F477188

General Info

Members Datasets Scaffolds Average Seq Length
718 563 393 152

Family's Representative Sequence

Representative Sequence 3300046530|Ga0495654_0000130|Ga0495654_0000130_32016_32558
Length 180
Sequence MTRKQKRLAVIAGGMSFIIVAVFLVMFAFSQSVAYFFMPGDIAAANLQPGTRIRLGGLVEQGSVRRGQGSTVSFSVTDGKATVPVSYTGILPDLFREGQGVVTEGAFDAASHGFVADSVLAKHDENYMPKEVADRLKKDGVWEDGSGKGMAPAQDKAKAKGADGAEKTTEKDQVVGSTKP

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
4 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
5 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
6 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
7 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
8 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
9 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
10 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
11 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
12 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
13 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
14 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
15 2516143018 Ensifer sp. BR816 Isolate Nodule
16 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
17 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
18 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
19 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
20 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
21 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
22 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
23 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
24 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
25 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
26 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
27 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
28 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
29 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
30 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
31 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
32 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
33 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
34 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
35 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
36 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
37 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
38 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
39 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
40 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
41 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
42 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
43 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
44 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
45 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
46 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
47 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
48 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
49 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
50 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
51 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
52 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
53 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
54 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
55 2643221557 Ensifer sp. Root558 Isolate Unclassified
56 2643221568 Rhizobium sp. Root564 Isolate Unclassified
57 2643221582 Rhizobium sp. Root651 Isolate Unclassified
58 2643221607 Rhizobium sp. Root73 Isolate Unclassified
59 2643221610 Ensifer sp. Root74 Isolate Unclassified
60 2643221618 Ensifer sp. Root231 Isolate Unclassified
61 2643221626 Ensifer sp. Root31 Isolate Unclassified
62 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
63 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
64 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
65 2643221655 Ensifer sp. Root1252 Isolate Unclassified
66 2643221659 Ensifer sp. Root127 Isolate Unclassified
67 2643221668 Ensifer sp. Root423 Isolate Unclassified
68 2643221675 Ensifer sp. Root1298 Isolate Unclassified
69 2643221680 Ensifer sp. Root1312 Isolate Unclassified
70 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
71 2643221688 Rhizobium sp. Root482 Isolate Unclassified
72 2643221693 Rhizobium sp. Root491 Isolate Unclassified
73 2643221698 Ensifer sp. Root142 Isolate Unclassified
74 2643221712 Ensifer sp. Root258 Isolate Unclassified
75 2643221718 Rhizobium sp. Root268 Isolate Unclassified
76 2643221719 Rhizobium sp. Root274 Isolate Unclassified
77 2643221723 Ensifer sp. Root278 Isolate Unclassified
78 2643221726 Ensifer sp. Root954 Isolate Unclassified
79 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
80 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
81 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
82 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
83 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
84 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
85 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
86 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
87 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
88 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
89 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
90 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
91 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
92 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
93 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
94 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
95 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
96 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
97 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
98 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
99 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
100 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
101 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
102 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
103 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
104 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
105 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
106 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
107 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
108 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
109 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
110 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
111 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
112 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
113 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
114 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
115 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
116 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
117 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
118 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
119 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
120 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
121 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
122 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
123 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
124 2844163670 Ensifer sp. 1H6 Isolate Unclassified
125 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
126 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
127 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
128 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
129 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
130 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
131 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
132 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
133 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
134 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
135 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
136 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
137 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
138 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
139 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
140 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
141 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
142 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
143 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
144 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
145 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
146 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
147 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
148 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
149 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
150 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
151 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
152 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
153 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
154 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
155 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
156 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
157 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
158 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
159 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
160 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
161 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
162 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
163 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
164 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
165 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
166 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
167 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
168 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
169 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
170 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
171 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
172 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
173 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
174 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
175 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
176 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
177 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
178 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
179 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
180 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
181 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
182 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
183 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
184 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
185 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
186 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
187 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
188 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
189 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
190 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
191 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
192 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
193 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
194 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
195 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
196 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
197 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
198 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
199 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
200 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
201 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
202 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
203 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
204 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
205 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
206 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
207 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
208 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
209 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
210 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
211 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
212 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
213 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
214 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
215 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
216 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
217 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
218 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
219 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
220 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
221 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
222 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
223 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
224 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
225 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
226 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
227 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
228 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
229 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
230 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
231 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
232 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
233 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
234 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
235 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
236 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
237 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
238 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
239 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
240 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
241 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
242 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
243 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
244 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
245 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
246 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
247 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
248 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
249 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
250 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
251 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
252 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
253 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
254 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
255 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
256 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
257 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
258 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
259 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
260 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
261 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
262 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
263 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
264 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
265 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
266 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
267 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
268 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
269 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
270 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
271 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
272 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
273 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
274 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
275 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
276 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
277 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
278 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
279 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
280 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
281 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
282 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
283 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
284 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
285 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
286 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
287 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
288 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
289 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
290 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
291 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
292 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
293 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
294 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
295 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
296 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
297 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
298 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
299 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
300 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
301 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
302 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
303 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
304 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
305 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
306 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
307 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
308 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
309 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
310 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
311 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
312 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
313 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
314 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
315 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
316 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
317 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
318 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
319 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
320 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
321 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
322 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
323 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
324 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
325 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
326 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
327 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
328 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
329 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
330 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
331 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
332 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
333 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
334 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
335 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
336 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
337 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
338 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
339 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
340 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
341 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
342 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
343 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
344 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
345 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
346 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
347 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
348 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
349 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
350 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
351 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
352 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
353 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
354 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
355 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
356 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
357 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
358 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
359 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
360 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
361 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
362 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
363 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
364 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
365 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
366 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
367 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
368 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
369 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
370 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
371 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
372 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
373 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
374 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
375 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
376 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
377 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
378 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
379 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
380 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
381 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
382 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
383 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
384 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
385 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
386 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
387 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
388 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
389 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
390 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
391 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
392 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
393 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
394 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
395 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
396 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
397 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
398 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
399 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
400 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
401 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
402 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
403 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
404 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
405 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
406 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
407 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
408 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
409 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
410 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
411 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
412 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
413 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
414 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
415 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
416 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
417 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
418 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
419 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
420 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
421 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
422 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
423 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
424 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
425 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
426 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
427 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
428 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
429 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
430 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
431 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
432 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
433 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
434 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
435 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
436 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
437 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
438 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
439 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
440 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
441 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
442 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
443 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
444 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
445 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
446 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
447 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
448 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
449 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
450 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
451 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
452 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
453 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
454 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
455 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
456 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
457 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
458 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
459 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
460 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
461 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
462 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
463 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
464 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
465 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
466 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
467 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
468 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
469 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
470 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
471 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
472 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
473 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
474 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
475 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
476 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
477 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
478 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
479 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
480 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
481 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
482 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
483 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
484 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
485 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
486 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
487 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
488 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
489 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
490 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
491 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
492 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
493 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
494 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
495 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
496 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
497 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
498 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
499 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
500 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
501 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
502 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
503 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
504 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
505 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
506 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
507 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
508 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
509 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
510 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
511 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
512 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
513 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
514 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
515 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
516 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
517 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
518 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
519 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
520 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
521 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
522 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
523 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
524 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
525 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
526 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
527 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
528 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
529 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
530 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
531 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
532 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
533 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
534 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
535 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
536 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
537 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
538 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
539 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
540 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
541 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
542 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
543 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
544 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
545 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
546 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
547 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
548 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
549 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
550 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
551 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
552 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
553 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
554 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
555 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
556 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
557 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
558 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
559 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
560 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
561 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
562 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
563 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 54.46
Metatranscriptomes 0.28
Isolates 45.26

