505466 2957512152 452
196 iso_pu_bacteria 2960584000 2960590659 452
197 iso_pu_bacteria 2960591022 2960594122 452
198 iso_pu_bacteria 2960597568 2960603778 452
199 iso_pu_bacteria 2960603979 2960606368 452
200 iso_pu_bacteria 2960610863 2960615751 452
201 iso_pu_bacteria 2960617483 2960619776 452
202 iso_pu_bacteria 2960624210 2960627328 452
203 iso_pu_bacteria 2960631154 2960635119 452
204 iso_pu_bacteria 2960637947 2960643866 452
205 iso_pu_bacteria 2960645483 2960648935 452
206 iso_pu_bacteria 2960652885 2960658228 452
207 iso_pu_bacteria 2960660292 2960662989 452
208 iso_pu_bacteria 2960667422 2960668103 452
209 iso_pu_bacteria 2960674078 2960677866 452
210 iso_pu_bacteria 2960680706 2960680913 452
211 iso_pu_bacteria 2960687367 2960690991 452
212 iso_pu_bacteria 2960693952 2960698352 452
213 iso_pu_bacteria 2964607997 2964608835 452
214 iso_pu_bacteria 2964615318 2964620782 452
215 iso_pu_bacteria 2964621998 2964625588 452
216 iso_pu_bacteria 2964628898 2964631345 452
217 iso_pu_bacteria 2964636051 2964642881 452
218 iso_pu_bacteria 2964643177 2964643827 452
219 iso_pu_bacteria 2964649959 2964652384 452
220 iso_pu_bacteria 2964656573 2964659926 452
221 iso_pu_bacteria 2964663802 2964665400 452
222 iso_pu_bacteria 2964670856 2964675492 452
223 iso_pu_bacteria 2964678106 2964679672 452
224 iso_pu_bacteria 2964685014 2964685403 452
225 iso_pu_bacteria 2964691889 2964697498 452
226 iso_pu_bacteria 2964698721 2964700916 452
227 iso_pu_bacteria 2964705432 2964707834 452
228 iso_pu_bacteria 2964712639 2964718106 452
229 iso_pu_bacteria 2964719344 2964724205 452
230 iso_pu_bacteria 2967664464 2967669021 452
231 iso_pu_bacteria 2967671571 2967673882 452
232 iso_pu_bacteria 2967678726 2967680410 452
233 iso_pu_bacteria 2967686174 2967691157 452
234 iso_pu_bacteria 2967693043 2967695937 452
235 iso_pu_bacteria 2967699805 2967701718 452
236 iso_pu_bacteria 2967706974 2967711922 452
237 iso_pu_bacteria 2967714385 2967717419 452
238 iso_pu_bacteria 2967721400 2967725497 452
239 iso_pu_bacteria 2967728569 2967729391 452
240 iso_pu_bacteria 2967735183 2967735830 452
241 iso_pu_bacteria 2967742019 2967748036 452
242 iso_pu_bacteria 2967748971 2967750761 452
243 iso_pu_bacteria 2967755722 2967758605 452
244 iso_pu_bacteria 2967762386 2967764920 452
245 iso_pu_bacteria 2967769361 2967774986 452
246 iso_pu_bacteria 2967775926 2967780971 452
247 iso_pu_bacteria 2970019648 2970025562 452
248 iso_pu_bacteria 2970026789 2970028119 452
249 iso_pu_bacteria 2970033650 2970036875 452
250 iso_pu_bacteria 2970040964 2970043771 452
251 iso_pu_bacteria 2970047711 2970053311 452
252 iso_pu_bacteria 2970054988 2970058550 452
253 iso_pu_bacteria 2970061556 2970068700 452
254 iso_pu_bacteria 2970068827 2970074793 452
255 iso_pu_bacteria 2970076120 2970078569 452
256 iso_pu_bacteria 2970082768 2970086552 452
257 iso_pu_bacteria 2970088815 2970090561 452
258 iso_pu_bacteria 2970095765 2970098509 452
259 iso_pu_bacteria 2970102677 2970104068 452
260 iso_pu_bacteria 2970109326 2970111728 452
261 iso_pu_bacteria 2970116247 2970118819 452
262 iso_pu_bacteria 2970122695 2970126548 452
263 iso_pu_bacteria 2970129317 2970132000 452
264 iso_pu_bacteria 2970143518 2970145786 452
265 iso_pu_bacteria 2970149975 2970152387 452
266 iso_pu_bacteria 2970156795 2970161497 452
267 iso_pu_bacteria 2970164137 2970164468 452
