F477139
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 718 | 316 | 1436 | 118 |
Family's Representative Sequence
| Representative Sequence | 3300005339|Ga0070660_101269957|Ga0070660_1012699572 |
| Length | 130 |
| Sequence | VEAPALPVPERGNVSEVYDYFQQGRRHLQKGMAAQATVPLEKAKRREPNKASIRESLGIAYFRIGRYDEAAAEFRAVLELSPADDYAHYALGRCLEKQGHTAEANGHYKLAHSLRPGSETYASRVMDLES |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 8 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 36 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 42 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 44 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 45 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 46 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 48 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 49 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 50 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 51 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 52 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 53 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 54 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 56 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 61 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 62 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 63 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 64 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 65 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 66 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 67 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 68 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 90 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 95 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 96 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 97 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 98 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 147 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 150 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 151 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 152 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 153 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 154 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 155 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 156 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 157 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 158 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 159 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 160 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 161 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 162 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 163 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 164 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 165 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 166 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 167 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 168 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 169 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 170 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 171 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 172 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 173 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 174 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 175 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 176 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 177 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 178 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 179 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 180 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 181 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 182 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 183 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 184 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 185 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 186 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 187 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 188 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 189 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 190 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 191 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 192 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 193 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 194 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 195 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 196 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 197 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 198 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 199 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 200 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 201 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 202 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 203 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 204 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 205 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 206 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 207 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 208 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 209 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 210 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 211 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 212 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 213 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 214 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 215 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 216 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 217 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 218 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 219 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 220 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 221 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 222 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 264 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 265 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 266 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 267 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 268 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 269 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 270 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 271 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 272 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 273 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 274 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 275 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 276 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 277 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 278 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 279 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 316 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.58 |
| Metatranscriptomes | 0.42 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.14 |
| Nodule | 0 |
| Rhizoplane | 16.43 |
| Rhizosphere | 83.01 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 18.52 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070660_101269957 | 3300005339 | Bacteria | 625 |
| 2 | Ga0070683_100103859 | 3300005329 | Bacteria | 2678 |
| 3 | Ga0070683_100583868 | 3300005329 | Unclassified | 1069 |
| 4 | Ga0068869_100591254 | 3300005334 | Unclassified | 937 |
| 5 | Ga0070680_100046131 | 3300005336 | Bacteria | 3544 |
| 6 | Ga0070680_100091334 | 3300005336 | Bacteria | 2521 |
| 7 | Ga0070680_101028228 | 3300005336 | Bacteria | 712 |
| 8 | Ga0070680_101444312 | 3300005336 | Unclassified | 596 |
| 9 | Ga0070682_100117193 | 3300005337 | Bacteria | 1783 |
| 10 | Ga0070682_100412777 | 3300005337 | Bacteria | 1024 |
| 11 | Ga0068868_100051484 | 3300005338 | Bacteria | 3240 |
| 12 | Ga0068868_101011893 | 3300005338 | Bacteria | 761 |
| 13 | Ga0070660_100041964 | 3300005339 | Bacteria | 3489 |
| 14 | Ga0070660_100463755 | 3300005339 | Bacteria | 1052 |
| 15 | Ga0070660_100813767 | 3300005339 | Bacteria | 786 |
| 16 | Ga0070691_10558887 | 3300005341 | Bacteria | 670 |
| 17 | Ga0070687_101329949 | 3300005343 | Bacteria | 535 |
| 18 | Ga0070661_100665458 | 3300005344 | Archaea | 846 |
| 19 | Ga0070669_101885250 | 3300005353 | Unclassified | 522 |
| 20 | Ga0070675_101343567 | 3300005354 | Unclassified | 659 |
| 21 | Ga0070671_100104671 | 3300005355 | Bacteria | 2375 |
| 22 | Ga0070671_100113070 | 3300005355 | Bacteria | 2281 |
| 23 | Ga0070671_100288288 | 3300005355 | Bacteria | 1397 |
| 24 | Ga0070671_100356284 | 3300005355 | Bacteria | 1249 |
| 25 | Ga0070671_100782506 | 3300005355 | Bacteria | 830 |
| 26 | Ga0070674_100380870 | 3300005356 | Unclassified | 1148 |
| 27 | Ga0070673_101538764 | 3300005364 | Unclassified | 628 |
| 28 | Ga0070688_101166762 | 3300005365 | Unclassified | 618 |
| 29 | Ga0070659_101225628 | 3300005366 | Bacteria | 664 |
| 30 | Ga0070667_100011225 | 3300005367 | Bacteria | 7411 |