Biome Distribution

Category Percentage (%)
Aerial Root 0.7
Bulb 0
Endosphere 16.99
Nodule 31.06
Rhizoplane 2.37
Rhizosphere 28.97
Stem 0
Stem Tuber 0
Unclassified 19.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10001706 3300001979 Bacteria 10085
2 JGI25162J39368_1000243 3300002737 Bacteria 54503
3 JGI25162J39368_1000372 3300002737 Bacteria 38119
4 JGI25154J39366_1025527 3300002738 Bacteria 538
5 JGI25159J45721_1000001 3300002987 Bacteria 303489
6 JGI25159J45721_1007076 3300002987 Bacteria 3268
7 JGI25151J46595_10014402 3300003187 Bacteria 3524
8 JGI25151J46595_10036328 3300003187 Bacteria 1860
9 JGI25165J46597_1000318 3300003214 Bacteria 57977
10 JGI25165J46597_1000413 3300003214 Bacteria 44960
11 rootH2_10088068 3300003320 Bacteria 2927
12 rootL2_10004432 3300003322 Bacteria 5832
13 rootL2_10004433 3300003322 Bacteria 1005
14 rootH1_10018310 3300003323 Bacteria 3819
15 rootH1_10066496 3300003323 Bacteria 4032
16 JGI25160J50197_1000002 3300003354 Bacteria 561707
17 JGI25160J50197_1011762 3300003354 Bacteria 3077
18 JGI25161J50226_1000742 3300003374 Bacteria 12536
19 JGI25161J50226_1004189 3300003374 Bacteria 3077
20 Ga0055526_1000805 3300003771 Bacteria 23389
21 Ga0055524_1046411 3300003775 Bacteria 1033
22 Ga0055536_1000427 3300003781 Bacteria 30054
23 Ga0055536_1002131 3300003781 Bacteria 11268
24 Ga0055530_10004975 3300003791 Bacteria 6570
25 Ga0055540_1003388 3300003792 Bacteria 7725
26 Ga0055540_1022338 3300003792 Bacteria 1621
27 Ga0055531_10003223 3300003794 Bacteria 10465
28 Ga0055531_10019032 3300003794 Bacteria 2802
29 Ga0055543_1005842 3300004625 Bacteria 3077
30 Ga0055543_1008229 3300004625 Bacteria 2324
31 Ga0065165_1000004 3300005262 Bacteria 377081
32 Ga0065165_1006277 3300005262 Bacteria 6303
33 Ga0065165_1015306 3300005262 Bacteria 2930
34 Ga0070676_10118877 3300005328 Bacteria 1656
35 Ga0070683_100689029 3300005329 Bacteria 978
36 Ga0070680_100008482 3300005336 Bacteria 7869
37 Ga0070680_100062152 3300005336 Bacteria 3058
38 Ga0070660_100085737 3300005339 Bacteria 2477
39 Ga0070661_100169973 3300005344 Bacteria 1655
40 Ga0070668_100486269 3300005347 Bacteria 1067
41 Ga0070669_100054894 3300005353 Bacteria 2919
42 Ga0070659_100032152 3300005366 Bacteria 4068
43 Ga0070659_101147645 3300005366 Bacteria 686
44 Ga0070714_100024490 3300005435 Bacteria 4972
45 Ga0070710_10389396 3300005437 Bacteria 931
46 Ga0070711_100518830 3300005439 Bacteria 984
47 Ga0070711_100747284 3300005439 Bacteria 826
48 Ga0070679_100248409 3300005530 Bacteria 1735
49 Ga0070684_100194099 3300005535 Bacteria 1848
50 Ga0068853_100003501 3300005539 Bacteria 12013
51 Ga0068853_100199143 3300005539 Bacteria 1822
52 Ga0068853_100337428 3300005539 Bacteria 1400
53 Ga0070693_100290156 3300005547 Bacteria 1099
54 Ga0070665_100134095 3300005548 Bacteria 2478
55 Ga0070665_100184170 3300005548 Bacteria 2089
56 Ga0070665_100402121 3300005548 Bacteria 1378
57 Ga0068855_100019140 3300005563 Bacteria 8227
58 Ga0068855_100517370 3300005563 Bacteria 1295
59 Ga0068855_102238740 3300005563 Bacteria 548
60 Ga0070664_101407448 3300005564 Bacteria 659
61 Ga0068857_100099392 3300005577 Bacteria 2610
62 Ga0068854_100055705 3300005578 Bacteria 2848
63 Ga0068854_100289276 3300005578 Bacteria 1322
64 Ga0068854_100394108 3300005578 Bacteria 1144
65 Ga0068856_100046878 3300005614 Bacteria 4257
66 Ga0068852_100014111 3300005616 Bacteria 6135
67 Ga0068852_100216600 3300005616 Bacteria 1819
68 Ga0068851_10103600 3300005834 Bacteria 1512
69 Ga0081455_10512935 3300005937 Bacteria 802
70 Ga0081539_10273761 3300005985 Bacteria 738
71 Ga0075365_10000488 3300006038 Bacteria 15084
72 Ga0075368_10003865 3300006042 Bacteria 5040
73 Ga0075363_100054797 3300006048 Bacteria 2134
74 Ga0075364_10057050 3300006051 Bacteria 2557
75 Ga0075364_10295213 3300006051 Bacteria 1103
76 Ga0070712_100111918 3300006175 Bacteria 2039
77 Ga0070712_100533098 3300006175 Bacteria 987
78 Ga0075362_10001934 3300006177 Bacteria 6808
79 Ga0075367_10028701 3300006178 Bacteria 3176
80 Ga0075367_10296427 3300006178 Bacteria 1018
81 Ga0075369_10015858 3300006186 Bacteria 3031
82 Ga0075369_10040475 3300006186 Bacteria 1992
83 Ga0075369_10309731 3300006186 Bacteria 738
84 Ga0075370_10033815 3300006353 Bacteria 2864
85 Ga0075370_10249191 3300006353 Bacteria 1052
86 Ga0075431_100034414 3300006847 Bacteria 5219
87 Ga0068865_100341634 3300006881 Bacteria 1210
88 Ga0075436_100032738 3300006914 Bacteria 3583
89 Ga0079104_1000010 3300006946 Bacteria 366021
90 Ga0099826_10000030 3300006948 Bacteria 128684
91 Ga0099826_10005897 3300006948 Bacteria 8850
92 Ga0105240_10000027 3300009093 Bacteria 348486
93 Ga0114129_10048144 3300009147 Bacteria 5990
94 Ga0105243_10003211 3300009148 Bacteria 13374
95 Ga0105243_10325071 3300009148 Bacteria 1403
96 Ga0105242_10267060 3300009176 Bacteria 1548
97 Ga0105248_10284786 3300009177 Bacteria 1861
98 Ga0105237_10006371 3300009545 Bacteria 13105
99 Ga0105238_10916640 3300009551 Bacteria 895
100 Ga0105033_107133 3300009986 Bacteria 969
101 Ga0105239_10031150 3300010375 Bacteria 5868
102 Ga0105239_10847388 3300010375 Bacteria 1048
103 Ga0105239_11284261 3300010375 Bacteria 844
104 Ga0157373_10037216 3300013100 Bacteria 3489
105 Ga0157373_10554686 3300013100 Bacteria 833
106 Ga0157371_10000307 3300013102 Bacteria 63760
107 Ga0157371_10194006 3300013102 Bacteria 1455
108 Ga0157370_10000223 3300013104 Bacteria 72025
109 Ga0157370_10000577 3300013104 Bacteria 45697
110 Ga0157370_10164829 3300013104 Bacteria 2061
111 Ga0157369_10306780 3300013105 Bacteria 1651
112 Ga0157369_10442725 3300013105 Bacteria 1346
113 Ga0171463_1001 3300013249 Bacteria 1406070
114 Ga0157378_12629022 3300013297 Bacteria 556
115 Ga0157372_10092379 3300013307 Bacteria 3443
116 Ga0157380_10517191 3300014326 Bacteria 1163
117 Ga0182007_10000805 3300015262 Bacteria 17521
118 Ga0182005_1001955 3300015265 Bacteria 7751
119 Ga0183363_1305 3300015690 Bacteria 6838
120 Ga0214542_1000010 3300021321 Bacteria 262816
121 Ga0214543_1000003 3300021327 Bacteria 692327
122 Ga0214543_1000004 3300021327 Bacteria 527190
123 Ga0209435_100036 3300025206 Bacteria 126970
124 Ga0209435_106982 3300025206 Bacteria 1252
125 Ga0209760_101252 3300025207 Bacteria 2813
126 Ga0209436_103777 3300025208 Bacteria 3914
127 Ga0209436_104773 3300025208 Bacteria 3273
128 Ga0207427_117028 3300025231 Bacteria 675
129 Ga0209437_100033 3300025233 Bacteria 512520
130 Ga0209437_100036 3300025233 Bacteria 469153
131 Ga0209646_1000132 3300025246 Bacteria 126859
132 Ga0209646_1013311 3300025246 Bacteria 1252
133 Ga0209646_1045463 3300025246 Bacteria 538
134 Ga0209026_1015454 3300025250 Bacteria 1252
135 Ga0209677_100419 3300025253 Bacteria 25164
136 Ga0209148_1038824 3300025254 Bacteria 668
137 Ga0209759_1025591 3300025256 Bacteria 1252
138 Ga0209233_1000056 3300025261 Bacteria 438104
139 Ga0209233_1000064 3300025261 Bacteria 392156
140 Ga0209233_1000152 3300025261 Bacteria 175910
141 Ga0209565_1046264 3300025263 Bacteria 794
142 Ga0209130_1000008 3300025284 Bacteria 581232
143 Ga0209130_1006133 3300025284 Bacteria 3970
144 Ga0209676_1000885 3300025292 Bacteria 38361
145 Ga0209676_1032958 3300025292 Bacteria 1550
146 Ga0209025_1000074 3300025294 Bacteria 277445
147 Ga0209025_1000080 3300025294 Bacteria 267244
148 Ga0209025_1000100 3300025294 Bacteria 229182
149 Ga0209025_1063801 3300025294 Bacteria 1357
150 Ga0209025_1085903 3300025294 Bacteria 1048
151 Ga0209564_1000104 3300025295 Bacteria 219017
152 Ga0209758_1000121 3300025297 Bacteria 192028
153 Ga0209758_1053900 3300025297 Bacteria 1378
154 Ga0209758_1101417 3300025297 Bacteria 818
155 Ga0209050_1001263 3300025298 Bacteria 29191
156 Ga0209050_1002888 3300025298 Bacteria 13567
157 Ga0209256_1001494 3300025299 Bacteria 23770
158 Ga0207426_1000016 3300025302 Bacteria 581232
159 Ga0207426_1012037 3300025302 Bacteria 3268
160 Ga0209051_1000918 3300025303 Bacteria 29277
161 Ga0209051_1001239 3300025303 Bacteria 22894
162 Ga0209051_1137631 3300025303 Bacteria 592
163 Ga0209257_1005831 3300025304 Bacteria 8356
164 Ga0209257_1032555 3300025304 Bacteria 1651
165 Ga0209257_1032558 3300025304 Bacteria 1651
166 Ga0207645_10079055 3300025907 Bacteria 2108
167 Ga0207707_10379544 3300025912 Bacteria 1215
168 Ga0207695_10000024 3300025913 Bacteria 632311
169 Ga0207695_10836915 3300025913 Bacteria 800
170 Ga0207671_10000986 3300025914 Bacteria 35178
171 Ga0207693_10012816 3300025915 Bacteria 6764
172 Ga0207693_10071773 3300025915 Bacteria 2711
173 Ga0207663_10158114 3300025916 Bacteria 1597
174 Ga0207660_10019044 3300025917 Bacteria 4585
175 Ga0207660_10041434 3300025917 Bacteria 3227
176 Ga0207657_10163197 3300025919 Bacteria 1809
177 Ga0207649_10194352 3300025920 Bacteria 1429
178 Ga0207652_10175794 3300025921 Bacteria 1923
179 Ga0207681_10147047 3300025923 Bacteria 1762
180 Ga0207681_10387676 3300025923 Bacteria 1126
181 Ga0207650_10000567 3300025925 Bacteria 30017
182 Ga0207664_10219165 3300025929 Bacteria 1649
183 Ga0207690_11084353 3300025932 Bacteria 667
184 Ga0207686_10281055 3300025934 Bacteria 1229
185 Ga0207709_10134080 3300025935 Bacteria 1692
186 Ga0207711_10192203 3300025941 Bacteria 1861
187 Ga0207689_10186811 3300025942 Bacteria 1709
188 Ga0207661_10058969 3300025944 Bacteria 3092
189 Ga0207667_10096670 3300025949 Bacteria 3048
190 Ga0207667_10163651 3300025949 Bacteria 2287
191 Ga0207667_10241500 3300025949 Bacteria 1848
192 Ga0207667_11950947 3300025949 Bacteria 548
193 Ga0207640_10068813 3300025981 Bacteria 2374
194 Ga0207640_10116982 3300025981 Bacteria 1902