268 iso_pu_bacteria 2970170962 2970175273 452
269 iso_pu_bacteria 2970177841 2970180614 452
270 iso_pu_bacteria 2970184632 2970188859 452
271 iso_pu_bacteria 2970191845 2970194738 452
272 iso_pu_bacteria 2977516862 2977523146 452
273 iso_pu_bacteria 2977523885 2977524799 452
274 iso_pu_bacteria 2977530762 2977535661 452
275 iso_pu_bacteria 2977537788 2977541146 452
276 iso_pu_bacteria 2977544691 2977549362 452
277 iso_pu_bacteria 2977551784 2977553722 452
278 iso_pu_bacteria 2977558990 2977562550 452
279 iso_pu_bacteria 2977565890 2977566640 452
280 iso_pu_bacteria 2977572785 2977576010 452
281 iso_pu_bacteria 2977579622 2977584605 452
282 iso_pu_bacteria 3003930520 3003934380 452
283 iso_pu_bacteria 643692032 643826483 452
284 iso_pu_bacteria 648276728 648738134 452
285 iso_pu_bacteria 8003992118 8003994333 452
286 iso_pu_bacteria 8003999396 8004002032 452
287 iso_pu_bacteria 8056875544 8056875704 452
288 3300006038 Ga0075365_10029064 Ga0075365_100290641 453
289 3300046460 Ga0495638_0011460 Ga0495638_0011460_4169_5554 453
290 3300048922 Ga0496119_0081379 Ga0496119_0081379_231_1595 453
291 3300050492 nmdc:mga0yw44_33403_c1 nmdc:mga0yw44_33403_c1_288_1649 453
292 iso_pu_bacteria 2643221653 2644298786 453
293 iso_pu_bacteria 2643221719 2644657015 453
294 iso_pu_bacteria 2775507049 2776914100 453
295 iso_pu_bacteria 2791355082 2792585012 453
296 iso_pu_bacteria 2818991272 2819241213 453
297 iso_pu_bacteria 2856342000 2856342078 453
298 iso_pu_bacteria 2888343758 2888346074 453
299 iso_pu_bacteria 2899803654 2899804215 453
300 iso_pu_bacteria 2922178524 2922180772 453
301 iso_pu_bacteria 2989771324 2989775724 453
302 iso_pu_bacteria 2989776772 2989779343 453
303 iso_pu_bacteria 8004727605 8004733554 453
304 iso_pu_bacteria 8005246636 8005248889 453
305 iso_pu_bacteria 8049293176 8049295442 453
306 3300021320 Ga0214544_1000010 Ga0214544_100001065 455
307 3300021321 Ga0214542_1000023 Ga0214542_1000023187 455
308 3300021327 Ga0214543_1000019 Ga0214543_1000019262 455
309 3300025304 Ga0209257_1021721 Ga0209257_10217213 455
310 3300031548 Ga0307408_100074293 Ga0307408_1000742932 455
311 3300041404 Ga0439436_0000675 Ga0439436_0000675_3738_5117 455
312 3300041405 Ga0439438_017582 Ga0439438_017582_646_2025 455
313 3300041406 Ga0439439_0006761 Ga0439439_0006761_130_1509 455
314 3300041413 Ga0439465_0001804 Ga0439465_0001804_4296_5675 455
315 3300042145 Ga0450906_000779 Ga0450906_000779_5123_6502 455
316 3300046660 Ga0495625_0018879 Ga0495625_0018879_1348_2727 455
317 3300053153 Ga0500616_0015042 Ga0500616_0015042_316_1707 455
318 3300002987 JGI25159J45721_1000004 JGI25159J45721_1000004141 456
319 3300003354 JGI25160J50197_1000021 JGI25160J50197_100002169 456
320 3300003374 JGI25161J50226_1000218 JGI25161J50226_100021818 456
321 3300003771 Ga0055526_1001422 Ga0055526_100142219 456
322 3300003775 Ga0055524_1002001 Ga0055524_10020018 456
323 3300003781 Ga0055536_1000269 Ga0055536_100026916 456
324 3300003781 Ga0055536_1003316 Ga0055536_100331611 456
325 3300003794 Ga0055531_10003470 Ga0055531_1000347012 456
326 3300004625 Ga0055543_1000164 Ga0055543_100016411 456
327 3300005262 Ga0065165_1000033 Ga0065165_100003369 456
328 3300006051 Ga0075364_10008358 Ga0075364_100083584 456
329 3300013249 Ga0171463_1017 Ga0171463_101726 456
330 3300015690 Ga0183363_1050 Ga0183363_105017 456
331 3300021321 Ga0214542_1028547 Ga0214542_10285472 456