| 31 | Ga0070703_10012025 | 3300005406 | Unclassified | 2450 |
| 32 | Ga0070703_10038264 | 3300005406 | Bacteria | 1482 |
| 33 | Ga0070709_10030007 | 3300005434 | Bacteria | 3258 |
| 34 | Ga0070709_10095908 | 3300005434 | Bacteria | 1966 |
| 35 | Ga0070709_10176918 | 3300005434 | Unclassified | 1495 |
| 36 | Ga0070714_100032272 | 3300005435 | Bacteria | 4370 |
| 37 | Ga0070713_100016209 | 3300005436 | Bacteria | 5601 |
| 38 | Ga0070713_100286867 | 3300005436 | Unclassified | 1512 |
| 39 | Ga0070710_10018809 | 3300005437 | Bacteria | 3560 |
| 40 | Ga0070701_10481977 | 3300005438 | Unclassified | 802 |
| 41 | Ga0070711_100035679 | 3300005439 | Bacteria | 3327 |
| 42 | Ga0070711_100164442 | 3300005439 | Bacteria | 1685 |
| 43 | Ga0070705_100018060 | 3300005440 | Bacteria | 3691 |
| 44 | Ga0070705_100101885 | 3300005440 | Bacteria | 1815 |
| 45 | Ga0070705_100255865 | 3300005440 | Bacteria | 1232 |
| 46 | Ga0070708_100070663 | 3300005445 | Bacteria | 3141 |
| 47 | Ga0070663_101052009 | 3300005455 | Bacteria | 710 |
| 48 | Ga0070678_100053401 | 3300005456 | Bacteria | 2938 |
| 49 | Ga0070678_100630501 | 3300005456 | Bacteria | 960 |
| 50 | Ga0070681_10012878 | 3300005458 | Bacteria | 8306 |
| 51 | Ga0070681_10062891 | 3300005458 | Bacteria | 3684 |
| 52 | Ga0070681_11169175 | 3300005458 | Unclassified | 691 |
| 53 | Ga0070706_100127727 | 3300005467 | Bacteria | 2371 |
| 54 | Ga0070706_100492329 | 3300005467 | Unclassified | 1141 |
| 55 | Ga0070707_100385118 | 3300005468 | Bacteria | 1362 |
| 56 | Ga0070707_101482409 | 3300005468 | Unclassified | 645 |
| 57 | Ga0070679_100028844 | 3300005530 | Bacteria | 5474 |
| 58 | Ga0070679_100160701 | 3300005530 | Unclassified | 2221 |
| 59 | Ga0070679_100817507 | 3300005530 | Bacteria | 875 |
| 60 | Ga0070679_100939889 | 3300005530 | Bacteria | 808 |
| 61 | Ga0070679_100940509 | 3300005530 | Bacteria | 808 |
| 62 | Ga0070684_100023568 | 3300005535 | Bacteria | 5152 |
| 63 | Ga0070684_100204992 | 3300005535 | Bacteria | 1797 |
| 64 | Ga0070684_100260013 | 3300005535 | Bacteria | 1588 |
| 65 | Ga0070684_100271688 | 3300005535 | Unclassified | 1552 |
| 66 | Ga0070684_100304284 | 3300005535 | Unclassified | 1463 |
| 67 | Ga0070697_100676753 | 3300005536 | Bacteria | 910 |
| 68 | Ga0068853_100231999 | 3300005539 | Unclassified | 1689 |
| 69 | Ga0070686_100165180 | 3300005544 | Bacteria | 1561 |
| 70 | Ga0070686_100498363 | 3300005544 | Unclassified | 945 |
| 71 | Ga0070695_100090028 | 3300005545 | Bacteria | 2047 |
| 72 | Ga0070695_100553569 | 3300005545 | Unclassified | 897 |
| 73 | Ga0070696_100031409 | 3300005546 | Bacteria | 3639 |
| 74 | Ga0070696_100189970 | 3300005546 | Bacteria | 1528 |
| 75 | Ga0070696_100360709 | 3300005546 | Bacteria | 1128 |
| 76 | Ga0070693_100002841 | 3300005547 | Bacteria | 7977 |
| 77 | Ga0070693_100857173 | 3300005547 | Unclassified | 678 |
| 78 | Ga0070704_100579580 | 3300005549 | Bacteria | 984 |
| 79 | Ga0070704_100819628 | 3300005549 | Unclassified | 833 |
| 80 | Ga0070704_101134665 | 3300005549 | Bacteria | 711 |
| 81 | Ga0068855_100086582 | 3300005563 | Bacteria | 3623 |
| 82 | Ga0068855_101793681 | 3300005563 | Bacteria | 624 |
| 83 | Ga0070664_100234591 | 3300005564 | Bacteria | 1645 |
| 84 | Ga0068857_101242320 | 3300005577 | Bacteria | 722 |
| 85 | Ga0068857_102362975 | 3300005577 | Unclassified | 522 |
| 86 | Ga0068854_100831768 | 3300005578 | Bacteria | 807 |
| 87 | Ga0068856_100044239 | 3300005614 | Bacteria | 4381 |
| 88 | Ga0068856_100065336 | 3300005614 | Bacteria | 3596 |
| 89 | Ga0068856_100109761 | 3300005614 | Bacteria | 2755 |
| 90 | Ga0068856_100202068 | 3300005614 | Bacteria | 2002 |
| 91 | Ga0068856_100235152 | 3300005614 | Bacteria | 1848 |
| 92 | Ga0068856_100310444 | 3300005614 | Bacteria | 1594 |
| 93 | Ga0070702_100123721 | 3300005615 | Unclassified | 1623 |
| 94 | Ga0068866_10195727 | 3300005718 | Bacteria | 1204 |
| 95 | Ga0068861_100186791 | 3300005719 | Bacteria | 1729 |
| 96 | Ga0068858_101123002 | 3300005842 | Bacteria | 772 |
| 97 | Ga0068860_102565346 | 3300005843 | Unclassified | 529 |
| 98 | Ga0081455_10060297 | 3300005937 | Bacteria | 3200 |
| 99 | Ga0081455_10475290 | 3300005937 | Bacteria | 847 |
| 100 | Ga0081538_10219870 | 3300005981 | Bacteria | 755 |
| 101 | Ga0081539_10080281 | 3300005985 | Unclassified | 1716 |
| 102 | Ga0081539_10213773 | 3300005985 | Bacteria | 882 |
| 103 | Ga0070717_10006807 | 3300006028 | Bacteria | 8438 |
| 104 | Ga0070717_10035760 | 3300006028 | Bacteria | 4024 |
| 105 | Ga0070717_11385673 | 3300006028 | Bacteria | 639 |
| 106 | Ga0075365_10783352 | 3300006038 | Bacteria | 673 |
| 107 | Ga0070715_10020836 | 3300006163 | Bacteria | 2533 |