195 Ga0207658_11134507 3300025986 Bacteria 714
196 Ga0207639_10189792 3300026041 Bacteria 1754
197 Ga0207702_10425191 3300026078 Bacteria 1285
198 Ga0207702_10501763 3300026078 Bacteria 1183
199 Ga0207698_10159815 3300026142 Bacteria 1969
200 Ga0209281_1000053 3300027111 Bacteria 309587
201 Ga0209281_1000377 3300027111 Bacteria 71243
202 Ga0209371_1000009 3300027312 Bacteria 963030
203 Ga0209371_1001001 3300027312 Bacteria 21687
204 Ga0209371_1007294 3300027312 Bacteria 3880
205 Ga0209282_1001844 3300027666 Bacteria 11920
206 Ga0209813_10010599 3300027866 Bacteria 2388
207 Ga0268266_10077344 3300028379 Bacteria 2893
208 Ga0268266_10151057 3300028379 Bacteria 2093
209 Ga0268266_10518792 3300028379 Bacteria 1139
210 Ga0268266_10755119 3300028379 Bacteria 939
211 Ga0307515_10002710 3300028794 Bacteria 37898
212 Ga0265338_10383584 3300028800 Bacteria 1005
213 Ga0268256_1000010 3300030500 Bacteria 963034
214 Ga0268256_1008343 3300030500 Bacteria 3560
215 Ga0268256_1026173 3300030500 Bacteria 1470
216 Ga0265325_10032431 3300031241 Bacteria 2789
217 Ga0265339_10160866 3300031249 Bacteria 1130
218 Ga0307408_100335795 3300031548 Bacteria 1278
219 Ga0307408_100710404 3300031548 Bacteria 904
220 Ga0307408_100863603 3300031548 Bacteria 826
221 Ga0307508_10408162 3300031616 Bacteria 950
222 Ga0265314_10002263 3300031711 Bacteria 19929
223 Ga0307405_10057233 3300031731 Bacteria 2449
224 Ga0307405_10153351 3300031731 Bacteria 1623
225 Ga0307413_10730087 3300031824 Bacteria 826
226 Ga0307406_10012978 3300031901 Bacteria 4762
227 Ga0307412_10223405 3300031911 Bacteria 1445
228 Ga0307416_102248550 3300032002 Bacteria 646
229 Ga0307414_10218475 3300032004 Bacteria 1563
230 Ga0307414_10488251 3300032004 Bacteria 1087
231 Ga0307414_10927605 3300032004 Bacteria 799
232 Ga0373939_0001378 3300035114 Bacteria 5884
233 Ga0373933_0282428 3300035724 Bacteria 1073
234 Ga0400485_00599 3300038735 Bacteria 2466
235 Ga0400488_43485 3300038741 Bacteria 1268
236 Ga0400486_12542 3300038742 Bacteria 1110
237 Ga0439436_0002969 3300041404 Bacteria 5142
238 Ga0439436_0081436 3300041404 Bacteria 901
239 Ga0439438_029569 3300041405 Bacteria 1466
240 Ga0439438_130062 3300041405 Bacteria 604
241 Ga0439466_0090180 3300041411 Bacteria 961
242 Ga0439466_0138362 3300041411 Bacteria 748
243 Ga0439465_0042221 3300041413 Bacteria 1477
244 Ga0451839_0390476 3300041496 Bacteria 529
245 Ga0451851_0457214 3300041507 Bacteria 696
246 Ga0439433_0086967 3300041999 Bacteria 765
247 Ga0439445_0102546 3300042004 Bacteria 812
248 Ga0439449_0009869 3300042007 Bacteria 3611
249 Ga0439449_0038896 3300042007 Bacteria 1768
250 Ga0439462_0009200 3300042015 Bacteria 2498
251 Ga0450920_006043 3300042122 Bacteria 2167
252 Ga0439458_0026517 3300042157 Bacteria 1364
253 Ga0450909_015526 3300042185 Bacteria 1124
254 Ga0439434_0167943 3300042435 Bacteria 731
255 Ga0495606_0005820 3300046507 Bacteria 11630
256 Ga0495643_0057328 3300046522 Bacteria 2076
257 Ga0495648_0242839 3300046524 Bacteria 874
258 Ga0495654_0000130 3300046530 Bacteria 81643
259 Ga0495654_0117822 3300046530 Bacteria 1205
260 Ga0495633_0037945 3300046558 Bacteria 2303
261 Ga0495588_0000397 3300046674 Bacteria 24653
262 Ga0495681_0011685 3300047470 Bacteria 5210
263 Ga0495686_0000613 3300047472 Bacteria 49253
264 Ga0496102_0011682 3300048905 Bacteria 7581
265 Ga0496103_0008622 3300048906 Bacteria 6055
266 Ga0496104_0110009 3300048907 Bacteria 2641
267 Ga0496106_0135684 3300048909 Bacteria 1932
268 Ga0496110_0140994 3300048913 Bacteria 2179
269 Ga0496111_0005007 3300048914 Bacteria 8430
270 Ga0496111_0153817 3300048914 Bacteria 1707
271 Ga0496111_0440266 3300048914 Bacteria 962
272 Ga0496112_1072320 3300048915 Bacteria 724
273 Ga0496113_0016544 3300048916 Bacteria 5098
274 Ga0496115_0113228 3300048918 Bacteria 2229
275 Ga0496116_0000036 3300048919 Bacteria 388508
276 Ga0496116_0028892 3300048919 Bacteria 4009
277 Ga0496116_0030413 3300048919 Bacteria 3879
278 Ga0496116_0122294 3300048919 Bacteria 1503
279 Ga0496117_0000002 3300048920 Bacteria 2483758
280 Ga0496117_0006286 3300048920 Bacteria 12091
281 Ga0496117_0034950 3300048920 Bacteria 3780
282 Ga0496118_0000084 3300048921 Bacteria 181733
283 Ga0496118_0000396 3300048921 Bacteria 73830
284 Ga0496118_0037022 3300048921 Bacteria 3934
285 Ga0496119_0015105 3300048922 Bacteria 5976
286 Ga0496119_0027835 3300048922 Bacteria 3872
287 Ga0496119_0073005 3300048922 Bacteria 2002
288 Ga0496119_0131286 3300048922 Bacteria 1365
289 Ga0496120_0000087 3300048923 Bacteria 152857
290 Ga0496120_0052565 3300048923 Bacteria 2319
291 Ga0496120_0422386 3300048923 Bacteria 585
292 Ga0496121_0000001 3300048924 Bacteria 1830318
293 Ga0496121_0001010 3300048924 Bacteria 50285
294 Ga0496121_0001141 3300048924 Bacteria 46594
295 Ga0496121_0025166 3300048924 Bacteria 5661
296 Ga0496121_0064478 3300048924 Bacteria 2987
297 Ga0496121_0110909 3300048924 Bacteria 2093
298 Ga0496121_0297016 3300048924 Bacteria 1098
299 Ga0496122_0000001 3300048925 Bacteria 1827766
300 Ga0496122_0000009 3300048925 Bacteria 584024
301 Ga0496122_0000106 3300048925 Bacteria 193672
302 Ga0496122_0013058 3300048925 Bacteria 8180
303 Ga0496122_0015206 3300048925 Bacteria 7367
304 Ga0496122_0052205 3300048925 Bacteria 3097
305 Ga0496122_0067194 3300048925 Bacteria 2584
306 Ga0496122_0095049 3300048925 Bacteria 2015
307 Ga0496122_0239159 3300048925 Bacteria 1025
308 Ga0496123_0000001 3300048926 Bacteria 1831497
309 Ga0496123_0007453 3300048926 Bacteria 10298
310 Ga0496123_0007860 3300048926 Bacteria 9917
311 Ga0496123_0057243 3300048926 Bacteria 2539
312 Ga0496123_0161009 3300048926 Bacteria 1196
313 Ga0496124_0000133 3300048927 Bacteria 154328
314 Ga0496124_0017643 3300048927 Bacteria 6720
315 Ga0496124_0030507 3300048927 Bacteria 4785
316 Ga0496124_0030549 3300048927 Bacteria 4780
317 Ga0496124_0052164 3300048927 Bacteria 3476
318 Ga0496124_0210195 3300048927 Bacteria 1473
319 Ga0496124_0212805 3300048927 Bacteria 1461
320 Ga0496124_0480062 3300048927 Bacteria 839
321 Ga0496124_0605693 3300048927 Bacteria 711
322 Ga0496125_0000001 3300048928 Bacteria 1766138
323 Ga0496125_0007816 3300048928 Bacteria 11305
324 Ga0496125_0012245 3300048928 Bacteria 8532
325 Ga0496125_0062106 3300048928 Bacteria 2990
326 Ga0496126_0001111 3300048929 Bacteria 45099
327 Ga0496126_0076529 3300048929 Bacteria 2968
328 Ga0496126_0271404 3300048929 Bacteria 1407
329 Ga0496126_0766130 3300048929 Bacteria 744
330 Ga0501032_0443016 3300049569 Bacteria 832
331 Ga0501033_0000038 3300049570 Bacteria 144438
332 Ga0501073_0050372 3300049589 Bacteria 2918
333 Ga0501073_0566135 3300049589 Bacteria 785
334 Ga0501074_0579567 3300049590 Bacteria 794
335 Ga0501238_009603 3300049671 Bacteria 1284
336 Ga0501079_1033732 3300049741 Bacteria 647
337 Ga0501080_0327946 3300049742 Bacteria 1385
338 Ga0501280_002457 3300049776 Bacteria 3081
339 Ga0501280_021713 3300049776 Bacteria 959
340 Ga0501035_0000326 3300049822 Bacteria 55174
341 Ga0501044_0374382 3300049823 Bacteria 1340
342 nmdc:mga03n38_9588_c1 3300050490 Bacteria 3529
343 nmdc:mga00v17_244489_c1 3300050491 Bacteria 1164
344 nmdc:mga00v17_325606_c1 3300050491 Bacteria 998
345 nmdc:mga00v17_52_c1 3300050491 Bacteria 72738
346 nmdc:mga0yw44_36498_c1 3300050492 Bacteria 2896
347 nmdc:mga0yw44_36786_c1 3300050492 Bacteria 2887
348 nmdc:mga0k408_87799_c1 3300050493 Bacteria 1827
349 nmdc:mga06z11_308360_c1 3300050494 Bacteria 942
350 nmdc:mga07m45_208570_c1 3300050496 Bacteria 1137
351 nmdc:mga06r32_33896_c1 3300050510 Bacteria 4812
352 nmdc:mga08x19_121754_c1 3300050514 Bacteria 1749
353 nmdc:mga0sz30_1906_c1 3300050516 Bacteria 7447
354 nmdc:mga0sz30_70596_c1 3300050516 Bacteria 1503
355 Ga0495619_0057278 3300053085 Bacteria 2586
356 Ga0500643_004960 3300053087 Bacteria 5853
357 Ga0500644_0000781 3300053088 Bacteria 10867
358 Ga0500646_0044020 3300053090 Bacteria 1266
359 Ga0500651_0214340 3300053093 Bacteria 1131
360 Ga0500566_0012016 3300053094 Bacteria 5099
361 Ga0500560_000501 3300053107 Bacteria 5485
362 Ga0500569_013863 3300053109 Bacteria 1984
363 Ga0500572_000194 3300053111 Bacteria 21418
364 Ga0500595_000002 3300053119 Bacteria 1074388
365 Ga0500595_055022 3300053119 Bacteria 1219
366 Ga0500607_045137 3300053121 Bacteria 2367
367 Ga0500608_006049 3300053122 Bacteria 4882
368 Ga0500614_090431 3300053123 Bacteria 869
369 Ga0500618_000055 3300053125 Bacteria 99876
370 Ga0500618_000945 3300053125 Bacteria 14881
371 Ga0500652_000062 3300053131 Bacteria 47514
372 Ga0500652_013374 3300053131 Bacteria 2904
373 Ga0500559_0000979 3300053136 Bacteria 17809
374 Ga0500559_0007920 3300053136 Bacteria 4685
375 Ga0500573_0000780 3300053140 Bacteria 14326
376 Ga0500573_0089940 3300053140 Bacteria 1735
377 Ga0500616_0000002 3300053153 Bacteria 1611257
378 Ga0500616_0002928 3300053153 Bacteria 13602
379 Ga0500616_0206442 3300053153 Bacteria 866
380 Ga0500624_001959 3300053157 Bacteria 2939
381 Ga0500624_047045 3300053157 Bacteria 793
382 Ga0500634_0002869 3300053161 Bacteria 7461
383 Ga0500634_0023083 3300053161 Bacteria 3381
384 Ga0500639_009890 3300053163 Bacteria 4990
385 Ga0500636_0000004 3300053177 Bacteria 202392
386 Ga0500636_0000820 3300053177 Bacteria 16724
387 Ga0500636_0054912 3300053177 Bacteria 2335
388 Ga0500576_025879 3300053725 Bacteria 2675
389 Ga0500645_000012 3300053730 Bacteria 168579
390 Ga0500565_001313 3300053734 Bacteria 1640
391 Ga0587090_007679 3300059510 Bacteria 1423
392 Ga0587072_014032 3300059643 Bacteria 1346
393 Ga0466962_0027943 3300061719 Bacteria 2704