332 3300021327 Ga0214543_1000022 Ga0214543_100002240 456
333 3300022739 Ga0228711_1000026 Ga0228711_100002678 456
334 3300022740 Ga0228710_1000005 Ga0228710_100000550 456
335 3300025208 Ga0209436_100276 Ga0209436_1002769 456
336 3300025284 Ga0209130_1000017 Ga0209130_1000017312 456
337 3300025292 Ga0209676_1000876 Ga0209676_100087625 456
338 3300025294 Ga0209025_1000161 Ga0209025_1000161138 456
339 3300025295 Ga0209564_1000013 Ga0209564_1000013760 456
340 3300025298 Ga0209050_1006499 Ga0209050_10064995 456
341 3300025299 Ga0209256_1000153 Ga0209256_100015310 456
342 3300025299 Ga0209256_1002058 Ga0209256_10020588 456
343 3300025302 Ga0207426_1000006 Ga0207426_1000006311 456
344 3300025304 Ga0209257_1008374 Ga0209257_10083745 456
345 3300027111 Ga0209281_1000380 Ga0209281_100038045 456
346 3300027111 Ga0209281_1000790 Ga0209281_10007901 456
347 3300027666 Ga0209282_1000006 Ga0209282_100000621 456
348 3300031967 Ga0315914_1000003 Ga0315914_100000376 456
349 3300033430 Ga0315913_1000001 Ga0315913_100000128 456
350 3300033464 Ga0315915_1000150 Ga0315915_10001501 456
351 3300050491 nmdc:mga00v17_241_c1 nmdc:mga00v17_241_c1_19946_21325 456
352 3300048924 Ga0496121_0001531 Ga0496121_0001531_16371_17753 457
353 3300048929 Ga0496126_0120893 Ga0496126_0120893_634_2016 457
354 3300049570 Ga0501033_0000706 Ga0501033_0000706_8641_10044 457
355 3300053140 Ga0500573_0000897 Ga0500573_0000897_9152_10534 457
356 iso_pu_bacteria 2510461069 2510839557 457
357 3300028794 Ga0307515_10000017 Ga0307515_1000001723 458
358 3300031456 Ga0307513_10002030 Ga0307513_1000203023 458
359 3300049568 Ga0501031_0039441 Ga0501031_0039441_635_2068 459
360 3300049570 Ga0501033_0001973 Ga0501033_0001973_8030_9463 459
361 3300049571 Ga0501034_0009472 Ga0501034_0009472_6104_7537 459
362 3300049579 Ga0501043_0015871 Ga0501043_0015871_3886_5319 459
363 3300049581 Ga0501047_0015713 Ga0501047_0015713_5072_6505 459
364 3300049589 Ga0501073_0073715 Ga0501073_0073715_14_1447 459
365 3300049822 Ga0501035_0001833 Ga0501035_0001833_8165_9598 459
366 3300049823 Ga0501044_0006671 Ga0501044_0006671_403_1836 459
367 3300049824 Ga0501045_0003000 Ga0501045_0003000_9704_11137 459
368 3300049586 Ga0501070_0000694 Ga0501070_0000694_10308_11774 460
369 3300049590 Ga0501074_0020074 Ga0501074_0020074_3373_4839 460
370 3300049742 Ga0501080_0003339 Ga0501080_0003339_9116_10582 460
371 3300049822 Ga0501035_0005312 Ga0501035_0005312_1407_2873 460
372 3300037312 Ga0395899_0000242 Ga0395899_0000242_20880_22292 463
373 3300037418 Ga0395900_0000318 Ga0395900_0000318_49040_50452 463
374 3300037466 Ga0395898_0000547 Ga0395898_0000547_20871_22283 463
375 3300037471 Ga0395905_0000305 Ga0395905_0000305_49040_50452 463
376 3300038443 Ga0395901_0000093 Ga0395901_0000093_20852_22264 463
377 3300049568 Ga0501031_0000021 Ga0501031_0000021_45361_46770 464
378 3300049569 Ga0501032_0000053 Ga0501032_0000053_49154_50563 464
379 3300049570 Ga0501033_0000135 Ga0501033_0000135_50383_51792 464
380 3300049571 Ga0501034_0000317 Ga0501034_0000317_5684_7093 464
381 3300049572 Ga0501036_0000026 Ga0501036_0000026_49166_50575 464
382 3300049573 Ga0501037_0000140 Ga0501037_0000140_20580_21989 464
383 3300049574 Ga0501038_0000022 Ga0501038_0000022_71966_73375 464
384 3300049575 Ga0501039_0000030 Ga0501039_0000030_78249_79658 464
385 3300049579 Ga0501043_0000967 Ga0501043_0000967_20384_21793 464