| 108 | Ga0070715_10099165 | 3300006163 | Unclassified | 1355 |
| 109 | Ga0070716_100008436 | 3300006173 | Bacteria | 5111 |
| 110 | Ga0070716_100204601 | 3300006173 | Bacteria | 1315 |
| 111 | Ga0070712_100263455 | 3300006175 | Unclassified | 1382 |
| 112 | Ga0097621_100114359 | 3300006237 | Bacteria | 2283 |
| 113 | Ga0097621_100674046 | 3300006237 | Bacteria | 950 |
| 114 | Ga0068871_101122442 | 3300006358 | Unclassified | 736 |
| 115 | Ga0075428_100000374 | 3300006844 | Bacteria | 44299 |
| 116 | Ga0075430_100194930 | 3300006846 | Bacteria | 1683 |
| 117 | Ga0075431_100791044 | 3300006847 | Bacteria | 922 |
| 118 | Ga0075431_101117968 | 3300006847 | Archaea | 752 |
| 119 | Ga0075433_10086435 | 3300006852 | Bacteria | 2769 |
| 120 | Ga0075433_11173375 | 3300006852 | Bacteria | 667 |
| 121 | Ga0075434_100300091 | 3300006871 | Bacteria | 1627 |
| 122 | Ga0075434_100568764 | 3300006871 | Bacteria | 1153 |
| 123 | Ga0075434_100617741 | 3300006871 | Bacteria | 1103 |
| 124 | Ga0075434_100859122 | 3300006871 | Bacteria | 923 |
| 125 | Ga0068865_101152457 | 3300006881 | Unclassified | 685 |
| 126 | Ga0075435_100345585 | 3300007076 | Bacteria | 1275 |
| 127 | Ga0075435_100583298 | 3300007076 | Bacteria | 969 |
| 128 | Ga0075435_101941800 | 3300007076 | Unclassified | 517 |
| 129 | Ga0111539_10083399 | 3300009094 | Bacteria | 3759 |
| 130 | Ga0111539_10458737 | 3300009094 | Bacteria | 1484 |
| 131 | Ga0111539_10954589 | 3300009094 | Bacteria | 997 |
| 132 | Ga0105245_10012378 | 3300009098 | Bacteria | 7424 |
| 133 | Ga0105245_10067558 | 3300009098 | Bacteria | 3238 |
| 134 | Ga0105245_10086385 | 3300009098 | Bacteria | 2877 |
| 135 | Ga0105245_10778814 | 3300009098 | Bacteria | 994 |
| 136 | Ga0105245_10864788 | 3300009098 | Unclassified | 945 |
| 137 | Ga0105245_12128249 | 3300009098 | Unclassified | 615 |
| 138 | Ga0105245_13049201 | 3300009098 | Bacteria | 519 |
| 139 | Ga0105247_10140642 | 3300009101 | Bacteria | 1581 |
| 140 | Ga0105247_11266019 | 3300009101 | Bacteria | 590 |
| 141 | Ga0114129_10042699 | 3300009147 | Bacteria | 6382 |
| 142 | Ga0105243_10112132 | 3300009148 | Bacteria | 2284 |
| 143 | Ga0105243_10275195 | 3300009148 | Bacteria | 1514 |
| 144 | Ga0105243_10914080 | 3300009148 | Bacteria | 874 |
| 145 | Ga0105243_11176474 | 3300009148 | Bacteria | 779 |
| 146 | Ga0105243_11369112 | 3300009148 | Bacteria | 727 |
| 147 | Ga0105243_12741369 | 3300009148 | Unclassified | 533 |
| 148 | Ga0105241_10805801 | 3300009174 | Unclassified | 865 |
| 149 | Ga0105242_11199273 | 3300009176 | Unclassified | 778 |
| 150 | Ga0105242_11548464 | 3300009176 | Unclassified | 695 |
| 151 | Ga0105248_10725446 | 3300009177 | Bacteria | 1121 |
| 152 | Ga0105248_11345559 | 3300009177 | Bacteria | 808 |
| 153 | Ga0105248_11924222 | 3300009177 | Bacteria | 671 |
| 154 | Ga0105238_10676658 | 3300009551 | Bacteria | 1043 |
| 155 | Ga0105249_10311958 | 3300009553 | Bacteria | 1581 |
| 156 | Ga0105239_10045576 | 3300010375 | Bacteria | 4806 |
| 157 | Ga0105239_11878249 | 3300010375 | Unclassified | 694 |
| 158 | Ga0105246_10065395 | 3300011119 | Bacteria | 2543 |
| 159 | Ga0105246_10400652 | 3300011119 | Bacteria | 1139 |
| 160 | Ga0105246_11305577 | 3300011119 | Bacteria | 673 |
| 161 | Ga0157373_11037287 | 3300013100 | Unclassified | 613 |
| 162 | Ga0157371_10422889 | 3300013102 | Unclassified | 977 |
| 163 | Ga0157371_11127424 | 3300013102 | Bacteria | 602 |
| 164 | Ga0157371_11209104 | 3300013102 | Unclassified | 583 |
| 165 | Ga0157370_11300304 | 3300013104 | Unclassified | 655 |
| 166 | Ga0157369_10370807 | 3300013105 | Bacteria | 1486 |
| 167 | Ga0157369_10522246 | 3300013105 | Bacteria | 1228 |
| 168 | Ga0157369_10536138 | 3300013105 | Bacteria | 1210 |
| 169 | Ga0157374_10004478 | 3300013296 | Bacteria | 11728 |
| 170 | Ga0157374_11457389 | 3300013296 | Unclassified | 708 |
| 171 | Ga0163162_11441386 | 3300013306 | Bacteria | 784 |
| 172 | Ga0163162_13001697 | 3300013306 | Unclassified | 542 |
| 173 | Ga0157372_10383777 | 3300013307 | Bacteria | 1637 |
| 174 | Ga0157372_10795947 | 3300013307 | Bacteria | 1099 |
| 175 | Ga0157372_10872409 | 3300013307 | Unclassified | 1044 |
| 176 | Ga0157372_10986474 | 3300013307 | Archaea | 976 |
| 177 | Ga0157375_10449449 | 3300013308 | Bacteria | 1454 |
| 178 | Ga0157375_10593696 | 3300013308 | Unclassified | 1267 |
| 179 | Ga0163163_10119734 | 3300014325 | Bacteria | 2666 |
| 180 | Ga0163163_10994856 | 3300014325 | Unclassified | 902 |
| 181 | Ga0163163_11303255 | 3300014325 | Archaea | 788 |
| 182 | Ga0182008_10153005 | 3300014497 | Bacteria | 1158 |
| 183 | Ga0157377_10081557 | 3300014745 | Bacteria | 1892 |