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053119 Ga0500595_055022 Ga0500595_055022_424_918 130
2 3300053123 Ga0500614_090431 Ga0500614_090431_228_722 130
3 3300053131 Ga0500652_000062 Ga0500652_000062_31431_31925 130
4 3300053177 Ga0500636_0054912 Ga0500636_0054912_200_694 130
5 3300027312 Ga0209371_1001001 Ga0209371_10010016 132
6 3300030500 Ga0268256_1026173 Ga0268256_10261732 132
7 3300047470 Ga0495681_0011685 Ga0495681_0011685_2482_2988 137
8 3300048915 Ga0496112_1072320 Ga0496112_1072320_132_584 141
9 3300048927 Ga0496124_0212805 Ga0496124_0212805_18_464 142
10 3300053153 Ga0500616_0002928 Ga0500616_0002928_9940_10425 143
11 iso_pu_bacteria 8005658619 8005660085 143
12 3300003781 Ga0055536_1002131 Ga0055536_10021316 144
13 3300003792 Ga0055540_1003388 Ga0055540_10033882 144
14 3300003794 Ga0055531_10003223 Ga0055531_100032239 144
15 3300025292 Ga0209676_1032958 Ga0209676_10329582 144
16 3300025297 Ga0209758_1000121 Ga0209758_1000121127 144
17 3300025298 Ga0209050_1002888 Ga0209050_10028887 144
18 3300025303 Ga0209051_1001239 Ga0209051_10012398 144
19 3300025304 Ga0209257_1032555 Ga0209257_10325552 144
20 3300025304 Ga0209257_1032558 Ga0209257_10325582 144
21 3300048927 Ga0496124_0000133 Ga0496124_0000133_90312_90797 144
22 iso_pu_bacteria 2775507049 2776912633 144
23 iso_pu_bacteria 2818991461 2819684283 144
24 iso_pu_bacteria 2854916844 2854921658 144
25 3300005328 Ga0070676_10118877 Ga0070676_101188772 145
26 3300005347 Ga0070668_100486269 Ga0070668_1004862692 145
27 3300005439 Ga0070711_100747284 Ga0070711_1007472842 145
28 3300005578 Ga0068854_100394108 Ga0068854_1003941082 145
29 3300006175 Ga0070712_100111918 Ga0070712_1001119182 145
30 3300006847 Ga0075431_100034414 Ga0075431_1000344143 145
31 3300009147 Ga0114129_10048144 Ga0114129_100481442 145
32 3300009176 Ga0105242_10267060 Ga0105242_102670602 145
33 3300025907 Ga0207645_10079055 Ga0207645_100790552 145
34 3300025915 Ga0207693_10071773 Ga0207693_100717732 145
35 3300025923 Ga0207681_10147047 Ga0207681_101470472 145
36 3300025934 Ga0207686_10281055 Ga0207686_102810552 145
37 3300028379 Ga0268266_10755119 Ga0268266_107551192 145
38 3300042157 Ga0439458_0026517 Ga0439458_0026517_471_944 145
39 3300048909 Ga0496106_0135684 Ga0496106_0135684_800_1300 145
40 3300048924 Ga0496121_0064478 Ga0496121_0064478_159_659 145
41 3300048929 Ga0496126_0766130 Ga0496126_0766130_95_619 145
42 3300050510 nmdc:mga06r32_33896_c1 nmdc:mga06r32_33896_c1_1658_2116 145
43 iso_pu_bacteria 2508501122 2509107448 145
44 iso_pu_bacteria 2509276019 2509374560 145
45 iso_pu_bacteria 2510065057 2510304479 145
46 iso_pu_bacteria 2510461069 2510842891 145
47 iso_pu_bacteria 2510917022 2511133622 145
48 iso_pu_bacteria 2510917026 2511173684 145
49 iso_pu_bacteria 2511231052 2511500903 145
50 iso_pu_bacteria 2512047086 2512532326 145
51 iso_pu_bacteria 2513237086 2513583559 145
52 iso_pu_bacteria 2513237091 2513617515 145
53 iso_pu_bacteria 2513237140 2513882772 145
54 iso_pu_bacteria 2513237143 2513905316 145
55 iso_pu_bacteria 2513237159 2513999448 145
56 iso_pu_bacteria 2515154107 2515608029 145
57 iso_pu_bacteria 2516143018 2516208783 145
58 iso_pu_bacteria 2516653046 2516892180 145
59 iso_pu_bacteria 2524023207 2524450227 145
60 iso_pu_bacteria 2524023209 2524457900 145
61 iso_pu_bacteria 2537561587 2537874540 145
62 iso_pu_bacteria 2551306084 2551676363 145
63 iso_pu_bacteria 2551306085 2551687470 145
64 iso_pu_bacteria 2551306086 2551693401 145
65 iso_pu_bacteria 2551306087 2551699187 145
66 iso_pu_bacteria 2551306089 2551714775 145
67 iso_pu_bacteria 2551306090 2551719035 145
68 iso_pu_bacteria 2551306091 2551730346 145
69 iso_pu_bacteria 2551306092 2551734581 145
70 iso_pu_bacteria 2551306093 2551745404 145
71 iso_pu_bacteria 2554235003 2554247000 145
72 iso_pu_bacteria 2558860100 2558863589 145
73 iso_pu_bacteria 2558860242 2559294225 145
74 iso_pu_bacteria 2582581306 2585266296 145
75 iso_pu_bacteria 2582581307 2585275766 145
76 iso_pu_bacteria 2582581308 2585278788 145
77 iso_pu_bacteria 2582581315 2585325598 145
78 iso_pu_bacteria 2582581316 2585329753 145
79 iso_pu_bacteria 2582581865 2585387297 145
80 iso_pu_bacteria 2582581866 2585397798 145
81 iso_pu_bacteria 2585427527 2585535898 145
82 iso_pu_bacteria 2585427530 2585554019 145
83 iso_pu_bacteria 2585427531 2585559315 145
84 iso_pu_bacteria 2585427608 2585901219 145
85 iso_pu_bacteria 2585427609 2585905309 145
86 iso_pu_bacteria 2585427633 2585994973 145
87 iso_pu_bacteria 2585427634 2585999516 145
88 iso_pu_bacteria 2585428125 2587979576 145
89 iso_pu_bacteria 2599185210 2599603440 145
90 iso_pu_bacteria 2599185236 2599724201 145
91 iso_pu_bacteria 2599185352 2600191829 145
92 iso_pu_bacteria 2600255279 2601608792 145
93 iso_pu_bacteria 2600255308 2601745566 145
94 iso_pu_bacteria 2615840626 2616305938 145
95 iso_pu_bacteria 2615840698 2616553817 145
96 iso_pu_bacteria 2617270742 2617381936 145
97 iso_pu_bacteria 2643221557 2643807309 145
98 iso_pu_bacteria 2643221568 2643856005 145
99 iso_pu_bacteria 2643221582 2643918596 145
100 iso_pu_bacteria 2643221607 2644046691 145
101 iso_pu_bacteria 2643221610 2644069721 145
102 iso_pu_bacteria 2643221618 2644109100 145
103 iso_pu_bacteria 2643221626 2644151620 145
104 iso_pu_bacteria 2643221636 2644202398 145
105 iso_pu_bacteria 2643221637 2644206313 145
106 iso_pu_bacteria 2643221653 2644296967 145
107 iso_pu_bacteria 2643221655 2644311756 145
108 iso_pu_bacteria 2643221659 2644330027 145
109 iso_pu_bacteria 2643221668 2644380692 145
110 iso_pu_bacteria 2643221675 2644414597 145
111 iso_pu_bacteria 2643221680 2644448254 145
112 iso_pu_bacteria 2643221686 2644479480 145
113 iso_pu_bacteria 2643221688 2644493501 145
114 iso_pu_bacteria 2643221693 2644518859 145
115 iso_pu_bacteria 2643221698 2644543219 145
116 iso_pu_bacteria 2643221712 2644617554 145
117 iso_pu_bacteria 2643221718 2644649961 145
118 iso_pu_bacteria 2643221719 2644655221 145
119 iso_pu_bacteria 2643221723 2644673654 145
120 iso_pu_bacteria 2643221726 2644689439 145
121 iso_pu_bacteria 2657244999 2657682216 145
122 iso_pu_bacteria 2667528174 2671112744 145
123 iso_pu_bacteria 2690316117 2692316922 145
124 iso_pu_bacteria 2751185821 2753458898 145
125 iso_pu_bacteria 2775507266 2778177347 145
126 iso_pu_bacteria 2791355082 2792584063 145
127 iso_pu_bacteria 2791355091 2792622134 145
128 iso_pu_bacteria 2791355092 2792628301 145
129 iso_pu_bacteria 2791355094 2792638441 145
130 iso_pu_bacteria 2802429268 2804751235 145
131 iso_pu_bacteria 2808606387 2808985999 145
132 iso_pu_bacteria 2818991272 2819242682 145
133 iso_pu_bacteria 2818991439 2819556120 145
134 iso_pu_bacteria 2818991448 2819613631 145
135 iso_pu_bacteria 2818991453 2819639367 145
136 iso_pu_bacteria 2821123053 2821124130 145
137 iso_pu_bacteria 2838029111 2838031296 145
138 iso_pu_bacteria 2838074704 2838076340 145
139 iso_pu_bacteria 2838675328 2838676847 145
140 iso_pu_bacteria 2838714209 2838715732 145
141 iso_pu_bacteria 2838719591 2838720467 145
142 iso_pu_bacteria 2838724970 2838726487 145
143 iso_pu_bacteria 2838736955 2838738846 145
144 iso_pu_bacteria 2841840854 2841842745 145
145 iso_pu_bacteria 2841846520 2841847397 145
146 iso_pu_bacteria 2841859092 2841860064 145
147 iso_pu_bacteria 2842124991 2842126573 145
148 iso_pu_bacteria 2842130223 2842131740 145
149 iso_pu_bacteria 2842140634 2842142525 145
150 iso_pu_bacteria 2842152218 2842153091 145
151 iso_pu_bacteria 2842170452 2842171976 145
152 iso_pu_bacteria 2842175837 2842176710 145
153 iso_pu_bacteria 2842187318 2842188841 145
154 iso_pu_bacteria 2842211629 2842213153 145
155 iso_pu_bacteria 2842224351 2842225229 145
156 iso_pu_bacteria 2842298080 2842300483 145
157 iso_pu_bacteria 2842357229 2842358399 145
158 iso_pu_bacteria 2842475841 2842478109 145
159 iso_pu_bacteria 2842482326 2842482736 145
160 iso_pu_bacteria 2842502639 2842504918 145
161 iso_pu_bacteria 2842509118 2842509605 145
162 iso_pu_bacteria 2842509118 2842514338 145
163 iso_pu_bacteria 2842515876 2842516849 145
164 iso_pu_bacteria 2842521101 2842525241 145
165 iso_pu_bacteria 2844163670 2844163894 145
166 iso_pu_bacteria 2847417321 2847418009 145
167 iso_pu_bacteria 2848992105 2848992986 145
168 iso_pu_bacteria 2850079185 2850080372 145
169 iso_pu_bacteria 2852387548 2852388945 145
170 iso_pu_bacteria 2854896431 2854898758 145
171 iso_pu_bacteria 2855825444 2855831254 145
172 iso_pu_bacteria 2855839649 2855840379 145
173 iso_pu_bacteria 2855872281 2855879048 145
174 iso_pu_bacteria 2857531043 2857531711 145
175 iso_pu_bacteria 2858800743 2858800909 145
176 iso_pu_bacteria 2896384573 2896386542 145
177 iso_pu_bacteria 2899792073 2899792132 145
178 iso_pu_bacteria 2899803654 2899806116 145
179 iso_pu_bacteria 2899845264 2899846291 145
180 iso_pu_bacteria 2913295892 2913297540 145
181 iso_pu_bacteria 2915986958 2915993307 145
182 iso_pu_bacteria 2915993759 2915997892 145
183 iso_pu_bacteria 2916000859 2916005714 145
184 iso_pu_bacteria 2916007675 2916012787 145
185 iso_pu_bacteria 2916014648 2916020961 145
186 iso_pu_bacteria 2916021584 2916022512 145
187 iso_pu_bacteria 2916028427 2916034603 145
188 iso_pu_bacteria 2916035215 2916035350 145
189 iso_pu_bacteria 2916041962 2916043281 145
190 iso_pu_bacteria 2916048683 2916052490 145
191 iso_pu_bacteria 2916055098 2916057598 145
192 iso_pu_bacteria 2916068649 2916072964 145
193 iso_pu_bacteria 2916076590 2916076728 145
194 iso_pu_bacteria 2919114240 2919115935 145
195 iso_pu_bacteria 2919166419 2919167229 145
196 iso_pu_bacteria 2919171160 2919171574 145
197 iso_pu_bacteria 2919408235 2919409183 145
198 iso_pu_bacteria 2920760137 2920762973 145
199 iso_pu_bacteria 2920822456 2920823745 145
200 iso_pu_bacteria 2921201388 2921201772 145
201 iso_pu_bacteria 2921208531 2921209733 145