386 3300049581 Ga0501047_0002661 Ga0501047_0002661_15099_16508 464
387 3300049586 Ga0501070_0024847 Ga0501070_0024847_2930_4339 464
388 3300049822 Ga0501035_0000065 Ga0501035_0000065_50374_51783 464
389 3300049823 Ga0501044_0000043 Ga0501044_0000043_78249_79658 464
390 iso_pu_bacteria 8018150411 8018152778 464
391 3300049570 Ga0501033_0000761 Ga0501033_0000761_6867_8330 465
392 3300049573 Ga0501037_0000818 Ga0501037_0000818_3181_4644 465
393 3300049579 Ga0501043_0000124 Ga0501043_0000124_50870_52333 465
394 3300049584 Ga0501068_0010248 Ga0501068_0010248_1999_3462 465
395 3300049585 Ga0501069_0000004 Ga0501069_0000004_168974_170437 465
396 3300049586 Ga0501070_0000148 Ga0501070_0000148_56714_58177 465
397 3300049587 Ga0501071_0025002 Ga0501071_0025002_2315_3778 465
398 3300049590 Ga0501074_0000006 Ga0501074_0000006_60812_62275 465
399 3300049742 Ga0501080_0005406 Ga0501080_0005406_3230_4693 465
400 3300049744 Ga0501083_0000066 Ga0501083_0000066_6681_8144 465
401 3300049822 Ga0501035_0000011 Ga0501035_0000011_238371_239834 465
402 3300049823 Ga0501044_0000803 Ga0501044_0000803_6698_8161 465
403 3300060353 Ga0501082_0053386 Ga0501082_0053386_340_1803 465
404 iso_pu_bacteria 2937822353 2937829032 465
405 iso_pu_bacteria 2508501127 2509139560 466
406 iso_pu_bacteria 2513237351 2514587744 466
407 iso_pu_bacteria 2597489875 2597812330 466
408 iso_pu_bacteria 2643221550 2643770802 466
409 iso_pu_bacteria 2643221551 2643776329 466
410 iso_pu_bacteria 2643221555 2643794776 466
411 iso_pu_bacteria 2643221564 2643839229 466
412 iso_pu_bacteria 2643221623 2644129674 466
413 iso_pu_bacteria 2738543024 2739310108 466
414 iso_pu_bacteria 2841734538 2841738338 466
415 iso_pu_bacteria 2869162929 2869163976 466
416 iso_pu_bacteria 2871474448 2871474888 466
417 iso_pu_bacteria 2874123672 2874127028 466
418 iso_pu_bacteria 2874168670 2874168942 466
419 iso_pu_bacteria 2878788777 2878795542 466
420 iso_pu_bacteria 2885305155 2885308592 466
421 iso_pu_bacteria 2885312484 2885312643 466
422 iso_pu_bacteria 2885326080 2885331835 466
423 iso_pu_bacteria 2885334103 2885341651 466
424 iso_pu_bacteria 2924754689 2924755892 466
425 iso_pu_bacteria 2937836603 2937839600 466
426 iso_pu_bacteria 2958071322 2958073971 466
427 iso_pu_bacteria 2970524798 2970527591 466
428 iso_pu_bacteria 2970540015 2970544211 466
429 iso_pu_bacteria 2996310559 2996314393 466
430 iso_pu_bacteria 8002285264 8002289313 466
431 iso_pu_bacteria 8004395343 8004395662 466
432 iso_pu_bacteria 8004633249 8004638701 466
433 iso_pu_bacteria 8055617313 8055619803 466
434 iso_pu_bacteria 2503198000 2503200333 467
435 iso_pu_bacteria 2508501123 2509115038 467
436 iso_pu_bacteria 2509276018 2509373791 467
437 iso_pu_bacteria 2509276022 2509395139 467
438 iso_pu_bacteria 2510065059 2510314127 467
439 iso_pu_bacteria 2512875016 2512932301 467
440 iso_pu_bacteria 2512875024 2512960308 467
441 iso_pu_bacteria 2513237090 2513614240 467
442 iso_pu_bacteria 2513237164 2514034588 467
443 iso_pu_bacteria 2588253730 2588518365 467
444 iso_pu_bacteria 2599185301 2599936188 467
445 iso_pu_bacteria 2643221595 2643985576 467
446 iso_pu_bacteria 2643221627 2644158284 467
447 iso_pu_bacteria 2687453392 2688597503 467
448 iso_pu_bacteria 2721755686 2723574735 467
449 iso_pu_bacteria 2756170246 2756671797 467
450 iso_pu_bacteria 2844002411 2844008269 467