| 184 | Ga0157379_10656130 | 3300014968 | Bacteria | 982 |
| 185 | Ga0157379_11139308 | 3300014968 | Bacteria | 748 |
| 186 | Ga0157376_10501042 | 3300014969 | Unclassified | 1193 |
| 187 | Ga0157376_10553053 | 3300014969 | Bacteria | 1139 |
| 188 | Ga0157376_11506461 | 3300014969 | Bacteria | 706 |
| 189 | Ga0157376_12092376 | 3300014969 | Bacteria | 604 |
| 190 | Ga0163161_10747845 | 3300017792 | Unclassified | 818 |
| 191 | Ga0206350_10015215 | 3300020080 | Bacteria | 744 |
| 192 | Ga0206354_10600778 | 3300020081 | Bacteria | 2514 |
| 193 | Ga0206353_10173132 | 3300020082 | Bacteria | 2032 |
| 194 | Ga0213874_10250900 | 3300021377 | Bacteria | 652 |
| 195 | Ga0207653_10047140 | 3300025885 | Bacteria | 1426 |
| 196 | Ga0207692_10018783 | 3300025898 | Bacteria | 3110 |
| 197 | Ga0207692_10539565 | 3300025898 | Bacteria | 744 |
| 198 | Ga0207642_10884718 | 3300025899 | Bacteria | 571 |
| 199 | Ga0207688_10360577 | 3300025901 | Unclassified | 897 |
| 200 | Ga0207685_10001990 | 3300025905 | Bacteria | 4537 |
| 201 | Ga0207685_10176678 | 3300025905 | Bacteria | 987 |
| 202 | Ga0207699_10012177 | 3300025906 | Bacteria | 4369 |
| 203 | Ga0207699_10658381 | 3300025906 | Bacteria | 765 |
| 204 | Ga0207705_10392816 | 3300025909 | Bacteria | 1072 |
| 205 | Ga0207705_10519259 | 3300025909 | Bacteria | 925 |
| 206 | Ga0207684_10136177 | 3300025910 | Bacteria | 2109 |
| 207 | Ga0207684_10831104 | 3300025910 | Bacteria | 779 |
| 208 | Ga0207654_10201867 | 3300025911 | Unclassified | 1309 |
| 209 | Ga0207707_10009696 | 3300025912 | Bacteria | 8354 |
| 210 | Ga0207707_10097369 | 3300025912 | Bacteria | 2571 |
| 211 | Ga0207707_10978484 | 3300025912 | Unclassified | 695 |
| 212 | Ga0207695_11153403 | 3300025913 | Unclassified | 655 |
| 213 | Ga0207693_10000699 | 3300025915 | Bacteria | 30109 |
| 214 | Ga0207693_10001532 | 3300025915 | Bacteria | 20428 |
| 215 | Ga0207663_10004229 | 3300025916 | Bacteria | 7119 |
| 216 | Ga0207663_10787857 | 3300025916 | Bacteria | 756 |
| 217 | Ga0207660_10018008 | 3300025917 | Bacteria | 4704 |
| 218 | Ga0207660_10052957 | 3300025917 | Bacteria | 2891 |
| 219 | Ga0207660_10352322 | 3300025917 | Archaea | 1180 |
| 220 | Ga0207660_11147695 | 3300025917 | Bacteria | 633 |
| 221 | Ga0207660_11152133 | 3300025917 | Bacteria | 631 |
| 222 | Ga0207657_10041733 | 3300025919 | Bacteria | 4054 |
| 223 | Ga0207657_10284930 | 3300025919 | Unclassified | 1311 |
| 224 | Ga0207652_10011117 | 3300025921 | Bacteria | 7255 |
| 225 | Ga0207652_10197173 | 3300025921 | Unclassified | 1812 |
| 226 | Ga0207652_10393164 | 3300025921 | Bacteria | 1251 |
| 227 | Ga0207652_10423859 | 3300025921 | Bacteria | 1200 |
| 228 | Ga0207652_10685642 | 3300025921 | Bacteria | 915 |
| 229 | Ga0207652_11041841 | 3300025921 | Bacteria | 718 |
| 230 | Ga0207652_11263824 | 3300025921 | Bacteria | 641 |
| 231 | Ga0207646_10950822 | 3300025922 | Unclassified | 761 |
| 232 | Ga0207646_11751052 | 3300025922 | Bacteria | 533 |
| 233 | Ga0207681_11460124 | 3300025923 | Unclassified | 574 |
| 234 | Ga0207650_11850000 | 3300025925 | Unclassified | 510 |
| 235 | Ga0207659_11089461 | 3300025926 | Bacteria | 687 |
| 236 | Ga0207687_10032466 | 3300025927 | Bacteria | 3536 |
| 237 | Ga0207687_10191617 | 3300025927 | Bacteria | 1592 |
| 238 | Ga0207687_10202635 | 3300025927 | Unclassified | 1552 |
| 239 | Ga0207687_10728328 | 3300025927 | Bacteria | 843 |
| 240 | Ga0207700_10011439 | 3300025928 | Bacteria | 5659 |
| 241 | Ga0207700_10082845 | 3300025928 | Bacteria | 2509 |
| 242 | Ga0207700_10259033 | 3300025928 | Unclassified | 1489 |
| 243 | Ga0207664_10006925 | 3300025929 | Bacteria | 7842 |
| 244 | Ga0207664_10022035 | 3300025929 | Bacteria | 4749 |
| 245 | Ga0207664_10477087 | 3300025929 | Bacteria | 1115 |
| 246 | Ga0207664_11464007 | 3300025929 | Bacteria | 604 |
| 247 | Ga0207644_10130719 | 3300025931 | Bacteria | 1922 |
| 248 | Ga0207644_10137205 | 3300025931 | Bacteria | 1880 |
| 249 | Ga0207690_11822589 | 3300025932 | Unclassified | 508 |
| 250 | Ga0207706_10119888 | 3300025933 | Unclassified | 2313 |
| 251 | Ga0207686_10250058 | 3300025934 | Unclassified | 1295 |
| 252 | Ga0207709_10174247 | 3300025935 | Bacteria | 1513 |
| 253 | Ga0207709_10388205 | 3300025935 | Bacteria | 1064 |
| 254 | Ga0207709_10409664 | 3300025935 | Bacteria | 1038 |
| 255 | Ga0207709_10888654 | 3300025935 | Unclassified | 724 |
| 256 | Ga0207669_10300373 | 3300025937 | Bacteria | 1220 |
| 257 | Ga0207704_10159201 | 3300025938 | Bacteria | 1604 |
| 258 | Ga0207665_10000653 | 3300025939 | Bacteria | 23307 |
| 259 | Ga0207665_10022103 | 3300025939 | Bacteria | 4182 |
| 260 | Ga0207691_10792520 | 3300025940 | Bacteria | 797 |