202 iso_pu_bacteria 2921237296 2921243927 145
203 iso_pu_bacteria 2921244191 2921245964 145
204 iso_pu_bacteria 2921263974 2921269353 145
205 iso_pu_bacteria 2921282425 2921286411 145
206 iso_pu_bacteria 2921289301 2921294058 145
207 iso_pu_bacteria 2921296804 2921302223 145
208 iso_pu_bacteria 2924144063 2924146924 145
209 iso_pu_bacteria 2924150972 2924156262 145
210 iso_pu_bacteria 2924158325 2924160504 145
211 iso_pu_bacteria 2924165586 2924166115 145
212 iso_pu_bacteria 2924172951 2924178551 145
213 iso_pu_bacteria 2924179722 2924181494 145
214 iso_pu_bacteria 2924186466 2924190288 145
215 iso_pu_bacteria 2924193448 2924195957 145
216 iso_pu_bacteria 2924200457 2924204391 145
217 iso_pu_bacteria 2924207177 2924207427 145
218 iso_pu_bacteria 2924214083 2924216461 145
219 iso_pu_bacteria 2924221636 2924224437 145
220 iso_pu_bacteria 2924228884 2924234867 145
221 iso_pu_bacteria 2926754445 2926756889 145
222 iso_pu_bacteria 2926760298 2926761113 145
223 iso_pu_bacteria 2929138655 2929139319 145
224 iso_pu_bacteria 2933006813 2933007734 145
225 iso_pu_bacteria 2933011516 2933012509 145
226 iso_pu_bacteria 2933594066 2933594949 145
227 iso_pu_bacteria 2936996657 2937000459 145
228 iso_pu_bacteria 2937002841 2937009584 145
229 iso_pu_bacteria 2937009748 2937010818 145
230 iso_pu_bacteria 2937016420 2937020814 145
231 iso_pu_bacteria 2937042894 2937049617 145
232 iso_pu_bacteria 2937049772 2937052646 145
233 iso_pu_bacteria 2937056579 2937061602 145
234 iso_pu_bacteria 2937063883 2937066481 145
235 iso_pu_bacteria 2937071275 2937073811 145
236 iso_pu_bacteria 2937091812 2937098953 145
237 iso_pu_bacteria 2937098957 2937103696 145
238 iso_pu_bacteria 2937106411 2937111589 145
239 iso_pu_bacteria 2937113482 2937118241 145
240 iso_pu_bacteria 2937119839 2937121117 145
241 iso_pu_bacteria 2937126314 2937130154 145
242 iso_pu_bacteria 2941499720 2941500322 145
243 iso_pu_bacteria 2957382221 2957385137 145
244 iso_pu_bacteria 2957388812 2957389200 145
245 iso_pu_bacteria 2957402308 2957402675 145
246 iso_pu_bacteria 2957408893 2957415211 145
247 iso_pu_bacteria 2957415311 2957418018 145
248 iso_pu_bacteria 2957422303 2957425803 145
249 iso_pu_bacteria 2957430029 2957433143 145
250 iso_pu_bacteria 2957443900 2957449908 145
251 iso_pu_bacteria 2957450854 2957453508 145
252 iso_pu_bacteria 2957457609 2957457828 145
253 iso_pu_bacteria 2957464669 2957466446 145
254 iso_pu_bacteria 2957471148 2957473983 145
255 iso_pu_bacteria 2957478035 2957483731 145
256 iso_pu_bacteria 2957484790 2957485858 145
257 iso_pu_bacteria 2957491536 2957495927 145
258 iso_pu_bacteria 2957498199 2957499810 145
259 iso_pu_bacteria 2957505466 2957510303 145
260 iso_pu_bacteria 2960584000 2960587126 145
261 iso_pu_bacteria 2960597568 2960600643 145
262 iso_pu_bacteria 2960603979 2960609420 145
263 iso_pu_bacteria 2960610863 2960613798 145
264 iso_pu_bacteria 2960617483 2960617638 145
265 iso_pu_bacteria 2960624210 2960625480 145
266 iso_pu_bacteria 2960637947 2960642343 145
267 iso_pu_bacteria 2960645483 2960652778 145
268 iso_pu_bacteria 2960652885 2960656797 145
269 iso_pu_bacteria 2960660292 2960662315 145
270 iso_pu_bacteria 2960667422 2960673857 145
271 iso_pu_bacteria 2960674078 2960676136 145
272 iso_pu_bacteria 2960687367 2960691072 145
273 iso_pu_bacteria 2964607997 2964612094 145
274 iso_pu_bacteria 2964621998 2964623233 145
275 iso_pu_bacteria 2964628898 2964633185 145
276 iso_pu_bacteria 2964636051 2964642114 145
277 iso_pu_bacteria 2964643177 2964648742 145
278 iso_pu_bacteria 2964649959 2964653034 145
279 iso_pu_bacteria 2964656573 2964661096 145
280 iso_pu_bacteria 2964663802 2964666041 145
281 iso_pu_bacteria 2964670856 2964677680 145
282 iso_pu_bacteria 2964678106 2964683678 145
283 iso_pu_bacteria 2964685014 2964689155 145
284 iso_pu_bacteria 2964691889 2964695773 145
285 iso_pu_bacteria 2964698721 2964701881 145
286 iso_pu_bacteria 2964705432 2964712390 145
287 iso_pu_bacteria 2964712639 2964718630 145
288 iso_pu_bacteria 2964719344 2964726204 145
289 iso_pu_bacteria 2967664464 2967669707 145
290 iso_pu_bacteria 2967671571 2967673703 145
291 iso_pu_bacteria 2967678726 2967678856 145
292 iso_pu_bacteria 2967693043 2967693177 145
293 iso_pu_bacteria 2967699805 2967702590 145
294 iso_pu_bacteria 2967706974 2967709235 145
295 iso_pu_bacteria 2967714385 2967716598 145
296 iso_pu_bacteria 2967721400 2967724790 145
297 iso_pu_bacteria 2967735183 2967740966 145
298 iso_pu_bacteria 2967742019 2967746063 145
299 iso_pu_bacteria 2967748971 2967752173 145
300 iso_pu_bacteria 2967762386 2967763751 145
301 iso_pu_bacteria 2967769361 2967773125 145
302 iso_pu_bacteria 2967775926 2967777195 145
303 iso_pu_bacteria 2970019648 2970026002 145
304 iso_pu_bacteria 2970033650 2970039146 145
305 iso_pu_bacteria 2970040964 2970047626 145
306 iso_pu_bacteria 2970047711 2970049987 145
307 iso_pu_bacteria 2970054988 2970059676 145
308 iso_pu_bacteria 2970061556 2970067858 145
309 iso_pu_bacteria 2970068827 2970074952 145
310 iso_pu_bacteria 2970076120 2970076432 145
311 iso_pu_bacteria 2970082768 2970086619 145
312 iso_pu_bacteria 2970088815 2970093471 145
313 iso_pu_bacteria 2970095765 2970101672 145
314 iso_pu_bacteria 2970109326 2970109887 145
315 iso_pu_bacteria 2970116247 2970118036 145
316 iso_pu_bacteria 2970129317 2970129450 145
317 iso_pu_bacteria 2970136068 2970136959 145
318 iso_pu_bacteria 2970149975 2970153882 145
319 iso_pu_bacteria 2970156795 2970162382 145
320 iso_pu_bacteria 2970164137 2970167436 145
321 iso_pu_bacteria 2970170962 2970171537 145
322 iso_pu_bacteria 2970177841 2970182202 145
323 iso_pu_bacteria 2970184632 2970189424 145
324 iso_pu_bacteria 2970191845 2970198392 145
325 iso_pu_bacteria 2977516862 2977518637 145
326 iso_pu_bacteria 2977523885 2977527207 145
327 iso_pu_bacteria 2977537788 2977537921 145
328 iso_pu_bacteria 2977551784 2977551918 145
329 iso_pu_bacteria 2977558990 2977563130 145
330 iso_pu_bacteria 2977565890 2977568911 145
331 iso_pu_bacteria 2977572785 2977579029 145
332 iso_pu_bacteria 2977579622 2977581562 145
333 iso_pu_bacteria 2978969890 2978973655 145
334 iso_pu_bacteria 2979089926 2979093603 145
335 iso_pu_bacteria 2979095461 2979099009 145
336 iso_pu_bacteria 2979100975 2979105583 145
337 iso_pu_bacteria 2984509177 2984512569 145
338 iso_pu_bacteria 2984518228 2984521070 145
339 iso_pu_bacteria 2984537506 2984540364 145
340 iso_pu_bacteria 2984587000 2984591929 145
341 iso_pu_bacteria 2984601300 2984602561 145
342 iso_pu_bacteria 2989771324 2989771932 145
343 iso_pu_bacteria 2989776772 2989778051 145
344 iso_pu_bacteria 3005416602 3005417727 145
345 iso_pu_bacteria 643692032 643824987 145
346 iso_pu_bacteria 648276728 648740535 145
347 iso_pu_bacteria 650716007 650739416 145
348 iso_pu_bacteria 8003570095 8003570458 145
349 iso_pu_bacteria 8003992118 8003992796 145
350 iso_pu_bacteria 8005246636 8005246707 145
351 iso_pu_bacteria 8005314921 8005315083 145
352 iso_pu_bacteria 8005314921 8005318064 145
353 iso_pu_bacteria 8005484373 8005485745 145
354 iso_pu_bacteria 8005645114 8005648112 145
355 iso_pu_bacteria 8005682033 8005684719 145
356 iso_pu_bacteria 8024486573 8024489866 145
357 iso_pu_bacteria 8046767195 8046767549 145
358 iso_pu_bacteria 8049293176 8049293816 145
359 iso_pu_bacteria 8054460903 8054461768 145
360 iso_pu_bacteria 8054558443 8054563584 145
361 iso_pu_bacteria 8055431914 8055434057 145
362 iso_pu_bacteria 8056875544 8056880013 145
363 iso_pu_bacteria 8057575449 8057579107 145
364 3300005539 Ga0068853_100003501 Ga0068853_10000350113 146
365 3300005564 Ga0070664_101407448 Ga0070664_1014074482 146
366 3300005985 Ga0081539_10273761 Ga0081539_102737611 146
367 3300006881 Ga0068865_100341634 Ga0068865_1003416342 146
368 3300010375 Ga0105239_10847388 Ga0105239_108473882 146
369 3300013297 Ga0157378_12629022 Ga0157378_126290221 146
370 3300014326 Ga0157380_10517191 Ga0157380_105171912 146
371 3300031241 Ga0265325_10032431 Ga0265325_100324312 146
372 3300035724 Ga0373933_0282428 Ga0373933_0282428_513_977 146
373 3300053088 Ga0500644_0000781 Ga0500644_0000781_8916_9374 146
374 3300053131 Ga0500652_013374 Ga0500652_013374_778_1236 146
375 3300053153 Ga0500616_0000002 Ga0500616_0000002_671515_671973 146
376 3300053730 Ga0500645_000012 Ga0500645_000012_40353_40811 146
377 3300025942 Ga0207689_10186811 Ga0207689_101868112 147
378 3300028379 Ga0268266_10518792 Ga0268266_105187922 147
379 3300031616 Ga0307508_10408162 Ga0307508_104081622 147
380 3300046524 Ga0495648_0242839 Ga0495648_0242839_149_640 147
381 3300048907 Ga0496104_0110009 Ga0496104_0110009_1782_2291 147
382 3300048918 Ga0496115_0113228 Ga0496115_0113228_1044_1505 147
383 3300048922 Ga0496119_0015105 Ga0496119_0015105_3472_3981 147
384 3300048925 Ga0496122_0000009 Ga0496122_0000009_85718_86248 147
385 3300049589 Ga0501073_0050372 Ga0501073_0050372_1974_2441 147
386 3300049589 Ga0501073_0566135 Ga0501073_0566135_296_763 147
387 3300049590 Ga0501074_0579567 Ga0501074_0579567_189_656 147
388 3300049741 Ga0501079_1033732 Ga0501079_1033732_53_520 147
389 3300049742 Ga0501080_0327946 Ga0501080_0327946_453_920 147
390 3300049823 Ga0501044_0374382 Ga0501044_0374382_577_1020 147
391 3300053121 Ga0500607_045137 Ga0500607_045137_1532_1981 147
392 3300053140 Ga0500573_0000780 Ga0500573_0000780_2161_2613 147
393 3300053140 Ga0500573_0089940 Ga0500573_0089940_486_938 147
394 3300053161 Ga0500634_0002869 Ga0500634_0002869_2781_3230 147
395 3300053734 Ga0500565_001313 Ga0500565_001313_130_579 147
396 3300005262 Ga0065165_1006277 Ga0065165_10062774 148
397 3300005329 Ga0070683_100689029 Ga0070683_1006890291 148
398 3300005336 Ga0070680_100008482 Ga0070680_1000084824 148
399 3300005336 Ga0070680_100062152 Ga0070680_1000621522 148
400 3300005339 Ga0070660_100085737 Ga0070660_1000857372 148