451 iso_pu_bacteria 2844009547 2844012882 467
452 iso_pu_bacteria 2847670302 2847675232 467
453 iso_pu_bacteria 2847686936 2847691414 467
454 iso_pu_bacteria 2856314179 2856314960 467
455 iso_pu_bacteria 2856320880 2856323408 467
456 iso_pu_bacteria 2856328259 2856329285 467
457 iso_pu_bacteria 2856334872 2856336394 467
458 iso_pu_bacteria 2856349417 2856353676 467
459 iso_pu_bacteria 2856356410 2856361165 467
460 iso_pu_bacteria 2856364286 2856368292 467
461 iso_pu_bacteria 2857349434 2857351516 467
462 iso_pu_bacteria 2857367948 2857375487 467
463 iso_pu_bacteria 2869169390 2869174047 467
464 iso_pu_bacteria 2869249662 2869253318 467
465 iso_pu_bacteria 2869256925 2869261875 467
466 iso_pu_bacteria 2869264136 2869266490 467
467 iso_pu_bacteria 2869271264 2869275398 467
468 iso_pu_bacteria 2869278585 2869282887 467
469 iso_pu_bacteria 2869285874 2869290089 467
470 iso_pu_bacteria 2871429161 2871432373 467
471 iso_pu_bacteria 2871435913 2871436724 467
472 iso_pu_bacteria 2871444079 2871450986 467
473 iso_pu_bacteria 2871451962 2871456658 467
474 iso_pu_bacteria 2871459585 2871462030 467
475 iso_pu_bacteria 2871466892 2871469033 467
476 iso_pu_bacteria 2871488783 2871492994 467
477 iso_pu_bacteria 2871495908 2871502549 467
478 iso_pu_bacteria 2874102143 2874105627 467
479 iso_pu_bacteria 2874131515 2874133968 467
480 iso_pu_bacteria 2874139085 2874142548 467
481 iso_pu_bacteria 2874146452 2874152337 467
482 iso_pu_bacteria 2874155637 2874159740 467
483 iso_pu_bacteria 2874162495 2874162849 467
484 iso_pu_bacteria 2876363079 2876367666 467
485 iso_pu_bacteria 2876369609 2876374924 467
486 iso_pu_bacteria 2876386047 2876389094 467
487 iso_pu_bacteria 2876392853 2876393967 467
488 iso_pu_bacteria 2876399893 2876404156 467
489 iso_pu_bacteria 2876406927 2876409070 467
490 iso_pu_bacteria 2876413966 2876418256 467
491 iso_pu_bacteria 2876420981 2876424247 467
492 iso_pu_bacteria 2878035449 2878042203 467
493 iso_pu_bacteria 2878730984 2878735354 467
494 iso_pu_bacteria 2878738818 2878739210 467
495 iso_pu_bacteria 2878745973 2878749986 467
496 iso_pu_bacteria 2878753008 2878757040 467
497 iso_pu_bacteria 2878760144 2878766441 467
498 iso_pu_bacteria 2878767105 2878773637 467
499 iso_pu_bacteria 2878774303 2878779254 467
500 iso_pu_bacteria 2878781027 2878783698 467
501 iso_pu_bacteria 2881147464 2881150810 467
502 iso_pu_bacteria 2881155292 2881161343 467
503 iso_pu_bacteria 2881161766 2881167083 467
504 iso_pu_bacteria 2881853255 2881860590 467
505 iso_pu_bacteria 2881861095 2881866636 467
506 iso_pu_bacteria 2882632389 2882640706 467
507 iso_pu_bacteria 2882912400 2882919579 467
508 iso_pu_bacteria 2885318864 2885321457 467
509 iso_pu_bacteria 2885350715 2885351611 467
510 iso_pu_bacteria 2888337043 2888338569 467
511 iso_pu_bacteria 2888350351 2888355392 467
512 iso_pu_bacteria 2889010040 2889010371 467
513 iso_pu_bacteria 2889016732 2889017964 467
514 iso_pu_bacteria 2903448605 2903450444 467
515 iso_pu_bacteria 2903492973 2903500766 467
516 iso_pu_bacteria 2903492973 2903503291 467
517 iso_pu_bacteria 2903513507 2903515404 467
518 iso_pu_bacteria 2903521522 2903521817 467
519 iso_pu_bacteria 2903528002 2903528194 467
520 iso_pu_bacteria 2903540706 2903547590 467
521 iso_pu_bacteria 2904659560 2904660298 467
522 iso_pu_bacteria 2906308376 2906312345 467
523 iso_pu_bacteria 2906321335 2906325054 467