| 261 | Ga0207711_10794155 | 3300025941 | Bacteria | 882 |
| 262 | Ga0207661_10007239 | 3300025944 | Bacteria | 7889 |
| 263 | Ga0207661_10048360 | 3300025944 | Bacteria | 3379 |
| 264 | Ga0207661_10111408 | 3300025944 | Bacteria | 2315 |
| 265 | Ga0207661_10536514 | 3300025944 | Unclassified | 1071 |
| 266 | Ga0207679_10672213 | 3300025945 | Bacteria | 938 |
| 267 | Ga0207667_10169991 | 3300025949 | Bacteria | 2240 |
| 268 | Ga0207651_11588810 | 3300025960 | Unclassified | 589 |
| 269 | Ga0207640_10359623 | 3300025981 | Unclassified | 1172 |
| 270 | Ga0207640_11057505 | 3300025981 | Bacteria | 716 |
| 271 | Ga0207658_10003886 | 3300025986 | Bacteria | 10519 |
| 272 | Ga0207677_10023274 | 3300026023 | Bacteria | 3823 |
| 273 | Ga0207703_10617176 | 3300026035 | Unclassified | 1027 |
| 274 | Ga0207703_11580098 | 3300026035 | Bacteria | 631 |
| 275 | Ga0207639_11282139 | 3300026041 | Bacteria | 688 |
| 276 | Ga0207678_11607544 | 3300026067 | Unclassified | 572 |
| 277 | Ga0207708_10703690 | 3300026075 | Bacteria | 864 |
| 278 | Ga0207702_10006756 | 3300026078 | Bacteria | 9845 |
| 279 | Ga0207702_10114640 | 3300026078 | Bacteria | 2402 |
| 280 | Ga0207702_10174053 | 3300026078 | Bacteria | 1976 |
| 281 | Ga0207702_10394665 | 3300026078 | Bacteria | 1333 |
| 282 | Ga0207702_10526424 | 3300026078 | Bacteria | 1154 |
| 283 | Ga0207702_11045958 | 3300026078 | Bacteria | 810 |
| 284 | Ga0207674_11837566 | 3300026116 | Unclassified | 573 |
| 285 | Ga0207675_100292291 | 3300026118 | Bacteria | 1585 |
| 286 | Ga0207683_10159125 | 3300026121 | Bacteria | 2041 |
| 287 | Ga0207683_10252800 | 3300026121 | Bacteria | 1609 |
| 288 | Ga0207428_10474544 | 3300027907 | Bacteria | 910 |
| 289 | Ga0268266_10985531 | 3300028379 | Bacteria | 816 |
| 290 | Ga0268264_12241432 | 3300028381 | Unclassified | 554 |
| 291 | Ga0265334_10242620 | 3300028573 | Bacteria | 621 |
| 292 | Ga0265318_10014404 | 3300028577 | Bacteria | 3320 |
| 293 | Ga0265322_10003297 | 3300028654 | Bacteria | 4894 |
| 294 | Ga0265322_10189494 | 3300028654 | Unclassified | 589 |
| 295 | Ga0265338_10065268 | 3300028800 | Bacteria | 3159 |
| 296 | Ga0265324_10022113 | 3300029957 | Unclassified | 2276 |
| 297 | Ga0265330_10078977 | 3300031235 | Unclassified | 1419 |
| 298 | Ga0265325_10056460 | 3300031241 | Bacteria | 2005 |
| 299 | Ga0265331_10037812 | 3300031250 | Bacteria | 2362 |
| 300 | Ga0265331_10092934 | 3300031250 | Unclassified | 1393 |
| 301 | Ga0265327_10015440 | 3300031251 | Bacteria | 4926 |
| 302 | Ga0265327_10061461 | 3300031251 | Bacteria | 1916 |
| 303 | Ga0265327_10166616 | 3300031251 | Unclassified | 1014 |
| 304 | Ga0265316_10020606 | 3300031344 | Bacteria | 5607 |
| 305 | Ga0265316_10520772 | 3300031344 | Bacteria | 848 |
| 306 | Ga0265313_10030323 | 3300031595 | Bacteria | 2786 |
| 307 | Ga0265314_10060773 | 3300031711 | Bacteria | 2577 |
| 308 | Ga0265314_10072278 | 3300031711 | Bacteria | 2305 |
| 309 | Ga0265342_10168893 | 3300031712 | Bacteria | 1205 |
| 310 | Ga0307407_10059593 | 3300031903 | Bacteria | 2224 |
| 311 | Ga0307409_100029860 | 3300031995 | Bacteria | 3908 |
| 312 | Ga0307416_100753969 | 3300032002 | Unclassified | 1066 |
| 313 | Ga0307415_100955011 | 3300032126 | Bacteria | 794 |
| 314 | Ga0307415_101494175 | 3300032126 | Unclassified | 646 |
| 315 | Ga0373930_0010717 | 3300034816 | Bacteria | 1644 |
| 316 | Ga0373950_0001843 | 3300034818 | Unclassified | 2839 |
| 317 | Ga0373958_0095395 | 3300034819 | Bacteria | 691 |
| 318 | Ga0373929_0010623 | 3300035085 | Bacteria | 1724 |
| 319 | Ga0373929_0138614 | 3300035085 | Bacteria | 644 |
| 320 | Ga0373934_0352671 | 3300035086 | Bacteria | 613 |
| 321 | Ga0373949_0001938 | 3300035090 | Bacteria | 5578 |
| 322 | Ga0373952_0276840 | 3300035092 | Unclassified | 516 |
| 323 | Ga0373932_0053886 | 3300035112 | Bacteria | 1202 |
| 324 | Ga0373939_0046938 | 3300035114 | Bacteria | 1324 |
| 325 | Ga0373954_0264599 | 3300035118 | Bacteria | 847 |
| 326 | Ga0373957_0121052 | 3300035120 | Bacteria | 1059 |
| 327 | Ga0373946_0165408 | 3300035171 | Bacteria | 1041 |
| 328 | Ga0373955_0053225 | 3300035172 | Bacteria | 2210 |
| 329 | Ga0373955_0723849 | 3300035172 | Bacteria | 611 |
| 330 | Ga0373942_0109959 | 3300035207 | Bacteria | 851 |
| 331 | Ga0373961_0009927 | 3300035241 | Bacteria | 2337 |
| 332 | Ga0373962_0056740 | 3300035242 | Bacteria | 1141 |
| 333 | Ga0373931_0045649 | 3300035691 | Unclassified | 2314 |
| 334 | Ga0373931_0145781 | 3300035691 | Unclassified | 1376 |
| 335 | Ga0373931_0173730 | 3300035691 | Bacteria | 1271 |
| 336 | Ga0373947_0477859 | 3300035725 | Bacteria | 845 |