401 3300005344 Ga0070661_100169973 Ga0070661_1001699732 148
402 3300005366 Ga0070659_100032152 Ga0070659_1000321524 148
403 3300005366 Ga0070659_101147645 Ga0070659_1011476452 148
404 3300005435 Ga0070714_100024490 Ga0070714_1000244902 148
405 3300005437 Ga0070710_10389396 Ga0070710_103893962 148
406 3300005439 Ga0070711_100518830 Ga0070711_1005188302 148
407 3300005530 Ga0070679_100248409 Ga0070679_1002484091 148
408 3300005535 Ga0070684_100194099 Ga0070684_1001940992 148
409 3300005539 Ga0068853_100199143 Ga0068853_1001991432 148
410 3300005539 Ga0068853_100337428 Ga0068853_1003374282 148
411 3300005547 Ga0070693_100290156 Ga0070693_1002901562 148
412 3300005563 Ga0068855_100019140 Ga0068855_1000191404 148
413 3300005563 Ga0068855_100517370 Ga0068855_1005173702 148
414 3300005563 Ga0068855_102238740 Ga0068855_1022387402 148
415 3300005577 Ga0068857_100099392 Ga0068857_1000993922 148
416 3300005578 Ga0068854_100289276 Ga0068854_1002892762 148
417 3300005616 Ga0068852_100014111 Ga0068852_1000141112 148
418 3300006175 Ga0070712_100533098 Ga0070712_1005330982 148
419 3300006914 Ga0075436_100032738 Ga0075436_1000327384 148
420 3300009551 Ga0105238_10916640 Ga0105238_109166401 148
421 3300010375 Ga0105239_11284261 Ga0105239_112842612 148
422 3300013100 Ga0157373_10554686 Ga0157373_105546862 148
423 3300013104 Ga0157370_10164829 Ga0157370_101648293 148
424 3300013105 Ga0157369_10442725 Ga0157369_104427252 148
425 3300013307 Ga0157372_10092379 Ga0157372_100923794 148
426 3300025912 Ga0207707_10379544 Ga0207707_103795441 148
427 3300025913 Ga0207695_10836915 Ga0207695_108369151 148
428 3300025915 Ga0207693_10012816 Ga0207693_100128166 148
429 3300025916 Ga0207663_10158114 Ga0207663_101581142 148
430 3300025917 Ga0207660_10019044 Ga0207660_100190443 148
431 3300025917 Ga0207660_10041434 Ga0207660_100414342 148
432 3300025919 Ga0207657_10163197 Ga0207657_101631972 148
433 3300025920 Ga0207649_10194352 Ga0207649_101943522 148
434 3300025921 Ga0207652_10175794 Ga0207652_101757942 148
435 3300025929 Ga0207664_10219165 Ga0207664_102191652 148
436 3300025932 Ga0207690_11084353 Ga0207690_110843532 148
437 3300025944 Ga0207661_10058969 Ga0207661_100589693 148
438 3300025949 Ga0207667_10096670 Ga0207667_100966702 148
439 3300025949 Ga0207667_10163651 Ga0207667_101636512 148
440 3300025949 Ga0207667_10241500 Ga0207667_102415002 148
441 3300025949 Ga0207667_11950947 Ga0207667_119509471 148
442 3300025981 Ga0207640_10116982 Ga0207640_101169822 148
443 3300026041 Ga0207639_10189792 Ga0207639_101897922 148
444 3300026078 Ga0207702_10501763 Ga0207702_105017632 148
445 3300028800 Ga0265338_10383584 Ga0265338_103835841 148
446 3300031249 Ga0265339_10160866 Ga0265339_101608662 148
447 3300031711 Ga0265314_10002263 Ga0265314_1000226312 148
448 3300035114 Ga0373939_0001378 Ga0373939_0001378_5311_5775 148
449 3300038735 Ga0400485_00599 Ga0400485_00599_1396_1866 148
450 3300038742 Ga0400486_12542 Ga0400486_12542_571_1041 148
451 3300041496 Ga0451839_0390476 Ga0451839_0390476_41_505 148
452 3300046530 Ga0495654_0117822 Ga0495654_0117822_248_727 148
453 3300048914 Ga0496111_0153817 Ga0496111_0153817_865_1338 148
454 3300048921 Ga0496118_0037022 Ga0496118_0037022_2045_2557 148
455 3300048924 Ga0496121_0297016 Ga0496121_0297016_154_666 148
456 3300048925 Ga0496122_0000106 Ga0496122_0000106_224_751 148
457 3300048927 Ga0496124_0210195 Ga0496124_0210195_19_552 148
458 3300048928 Ga0496125_0012245 Ga0496125_0012245_5032_5544 148
459 3300050514 nmdc:mga08x19_121754_c1 nmdc:mga08x19_121754_c1_321_785 148
460 3300053085 Ga0495619_0057278 Ga0495619_0057278_233_706 148
461 3300053087 Ga0500643_004960 Ga0500643_004960_4376_4849 148
462 3300053090 Ga0500646_0044020 Ga0500646_0044020_263_751 148
463 3300053093 Ga0500651_0214340 Ga0500651_0214340_171_644 148
464 3300053094 Ga0500566_0012016 Ga0500566_0012016_294_767 148
465 3300053111 Ga0500572_000194 Ga0500572_000194_14237_14698 148
466 3300053119 Ga0500595_000002 Ga0500595_000002_602145_602618 148
467 3300053136 Ga0500559_0000979 Ga0500559_0000979_10597_11058 148
468 3300053163 Ga0500639_009890 Ga0500639_009890_2781_3242 148
469 3300053725 Ga0500576_025879 Ga0500576_025879_49_510 148
470 3300001979 JGI24740J21852_10001706 JGI24740J21852_100017066 149
471 3300002737 JGI25162J39368_1000243 JGI25162J39368_100024360 149
472 3300002737 JGI25162J39368_1000372 JGI25162J39368_10003724 149
473 3300002738 JGI25154J39366_1025527 JGI25154J39366_10255271 149
474 3300002987 JGI25159J45721_1000001 JGI25159J45721_1000001298 149
475 3300002987 JGI25159J45721_1007076 JGI25159J45721_10070762 149
476 3300003187 JGI25151J46595_10014402 JGI25151J46595_100144022 149
477 3300003187 JGI25151J46595_10036328 JGI25151J46595_100363282 149
478 3300003214 JGI25165J46597_1000318 JGI25165J46597_10003188 149
479 3300003214 JGI25165J46597_1000413 JGI25165J46597_100041347 149
480 3300003320 rootH2_10088068 rootH2_100880682 149
481 3300003322 rootL2_10004432 rootL2_100044325 149
482 3300003322 rootL2_10004433 rootL2_100044331 149
483 3300003323 rootH1_10018310 rootH1_100183102 149
484 3300003323 rootH1_10066496 rootH1_100664964 149
485 3300003354 JGI25160J50197_1000002 JGI25160J50197_100000216 149
486 3300003354 JGI25160J50197_1011762 JGI25160J50197_10117622 149
487 3300003374 JGI25161J50226_1000742 JGI25161J50226_100074211 149
488 3300003374 JGI25161J50226_1004189 JGI25161J50226_10041892 149
489 3300003771 Ga0055526_1000805 Ga0055526_100080519 149
490 3300003775 Ga0055524_1046411 Ga0055524_10464112 149
491 3300003781 Ga0055536_1000427 Ga0055536_100042710 149
492 3300003791 Ga0055530_10004975 Ga0055530_100049756 149
493 3300003792 Ga0055540_1022338 Ga0055540_10223382 149
494 3300003794 Ga0055531_10019032 Ga0055531_100190322 149
495 3300004625 Ga0055543_1005842 Ga0055543_10058422 149
496 3300004625 Ga0055543_1008229 Ga0055543_10082292 149
497 3300005262 Ga0065165_1000004 Ga0065165_1000004366 149
498 3300005262 Ga0065165_1015306 Ga0065165_10153062 149
499 3300005353 Ga0070669_100054894 Ga0070669_1000548942 149
500 3300005548 Ga0070665_100134095 Ga0070665_1001340952 149
501 3300005548 Ga0070665_100184170 Ga0070665_1001841702 149
502 3300005548 Ga0070665_100402121 Ga0070665_1004021212 149
503 3300005578 Ga0068854_100055705 Ga0068854_1000557052 149
504 3300005614 Ga0068856_100046878 Ga0068856_1000468785 149
505 3300005616 Ga0068852_100216600 Ga0068852_1002166002 149
506 3300005834 Ga0068851_10103600 Ga0068851_101036002 149
507 3300005937 Ga0081455_10512935 Ga0081455_105129351 149
508 3300006038 Ga0075365_10000488 Ga0075365_1000048814 149
509 3300006042 Ga0075368_10003865 Ga0075368_100038654 149
510 3300006048 Ga0075363_100054797 Ga0075363_1000547972 149
511 3300006051 Ga0075364_10057050 Ga0075364_100570502 149
512 3300006051 Ga0075364_10295213 Ga0075364_102952132 149
513 3300006177 Ga0075362_10001934 Ga0075362_100019345 149
514 3300006178 Ga0075367_10028701 Ga0075367_100287012 149
515 3300006178 Ga0075367_10296427 Ga0075367_102964272 149
516 3300006186 Ga0075369_10015858 Ga0075369_100158582 149
517 3300006186 Ga0075369_10040475 Ga0075369_100404752 149
518 3300006186 Ga0075369_10309731 Ga0075369_103097311 149
519 3300006353 Ga0075370_10033815 Ga0075370_100338153 149
520 3300006353 Ga0075370_10249191 Ga0075370_102491912 149
521 3300006946 Ga0079104_1000010 Ga0079104_100001073 149
522 3300006948 Ga0099826_10000030 Ga0099826_10000030148 149
523 3300006948 Ga0099826_10005897 Ga0099826_100058978 149
524 3300009093 Ga0105240_10000027 Ga0105240_10000027295 149
525 3300009148 Ga0105243_10003211 Ga0105243_100032118 149
526 3300009148 Ga0105243_10325071 Ga0105243_103250712 149
527 3300009177 Ga0105248_10284786 Ga0105248_102847862 149
528 3300009545 Ga0105237_10006371 Ga0105237_100063717 149
529 3300009986 Ga0105033_107133 Ga0105033_1071332 149
530 3300010375 Ga0105239_10031150 Ga0105239_100311504 149
531 3300013100 Ga0157373_10037216 Ga0157373_100372161 149
532 3300013102 Ga0157371_10000307 Ga0157371_1000030744 149
533 3300013102 Ga0157371_10194006 Ga0157371_101940062 149
534 3300013104 Ga0157370_10000223 Ga0157370_1000022316 149
535 3300013104 Ga0157370_10000577 Ga0157370_1000057724 149
536 3300013105 Ga0157369_10306780 Ga0157369_103067802 149
537 3300013249 Ga0171463_1001 Ga0171463_1001330 149
538 3300015262 Ga0182007_10000805 Ga0182007_100008058 149
539 3300015265 Ga0182005_1001955 Ga0182005_10019555 149
540 3300015690 Ga0183363_1305 Ga0183363_13056 149
541 3300021321 Ga0214542_1000010 Ga0214542_10000107 149
542 3300021327 Ga0214543_1000003 Ga0214543_1000003373 149
543 3300021327 Ga0214543_1000004 Ga0214543_100000429 149
544 3300025206 Ga0209435_100036 Ga0209435_10003663 149
545 3300025206 Ga0209435_106982 Ga0209435_1069822 149
546 3300025207 Ga0209760_101252 Ga0209760_1012522 149
547 3300025208 Ga0209436_103777 Ga0209436_1037773 149
548 3300025208 Ga0209436_104773 Ga0209436_1047732 149
549 3300025231 Ga0207427_117028 Ga0207427_1170282 149
550 3300025233 Ga0209437_100033 Ga0209437_100033158 149
551 3300025233 Ga0209437_100036 Ga0209437_100036410 149
552 3300025246 Ga0209646_1000132 Ga0209646_100013263 149
553 3300025246 Ga0209646_1013311 Ga0209646_10133112 149
554 3300025246 Ga0209646_1045463 Ga0209646_10454631 149
555 3300025250 Ga0209026_1015454 Ga0209026_10154542 149
556 3300025253 Ga0209677_100419 Ga0209677_10041929 149
557 3300025254 Ga0209148_1038824 Ga0209148_10388241 149
558 3300025256 Ga0209759_1025591 Ga0209759_10255912 149
559 3300025261 Ga0209233_1000056 Ga0209233_1000056180 149
560 3300025261 Ga0209233_1000064 Ga0209233_1000064266 149
561 3300025261 Ga0209233_1000152 Ga0209233_100015222 149
562 3300025263 Ga0209565_1046264 Ga0209565_10462642 149
563 3300025284 Ga0209130_1000008 Ga0209130_1000008524 149
564 3300025284 Ga0209130_1006133 Ga0209130_10061333 149