524 iso_pu_bacteria 2906328253 2906330404 467
525 iso_pu_bacteria 2906354277 2906356567 467
526 iso_pu_bacteria 2906363423 2906365956 467
527 iso_pu_bacteria 2906370794 2906376399 467
528 iso_pu_bacteria 2906378014 2906378926 467
529 iso_pu_bacteria 2906386501 2906392907 467
530 iso_pu_bacteria 2906393657 2906398034 467
531 iso_pu_bacteria 2906401398 2906405941 467
532 iso_pu_bacteria 2906408224 2906411937 467
533 iso_pu_bacteria 2906414383 2906419604 467
534 iso_pu_bacteria 2906427513 2906432944 467
535 iso_pu_bacteria 2922130491 2922133849 467
536 iso_pu_bacteria 2922151315 2922155862 467
537 iso_pu_bacteria 2922158528 2922164921 467
538 iso_pu_bacteria 2922172374 2922173627 467
539 iso_pu_bacteria 2922185730 2922187203 467
540 iso_pu_bacteria 2924710171 2924710639 467
541 iso_pu_bacteria 2924718760 2924720483 467
542 iso_pu_bacteria 2924733363 2924740611 467
543 iso_pu_bacteria 2924741084 2924744948 467
544 iso_pu_bacteria 2924748358 2924753352 467
545 iso_pu_bacteria 2924762789 2924763758 467
546 iso_pu_bacteria 2924776078 2924776675 467
547 iso_pu_bacteria 2924784321 2924786343 467
548 iso_pu_bacteria 2937813078 2937819513 467
549 iso_pu_bacteria 2937848649 2937850948 467
550 iso_pu_bacteria 2937861824 2937863496 467
551 iso_pu_bacteria 2937877337 2937880835 467
552 iso_pu_bacteria 2937891427 2937897457 467
553 iso_pu_bacteria 2937972304 2937977027 467
554 iso_pu_bacteria 2937994558 2938001465 467
555 iso_pu_bacteria 2938014810 2938019523 467
556 iso_pu_bacteria 2958034702 2958039670 467
557 iso_pu_bacteria 2958041894 2958052701 467
558 iso_pu_bacteria 2958064165 2958069379 467
559 iso_pu_bacteria 2958084443 2958088609 467
560 iso_pu_bacteria 2958092219 2958097975 467
561 iso_pu_bacteria 2958100919 2958107920 467
562 iso_pu_bacteria 2958108152 2958113038 467
563 iso_pu_bacteria 2958115193 2958116437 467
564 iso_pu_bacteria 2958122699 2958125697 467
565 iso_pu_bacteria 2958130278 2958134476 467
566 iso_pu_bacteria 2958144490 2958148218 467
567 iso_pu_bacteria 2958158011 2958159338 467
568 iso_pu_bacteria 2958165035 2958171619 467
569 iso_pu_bacteria 2958172287 2958178084 467
570 iso_pu_bacteria 2958179912 2958180957 467
571 iso_pu_bacteria 2961077736 2961078794 467
572 iso_pu_bacteria 2961114664 2961115622 467
573 iso_pu_bacteria 2961127735 2961131370 467
574 iso_pu_bacteria 2961136820 2961137962 467
575 iso_pu_bacteria 2961163497 2961170060 467
576 iso_pu_bacteria 2961170736 2961175632 467
577 iso_pu_bacteria 2961183825 2961186909 467
578 iso_pu_bacteria 2963644680 2963646903 467
579 iso_pu_bacteria 2965018300 2965024811 467
580 iso_pu_bacteria 2965025482 2965029744 467
581 iso_pu_bacteria 2965032056 2965032302 467
582 iso_pu_bacteria 2965040258 2965043227 467
583 iso_pu_bacteria 2965047637 2965055370 467
584 iso_pu_bacteria 2965062239 2965065221 467
585 iso_pu_bacteria 2965089291 2965093329 467
586 iso_pu_bacteria 2965102966 2965107037 467
587 iso_pu_bacteria 2965110997 2965113197 467
588 iso_pu_bacteria 2965119406 2965119543 467
589 iso_pu_bacteria 2967996073 2967999311 467
590 iso_pu_bacteria 2968003550 2968007724 467
591 iso_pu_bacteria 2968016561 2968021000 467
592 iso_pu_bacteria 2968083720 2968088296 467
593 iso_pu_bacteria 2968091066 2968095051 467
594 iso_pu_bacteria 2968097103 2968101484 467
595 iso_pu_bacteria 2968110612 2968111355 467
596 iso_pu_bacteria 2968117919 2968119621 467