| 337 | Ga0373947_0758614 | 3300035725 | Bacteria | 662 |
| 338 | Ga0373937_0045303 | 3300036401 | Bacteria | 4020 |
| 339 | Ga0395899_0009642 | 3300037312 | Bacteria | 7410 |
| 340 | Ga0395899_0373359 | 3300037312 | Bacteria | 949 |
| 341 | Ga0395900_0003795 | 3300037418 | Bacteria | 16180 |
| 342 | Ga0395900_0022123 | 3300037418 | Bacteria | 6504 |
| 343 | Ga0395900_1563037 | 3300037418 | Bacteria | 571 |
| 344 | Ga0395898_0024171 | 3300037466 | Bacteria | 6130 |
| 345 | Ga0395898_0071989 | 3300037466 | Bacteria | 3340 |
| 346 | Ga0395898_0358127 | 3300037466 | Bacteria | 1391 |
| 347 | Ga0395898_0399653 | 3300037466 | Bacteria | 1310 |
| 348 | Ga0395898_1361845 | 3300037466 | Unclassified | 638 |
| 349 | Ga0395905_0061092 | 3300037471 | Bacteria | 3524 |
| 350 | Ga0395905_0291490 | 3300037471 | Unclassified | 1518 |
| 351 | Ga0395905_1179669 | 3300037471 | Unclassified | 669 |
| 352 | Ga0395901_0109846 | 3300038443 | Bacteria | 2895 |
| 353 | Ga0395901_0335410 | 3300038443 | Bacteria | 1563 |
| 354 | Ga0395901_0392571 | 3300038443 | Unclassified | 1427 |
| 355 | Ga0395901_0399698 | 3300038443 | Bacteria | 1412 |
| 356 | Ga0395901_0516859 | 3300038443 | Unclassified | 1213 |
| 357 | Ga0395901_1142926 | 3300038443 | Bacteria | 747 |
| 358 | Ga0395901_1180103 | 3300038443 | Bacteria | 732 |
| 359 | Ga0395901_1799644 | 3300038443 | Bacteria | 562 |
| 360 | Ga0436360_1255117 | 3300039438 | Bacteria | 1758 |
| 361 | Ga0436363_0432503 | 3300039450 | Bacteria | 1796 |
| 362 | Ga0439439_0263274 | 3300041406 | Unclassified | 513 |
| 363 | Ga0439461_0109614 | 3300041410 | Bacteria | 680 |
| 364 | Ga0439466_0107647 | 3300041411 | Bacteria | 866 |
| 365 | Ga0439465_0265760 | 3300041413 | Bacteria | 637 |
| 366 | Ga0439465_0381203 | 3300041413 | Unclassified | 535 |
| 367 | Ga0451800_0008995 | 3300041459 | Unclassified | 891 |
| 368 | Ga0451849_0198147 | 3300041505 | Bacteria | 700 |
| 369 | Ga0439432_119786 | 3300042006 | Bacteria | 780 |
| 370 | Ga0450898_104855 | 3300042134 | Bacteria | 594 |
| 371 | Ga0450906_045142 | 3300042145 | Bacteria | 778 |
| 372 | Ga0450907_007656 | 3300042146 | Bacteria | 1800 |
| 373 | Ga0439446_0065937 | 3300042156 | Unclassified | 1101 |
| 374 | Ga0439434_0071559 | 3300042435 | Bacteria | 1092 |
| 375 | Ga0450918_049432 | 3300042531 | Unclassified | 764 |
| 376 | Ga0451577_1160832 | 3300042876 | Unclassified | 690 |
| 377 | Ga0466969_0027110 | 3300044656 | Bacteria | 2934 |
| 378 | Ga0466972_0015132 | 3300044658 | Bacteria | 3857 |
| 379 | Ga0466965_0256154 | 3300044683 | Archaea | 940 |
| 380 | Ga0466966_0002641 | 3300044684 | Bacteria | 11739 |
| 381 | Ga0466966_0031012 | 3300044684 | Bacteria | 3467 |
| 382 | Ga0466961_0014040 | 3300044693 | Bacteria | 5135 |
| 383 | Ga0466963_0235346 | 3300044694 | Bacteria | 1284 |
| 384 | Ga0466963_0590600 | 3300044694 | Bacteria | 784 |
| 385 | Ga0453684_2463523 | 3300044712 | Unclassified | 514 |
| 386 | Ga0466971_0010069 | 3300044719 | Bacteria | 4130 |
| 387 | Ga0466971_0011610 | 3300044719 | Bacteria | 3857 |
| 388 | Ga0466968_0013298 | 3300044735 | Bacteria | 3235 |
| 389 | Ga0466968_0336941 | 3300044735 | Archaea | 731 |
| 390 | Ga0466970_0115763 | 3300044765 | Unclassified | 1466 |
| 391 | Ga0466957_0021849 | 3300044842 | Bacteria | 3772 |
| 392 | Ga0466957_0635475 | 3300044842 | Bacteria | 749 |
| 393 | Ga0466960_0302119 | 3300044901 | Bacteria | 902 |
| 394 | Ga0466959_0013756 | 3300045049 | Bacteria | 5874 |
| 395 | Ga0466959_0207449 | 3300045049 | Bacteria | 1362 |
| 396 | Ga0466959_0296555 | 3300045049 | Archaea | 1108 |
| 397 | Ga0451576_2193175 | 3300045051 | Bacteria | 567 |
| 398 | Ga0466958_0016821 | 3300045836 | Bacteria | 4218 |
| 399 | Ga0466958_0037636 | 3300045836 | Bacteria | 2899 |
| 400 | Ga0466967_0019791 | 3300045976 | Bacteria | 5422 |
| 401 | Ga0466967_0064368 | 3300045976 | Bacteria | 3261 |
| 402 | Ga0466967_0609872 | 3300045976 | Bacteria | 1078 |
| 403 | Ga0495592_0023977 | 3300046454 | Bacteria | 4640 |
| 404 | Ga0495603_0058687 | 3300046455 | Bacteria | 2275 |
| 405 | Ga0495629_0031365 | 3300046459 | Bacteria | 3764 |
| 406 | Ga0495629_0127896 | 3300046459 | Bacteria | 1770 |
| 407 | Ga0495629_0141549 | 3300046459 | Bacteria | 1673 |
| 408 | Ga0495629_0154153 | 3300046459 | Bacteria | 1597 |
| 409 | Ga0495641_0230305 | 3300046461 | Bacteria | 832 |
| 410 | Ga0495651_0086316 | 3300046462 | Bacteria | 2361 |
| 411 | Ga0495651_0092472 | 3300046462 | Bacteria | 2266 |
| 412 | Ga0495651_0198185 | 3300046462 | Bacteria | 1407 |
| 413 | Ga0495651_0327769 | 3300046462 | Bacteria | 1019 |
| 414 | Ga0495653_0024865 | 3300046463 | Bacteria | 4820 |
| 415 | Ga0495653_0097761 | 3300046463 | Bacteria | 2132 |