565 3300025292 Ga0209676_1000885 Ga0209676_10008856 149
566 3300025294 Ga0209025_1000074 Ga0209025_1000074135 149
567 3300025294 Ga0209025_1000080 Ga0209025_1000080158 149
568 3300025294 Ga0209025_1000100 Ga0209025_1000100110 149
569 3300025294 Ga0209025_1063801 Ga0209025_10638012 149
570 3300025294 Ga0209025_1085903 Ga0209025_10859032 149
571 3300025295 Ga0209564_1000104 Ga0209564_1000104206 149
572 3300025297 Ga0209758_1053900 Ga0209758_10539002 149
573 3300025297 Ga0209758_1101417 Ga0209758_11014171 149
574 3300025298 Ga0209050_1001263 Ga0209050_100126310 149
575 3300025299 Ga0209256_1001494 Ga0209256_10014942 149
576 3300025302 Ga0207426_1000016 Ga0207426_100001638 149
577 3300025302 Ga0207426_1012037 Ga0207426_10120373 149
578 3300025303 Ga0209051_1000918 Ga0209051_100091816 149
579 3300025303 Ga0209051_1137631 Ga0209051_11376311 149
580 3300025304 Ga0209257_1005831 Ga0209257_10058315 149
581 3300025913 Ga0207695_10000024 Ga0207695_10000024335 149
582 3300025914 Ga0207671_10000986 Ga0207671_1000098612 149
583 3300025923 Ga0207681_10387676 Ga0207681_103876762 149
584 3300025925 Ga0207650_10000567 Ga0207650_100005679 149
585 3300025935 Ga0207709_10134080 Ga0207709_101340802 149
586 3300025941 Ga0207711_10192203 Ga0207711_101922032 149
587 3300025981 Ga0207640_10068813 Ga0207640_100688132 149
588 3300025986 Ga0207658_11134507 Ga0207658_111345072 149
589 3300026078 Ga0207702_10425191 Ga0207702_104251912 149
590 3300026142 Ga0207698_10159815 Ga0207698_101598152 149
591 3300027111 Ga0209281_1000053 Ga0209281_100005344 149
592 3300027111 Ga0209281_1000377 Ga0209281_100037733 149
593 3300027312 Ga0209371_1000009 Ga0209371_100000948 149
594 3300027312 Ga0209371_1007294 Ga0209371_10072945 149
595 3300027666 Ga0209282_1001844 Ga0209282_10018448 149
596 3300027866 Ga0209813_10010599 Ga0209813_100105992 149
597 3300028379 Ga0268266_10077344 Ga0268266_100773443 149
598 3300028379 Ga0268266_10151057 Ga0268266_101510572 149
599 3300028794 Ga0307515_10002710 Ga0307515_1000271026 149
600 3300030500 Ga0268256_1000010 Ga0268256_100001048 149
601 3300030500 Ga0268256_1008343 Ga0268256_10083432 149
602 3300031548 Ga0307408_100335795 Ga0307408_1003357951 149
603 3300031548 Ga0307408_100710404 Ga0307408_1007104042 149
604 3300031548 Ga0307408_100863603 Ga0307408_1008636031 149
605 3300031731 Ga0307405_10057233 Ga0307405_100572332 149
606 3300031731 Ga0307405_10153351 Ga0307405_101533511 149
607 3300031824 Ga0307413_10730087 Ga0307413_107300872 149
608 3300031901 Ga0307406_10012978 Ga0307406_100129784 149
609 3300031911 Ga0307412_10223405 Ga0307412_102234052 149
610 3300032002 Ga0307416_102248550 Ga0307416_1022485502 149
611 3300032004 Ga0307414_10218475 Ga0307414_102184752 149
612 3300032004 Ga0307414_10488251 Ga0307414_104882512 149
613 3300032004 Ga0307414_10927605 Ga0307414_109276051 149
614 3300038741 Ga0400488_43485 Ga0400488_43485_541_993 149
615 3300041404 Ga0439436_0002969 Ga0439436_0002969_975_1427 149
616 3300041404 Ga0439436_0081436 Ga0439436_0081436_147_599 149
617 3300041405 Ga0439438_029569 Ga0439438_029569_136_588 149
618 3300041405 Ga0439438_130062 Ga0439438_130062_28_480 149
619 3300041411 Ga0439466_0090180 Ga0439466_0090180_177_629 149
620 3300041411 Ga0439466_0138362 Ga0439466_0138362_39_491 149
621 3300041413 Ga0439465_0042221 Ga0439465_0042221_830_1282 149
622 3300041507 Ga0451851_0457214 Ga0451851_0457214_36_506 149
623 3300041999 Ga0439433_0086967 Ga0439433_0086967_93_545 149
624 3300042004 Ga0439445_0102546 Ga0439445_0102546_26_478 149
625 3300042007 Ga0439449_0009869 Ga0439449_0009869_1263_1715 149
626 3300042007 Ga0439449_0038896 Ga0439449_0038896_296_748 149
627 3300042015 Ga0439462_0009200 Ga0439462_0009200_158_610 149
628 3300042122 Ga0450920_006043 Ga0450920_006043_752_1204 149
629 3300042185 Ga0450909_015526 Ga0450909_015526_39_491 149
630 3300042435 Ga0439434_0167943 Ga0439434_0167943_229_681 149
631 3300046507 Ga0495606_0005820 Ga0495606_0005820_10685_11134 149
632 3300046522 Ga0495643_0057328 Ga0495643_0057328_1537_2049 149
633 3300046530 Ga0495654_0000130 Ga0495654_0000130_32016_32558 149
634 3300046558 Ga0495633_0037945 Ga0495633_0037945_1028_1540 149
635 3300046674 Ga0495588_0000397 Ga0495588_0000397_10328_10834 149
636 3300047472 Ga0495686_0000613 Ga0495686_0000613_22245_22694 149
637 3300048905 Ga0496102_0011682 Ga0496102_0011682_3929_4378 149
638 3300048906 Ga0496103_0008622 Ga0496103_0008622_2462_2911 149
639 3300048913 Ga0496110_0140994 Ga0496110_0140994_233_769 149
640 3300048914 Ga0496111_0005007 Ga0496111_0005007_5346_5882 149
641 3300048914 Ga0496111_0440266 Ga0496111_0440266_317_784 149
642 3300048916 Ga0496113_0016544 Ga0496113_0016544_1316_1828 149
643 3300048919 Ga0496116_0000036 Ga0496116_0000036_132579_133046 149
644 3300048919 Ga0496116_0028892 Ga0496116_0028892_2209_2676 149
645 3300048919 Ga0496116_0030413 Ga0496116_0030413_1501_1950 149
646 3300048919 Ga0496116_0122294 Ga0496116_0122294_376_843 149
647 3300048920 Ga0496117_0000002 Ga0496117_0000002_1608252_1608764 149
648 3300048920 Ga0496117_0006286 Ga0496117_0006286_11323_11772 149
649 3300048920 Ga0496117_0034950 Ga0496117_0034950_1166_1633 149
650 3300048921 Ga0496118_0000084 Ga0496118_0000084_48013_48525 149
651 3300048921 Ga0496118_0000396 Ga0496118_0000396_47821_48270 149
652 3300048922 Ga0496119_0027835 Ga0496119_0027835_953_1402 149
653 3300048922 Ga0496119_0073005 Ga0496119_0073005_588_1055 149
654 3300048922 Ga0496119_0131286 Ga0496119_0131286_595_1062 149
655 3300048923 Ga0496120_0000087 Ga0496120_0000087_125842_126354 149
656 3300048923 Ga0496120_0052565 Ga0496120_0052565_1700_2167 149
657 3300048923 Ga0496120_0422386 Ga0496120_0422386_78_527 149
658 3300048924 Ga0496121_0000001 Ga0496121_0000001_775447_775914 149
659 3300048924 Ga0496121_0001010 Ga0496121_0001010_47366_47815 149
660 3300048924 Ga0496121_0001141 Ga0496121_0001141_2019_2525 149
661 3300048924 Ga0496121_0025166 Ga0496121_0025166_1182_1631 149
662 3300048924 Ga0496121_0110909 Ga0496121_0110909_1559_2008 149
663 3300048925 Ga0496122_0000001 Ga0496122_0000001_979041_979553 149
664 3300048925 Ga0496122_0013058 Ga0496122_0013058_6609_7079 149
665 3300048925 Ga0496122_0015206 Ga0496122_0015206_3417_3866 149
666 3300048925 Ga0496122_0052205 Ga0496122_0052205_2357_2824 149
667 3300048925 Ga0496122_0067194 Ga0496122_0067194_482_949 149
668 3300048925 Ga0496122_0095049 Ga0496122_0095049_1143_1679 149
669 3300048925 Ga0496122_0239159 Ga0496122_0239159_337_786 149
670 3300048926 Ga0496123_0000001 Ga0496123_0000001_982772_983284 149
671 3300048926 Ga0496123_0007453 Ga0496123_0007453_7772_8221 149
672 3300048926 Ga0496123_0007860 Ga0496123_0007860_2630_3166 149
673 3300048926 Ga0496123_0057243 Ga0496123_0057243_1883_2350 149
674 3300048926 Ga0496123_0161009 Ga0496123_0161009_350_817 149
675 3300048927 Ga0496124_0017643 Ga0496124_0017643_5563_6075 149
676 3300048927 Ga0496124_0030507 Ga0496124_0030507_824_1273 149
677 3300048927 Ga0496124_0030549 Ga0496124_0030549_1869_2318 149
678 3300048927 Ga0496124_0052164 Ga0496124_0052164_653_1189 149
679 3300048927 Ga0496124_0480062 Ga0496124_0480062_283_750 149
680 3300048927 Ga0496124_0605693 Ga0496124_0605693_155_622 149
681 3300048928 Ga0496125_0000001 Ga0496125_0000001_889414_889881 149
682 3300048928 Ga0496125_0007816 Ga0496125_0007816_4878_5327 149
683 3300048928 Ga0496125_0062106 Ga0496125_0062106_1106_1618 149
684 3300048929 Ga0496126_0001111 Ga0496126_0001111_28770_29237 149
685 3300048929 Ga0496126_0076529 Ga0496126_0076529_401_850 149
686 3300048929 Ga0496126_0271404 Ga0496126_0271404_326_838 149
687 3300049569 Ga0501032_0443016 Ga0501032_0443016_293_745 149
688 3300049570 Ga0501033_0000038 Ga0501033_0000038_48896_49348 149
689 3300049671 Ga0501238_009603 Ga0501238_009603_351_875 149
690 3300049776 Ga0501280_002457 Ga0501280_002457_1952_2404 149
691 3300049776 Ga0501280_021713 Ga0501280_021713_251_703 149
692 3300049822 Ga0501035_0000326 Ga0501035_0000326_51205_51657 149
693 3300050490 nmdc:mga03n38_9588_c1 nmdc:mga03n38_9588_c1_1124_1636 149
694 3300050491 nmdc:mga00v17_244489_c1 nmdc:mga00v17_244489_c1_175_642 149
695 3300050491 nmdc:mga00v17_325606_c1 nmdc:mga00v17_325606_c1_196_708 149
696 3300050491 nmdc:mga00v17_52_c1 nmdc:mga00v17_52_c1_32738_33250 149
697 3300050492 nmdc:mga0yw44_36498_c1 nmdc:mga0yw44_36498_c1_1236_1697 149
698 3300050492 nmdc:mga0yw44_36786_c1 nmdc:mga0yw44_36786_c1_908_1420 149
699 3300050493 nmdc:mga0k408_87799_c1 nmdc:mga0k408_87799_c1_853_1365 149
700 3300050494 nmdc:mga06z11_308360_c1 nmdc:mga06z11_308360_c1_358_870 149
701 3300050496 nmdc:mga07m45_208570_c1 nmdc:mga07m45_208570_c1_313_825 149
702 3300050516 nmdc:mga0sz30_1906_c1 nmdc:mga0sz30_1906_c1_5183_5695 149
703 3300050516 nmdc:mga0sz30_70596_c1 nmdc:mga0sz30_70596_c1_919_1431 149
704 3300053107 Ga0500560_000501 Ga0500560_000501_1504_2016 149
705 3300053109 Ga0500569_013863 Ga0500569_013863_690_1142 149
706 3300053122 Ga0500608_006049 Ga0500608_006049_1545_1994 149
707 3300053125 Ga0500618_000055 Ga0500618_000055_28867_29385 149
708 3300053125 Ga0500618_000945 Ga0500618_000945_4881_5363 149
709 3300053136 Ga0500559_0007920 Ga0500559_0007920_2256_2714 149
710 3300053153 Ga0500616_0206442 Ga0500616_0206442_139_591 149
711 3300053157 Ga0500624_001959 Ga0500624_001959_628_1140 149
712 3300053157 Ga0500624_047045 Ga0500624_047045_71_523 149
713 3300053161 Ga0500634_0023083 Ga0500634_0023083_64_576 149
714 3300053177 Ga0500636_0000004 Ga0500636_0000004_122335_122805 149
715 3300053177 Ga0500636_0000820 Ga0500636_0000820_7453_7920 149
716 3300059510 Ga0587090_007679 Ga0587090_007679_254_766 149
717 3300059643 Ga0587072_014032 Ga0587072_014032_141_653 149
718 3300061719 Ga0466962_0027943 Ga0466962_0027943_792_1241 149