597 iso_pu_bacteria 2968128360 2968130609 467
598 iso_pu_bacteria 2968171901 2968178452 467
599 iso_pu_bacteria 2970469710 2970474297 467
600 iso_pu_bacteria 2970489779 2970494466 467
601 iso_pu_bacteria 2970503327 2970508220 467
602 iso_pu_bacteria 2970510686 2970511457 467
603 iso_pu_bacteria 2970532167 2970534904 467
604 iso_pu_bacteria 2970547951 2970554178 467
605 iso_pu_bacteria 2970554993 2970561297 467
606 iso_pu_bacteria 2970593180 2970597496 467
607 iso_pu_bacteria 2970619444 2970624416 467
608 iso_pu_bacteria 2970627176 2970628597 467
609 iso_pu_bacteria 2977821940 2977826199 467
610 iso_pu_bacteria 2977843712 2977848133 467
611 iso_pu_bacteria 2977851361 2977853698 467
612 iso_pu_bacteria 2977858184 2977864635 467
613 iso_pu_bacteria 2977864932 2977869074 467
614 iso_pu_bacteria 2977872689 2977878070 467
615 iso_pu_bacteria 2977898635 2977905248 467
616 iso_pu_bacteria 2977907340 2977913203 467
617 iso_pu_bacteria 2977915119 2977919949 467
618 iso_pu_bacteria 2977922695 2977923630 467
619 iso_pu_bacteria 2977935797 2977936534 467
620 iso_pu_bacteria 2977942078 2977944501 467
621 iso_pu_bacteria 2977950692 2977952784 467
622 iso_pu_bacteria 2977957713 2977959186 467
623 iso_pu_bacteria 2977971508 2977976515 467
624 iso_pu_bacteria 2979710463 2979710591 467
625 iso_pu_bacteria 2979742915 2979745886 467
626 iso_pu_bacteria 2979764755 2979771306 467
627 iso_pu_bacteria 2979772303 2979777912 467
628 iso_pu_bacteria 2979779861 2979786235 467
629 iso_pu_bacteria 2979793036 2979795832 467
630 iso_pu_bacteria 2979808191 2979813404 467
631 iso_pu_bacteria 2987636660 2987638700 467
632 iso_pu_bacteria 2987645492 2987646520 467
633 iso_pu_bacteria 2987652177 2987654265 467
634 iso_pu_bacteria 2987659509 2987666301 467
635 iso_pu_bacteria 2987666974 2987669930 467
636 iso_pu_bacteria 2987673487 2987676208 467
637 iso_pu_bacteria 2996341866 2996343704 467
638 iso_pu_bacteria 2996348954 2996352367 467
639 iso_pu_bacteria 2996386984 2996390292 467
640 iso_pu_bacteria 3000135777 3000139875 467
641 iso_pu_bacteria 3004167301 3004167934 467
642 iso_pu_bacteria 3004188549 3004195307 467
643 iso_pu_bacteria 3004203850 3004205057 467
644 iso_pu_bacteria 3004211236 3004215311 467
645 iso_pu_bacteria 3004218560 3004225846 467
646 iso_pu_bacteria 3004232784 3004236680 467
647 iso_pu_bacteria 3004239961 3004244593 467
648 iso_pu_bacteria 3004248173 3004255550 467
649 iso_pu_bacteria 3004268573 3004275555 467
650 iso_pu_bacteria 3004275668 3004279049 467
651 iso_pu_bacteria 3004289098 3004295304 467
652 iso_pu_bacteria 3004334049 3004335427 467
653 iso_pu_bacteria 637000159 637075401 467
654 iso_pu_bacteria 649633066 649872052 467
655 iso_pu_bacteria 8004300914 8004301122 467
656 iso_pu_bacteria 8004312739 8004315602 467
657 iso_pu_bacteria 8004374579 8004378615 467
658 iso_pu_bacteria 8004387939 8004392294 467
659 iso_pu_bacteria 8004445564 8004449202 467
660 iso_pu_bacteria 8004640170 8004641134 467
661 iso_pu_bacteria 8004695233 8004700688 467
662 iso_pu_bacteria 8004703790 8004708872 467
663 iso_pu_bacteria 8004714634 8004718604 467
664 3300049579 Ga0501043_0090233 Ga0501043_0090233_425_1897 468
665 3300049581 Ga0501047_0002052 Ga0501047_0002052_14439_15905 468
666 3300049581 Ga0501047_0112404 Ga0501047_0112404_401_1855 468
667 3300049586 Ga0501070_0001919 Ga0501070_0001919_9080_10546 468
668 3300049586 Ga0501070_0204109 Ga0501070_0204109_52_1566 468
669 3300049587 Ga0501071_0026559 Ga0501071_0026559_2455_3921 468
670 3300049742 Ga0501080_0048480 Ga0501080_0048480_1325_2791 468
671 3300049822 Ga0501035_0001755 Ga0501035_0001755_13870_15336 468
672 3300049823 Ga0501044_0014696 Ga0501044_0014696_1623_3077 468
673 3300049823 Ga0501044_0019335 Ga0501044_0019335_3030_4496 468
674 iso_pu_bacteria 2996336353 2996339894 468
675 3300026067 Ga0207678_10108430 Ga0207678_101084302 469
676 3300038443 Ga0395901_0051420 Ga0395901_0051420_2118_3533 469
677 3300046660 Ga0495625_0041874 Ga0495625_0041874_163_1572 469
678 3300049586 Ga0501070_0142628 Ga0501070_0142628_59_1474 469
679 iso_pu_bacteria 2939669807 2939671822 469
680 3300001979 JGI24740J21852_10007252 JGI24740J21852_100072522 471
681 3300002705 JGI25156J39149_1003391 JGI25156J39149_10033914 471
682 3300002741 JGI25157J39369_1000755 JGI25157J39369_10007555 471
683 3300003214 JGI25165J46597_1000006 JGI25165J46597_1000006308 471
684 3300003762 Ga0055542_1001018 Ga0055542_100101825 471
685 3300005539 Ga0068853_100013522 Ga0068853_1000135225 471
686 3300006038 Ga0075365_10005021 Ga0075365_100050212 471
687 3300006038 Ga0075365_10055068 Ga0075365_100550682 471
688 3300006051 Ga0075364_10025707 Ga0075364_100257072 471
689 3300006178 Ga0075367_10018362 Ga0075367_100183622 471
690 3300006186 Ga0075369_10018746 Ga0075369_100187463 471
691 3300009177 Ga0105248_10324855 Ga0105248_103248551 471
692 3300009545 Ga0105237_10091801 Ga0105237_100918012 471
693 3300010375 Ga0105239_10086611 Ga0105239_100866113 471
694 3300013105 Ga0157369_10149071 Ga0157369_101490712 471
695 3300013296 Ga0157374_10322690 Ga0157374_103226901 471
696 3300025250 Ga0209026_1000089 Ga0209026_1000089103 471
697 3300025254 Ga0209148_1000124 Ga0209148_1000124148 471
698 3300025256 Ga0209759_1000903 Ga0209759_100090317 471
699 3300025256 Ga0209759_1014776 Ga0209759_10147761 471
700 3300025261 Ga0209233_1000010 Ga0209233_1000010889 471
701 3300025272 Ga0209455_1000062 Ga0209455_1000062103 471
702 3300025904 Ga0207647_10005131 Ga0207647_100051314 471
703 3300025913 Ga0207695_10069593 Ga0207695_100695932 471
704 3300025913 Ga0207695_10078627 Ga0207695_100786272 471
705 3300025914 Ga0207671_10076843 Ga0207671_100768431 471
706 3300026041 Ga0207639_10014018 Ga0207639_100140183 471
707 3300026067 Ga0207678_10146031 Ga0207678_101460312 471
708 3300037471 Ga0395905_0062728 Ga0395905_0062728_103_1518 471
709 3300044658 Ga0466972_0009870 Ga0466972_0009870_1135_2550 471
710 3300044901 Ga0466960_0003996 Ga0466960_0003996_486_1901 471
711 3300048907 Ga0496104_0155608 Ga0496104_0155608_755_2170 471
712 3300048923 Ga0496120_0004279 Ga0496120_0004279_7971_9386 471
713 3300048929 Ga0496126_0033096 Ga0496126_0033096_3331_4746 471
714 3300050492 nmdc:mga0yw44_9634_c1 nmdc:mga0yw44_9634_c1_1160_2575 471
715 3300050516 nmdc:mga0sz30_52859_c1 nmdc:mga0sz30_52859_c1_215_1630 471
716 3300053155 Ga0500620_006007 Ga0500620_006007_633_2048 471
717 iso_pu_bacteria 2791355123 2792751997 471
718 iso_pu_bacteria 2977986579 2977990463 471

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00672

HAMP

HAMP domain

225

277

0.94

PF02518

HATPase_c

Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase

377

484

0.91

Feature Viewer

pLDDT pTM Quality
70.42 0.38 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map