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03100

CcmE

CcmE

3

130

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1j6q-assembly1.cif.gz_A solution structure and characterization of the heme chaperone ccme 0.8337 33 123
2kct-assembly1.cif.gz_A solution nmr structure of the ob-fold domain of heme chaperone ccme from desulfovibrio vulgaris. northeast structural genomics target dvr115g. 0.8136 45 122
4gop-assembly2.cif.gz_Y structure and conformational change of a replication protein a heterotrimer bound to ssdna 0.8002 52 124
1sr3-assembly1.cif.gz_A solution structure of the heme chaperone ccme of escherichia coli 0.7951 33 132
8x70-assembly4.cif.gz_D the crystal structure of ifi16 from biortus. 0.777 47 124
ID Description Score Start End Superfamily
1j6qA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8337 33 123 2.40.50.140
2kctA01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8136 45 122 2.40.50.140
4gopY00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8002 52 124 2.40.50.140
1sr3A00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7951 33 132 2.40.50.140
af_P04994_10_103_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7921 50 120 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A2E1XJU7-F1-model_v4 Cytochrome c-type biogenesis protein CcmE (Cytochrome c maturation protein E) (Heme chaperone CcmE) 0.9197 3 132 GO:0005886
GO:0017004
GO:0020037
GO:0046872
AF-A0A6M4AVV0-F1-model_v4 Cytochrome c-type biogenesis protein CcmE (Cytochrome c maturation protein E) (Heme chaperone CcmE) 0.9088 1 131 GO:0005886
GO:0017004
GO:0020037
GO:0046872
AF-A0A7J9WQ97-F1-model_v4 Cytochrome c maturation protein CcmE 0.894 1 131 GO:0005886
GO:0017004
GO:0020037
GO:0046872
AF-L9XQI3-F1-model_v4 Cytochrome c-type biogenesis protein CcmE 0.8876 34 126 GO:0005886
GO:0017004
GO:0020037
AF-A0A383D8M9-F1-model_v4 Uncharacterized protein 0.8809 34 130 GO:0005886
GO:0017004
GO:0020037

Feature Viewer

pLDDT pTM Quality
87.95 0.68 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map