| 416 | Ga0495653_0235781 | 3300046463 | Bacteria | 1222 |
| 417 | Ga0495653_0276243 | 3300046463 | Bacteria | 1104 |
| 418 | Ga0495653_0316994 | 3300046463 | Bacteria | 1012 |
| 419 | Ga0495580_1045635 | 3300046472 | Unclassified | 519 |
| 420 | Ga0495582_0080905 | 3300046473 | Bacteria | 1804 |
| 421 | Ga0495582_0110369 | 3300046473 | Bacteria | 1545 |
| 422 | Ga0495582_0111138 | 3300046473 | Bacteria | 1539 |
| 423 | Ga0495664_0087656 | 3300046477 | Bacteria | 1870 |
| 424 | Ga0495664_0162054 | 3300046477 | Bacteria | 1357 |
| 425 | Ga0495584_0643131 | 3300046491 | Bacteria | 541 |
| 426 | Ga0495594_0514276 | 3300046499 | Bacteria | 680 |
| 427 | Ga0495596_0048089 | 3300046500 | Bacteria | 1673 |
| 428 | Ga0495608_0006906 | 3300046511 | Bacteria | 8040 |
| 429 | Ga0495608_0150776 | 3300046511 | Bacteria | 1482 |
| 430 | Ga0495608_0333923 | 3300046511 | Bacteria | 935 |
| 431 | Ga0495618_0321168 | 3300046514 | Bacteria | 959 |
| 432 | Ga0495618_0352245 | 3300046514 | Bacteria | 907 |
| 433 | Ga0495628_0024207 | 3300046516 | Bacteria | 4971 |
| 434 | Ga0495628_0375630 | 3300046516 | Bacteria | 1042 |
| 435 | Ga0495630_0335399 | 3300046517 | Bacteria | 1157 |
| 436 | Ga0495630_0518064 | 3300046517 | Bacteria | 914 |
| 437 | Ga0495630_0862169 | 3300046517 | Bacteria | 690 |
| 438 | Ga0495644_0310485 | 3300046523 | Bacteria | 618 |
| 439 | Ga0495652_0069968 | 3300046529 | Bacteria | 2935 |
| 440 | Ga0495652_0104401 | 3300046529 | Bacteria | 2292 |
| 441 | Ga0495640_0179276 | 3300046533 | Bacteria | 1351 |
| 442 | Ga0495586_0215966 | 3300046535 | Unclassified | 1089 |
| 443 | Ga0495586_0632778 | 3300046535 | Unclassified | 618 |
| 444 | Ga0495587_0092975 | 3300046536 | Bacteria | 1741 |
| 445 | Ga0495587_0356377 | 3300046536 | Bacteria | 815 |
| 446 | Ga0495645_0229408 | 3300046543 | Bacteria | 1244 |
| 447 | Ga0495645_0940302 | 3300046543 | Bacteria | 511 |
| 448 | Ga0495667_0016328 | 3300046559 | Bacteria | 5017 |
| 449 | Ga0495667_0025734 | 3300046559 | Bacteria | 3964 |
| 450 | Ga0495667_0806650 | 3300046559 | Bacteria | 578 |
| 451 | Ga0495656_0076108 | 3300046615 | Bacteria | 1503 |
| 452 | Ga0495634_0012968 | 3300046642 | Bacteria | 6031 |
| 453 | Ga0495634_0342553 | 3300046642 | Bacteria | 896 |
| 454 | Ga0495634_0630783 | 3300046642 | Unclassified | 620 |
| 455 | Ga0495635_0026017 | 3300046663 | Bacteria | 4075 |
| 456 | Ga0495635_0159259 | 3300046663 | Unclassified | 1536 |
| 457 | Ga0495635_0232487 | 3300046663 | Bacteria | 1245 |
| 458 | Ga0495635_0371177 | 3300046663 | Unclassified | 953 |
| 459 | Ga0495657_0006007 | 3300046675 | Bacteria | 9535 |
| 460 | Ga0495599_0030958 | 3300046678 | Bacteria | 3358 |
| 461 | Ga0495599_0496186 | 3300046678 | Bacteria | 719 |
| 462 | Ga0495599_0561578 | 3300046678 | Bacteria | 667 |
| 463 | Ga0495623_0028311 | 3300046679 | Bacteria | 3604 |
| 464 | Ga0495623_0173097 | 3300046679 | Bacteria | 1260 |
| 465 | Ga0495646_0030128 | 3300046680 | Bacteria | 3389 |
| 466 | Ga0495646_0333494 | 3300046680 | Bacteria | 797 |
| 467 | Ga0495647_0042765 | 3300046681 | Bacteria | 1731 |
| 468 | Ga0495658_0008377 | 3300046683 | Bacteria | 5122 |
| 469 | Ga0495658_0558843 | 3300046683 | Unclassified | 733 |
| 470 | Ga0495613_0074572 | 3300046689 | Bacteria | 2471 |
| 471 | Ga0495613_0232091 | 3300046689 | Bacteria | 1292 |
| 472 | Ga0495613_0333394 | 3300046689 | Unclassified | 1045 |
| 473 | Ga0495613_0501303 | 3300046689 | Bacteria | 817 |
| 474 | Ga0495600_0121277 | 3300046809 | Bacteria | 1700 |
| 475 | Ga0495600_0145008 | 3300046809 | Bacteria | 1539 |
| 476 | Ga0495600_0182539 | 3300046809 | Bacteria | 1352 |
| 477 | Ga0495600_0305072 | 3300046809 | Unclassified | 1004 |
| 478 | Ga0495581_0342347 | 3300047315 | Unclassified | 873 |
| 479 | Ga0495581_0394702 | 3300047315 | Bacteria | 807 |
| 480 | Ga0495604_0142879 | 3300047317 | Bacteria | 1708 |
| 481 | Ga0495604_0232317 | 3300047317 | Bacteria | 1264 |
| 482 | Ga0495674_0182699 | 3300047319 | Bacteria | 1746 |
| 483 | Ga0495674_0245725 | 3300047319 | Bacteria | 1473 |
| 484 | Ga0495676_0046869 | 3300047321 | Bacteria | 3503 |
| 485 | Ga0495676_0147318 | 3300047321 | Unclassified | 1680 |
| 486 | Ga0495680_0026950 | 3300047322 | Bacteria | 4730 |
| 487 | Ga0495680_0091709 | 3300047322 | Bacteria | 2277 |
| 488 | Ga0495680_0100218 | 3300047322 | Bacteria | 2158 |
| 489 | Ga0495680_0140378 | 3300047322 | Bacteria | 1768 |
| 490 | Ga0495680_0966173 | 3300047322 | Bacteria | 546 |
| 491 | Ga0495684_0005859 | 3300047471 | Bacteria | 9549 |
| 492 | Ga0495684_0081353 | 3300047471 | Bacteria | 2458 |
| 493 | Ga0495684_0360168 | 3300047471 | Bacteria | 1030 |
| 494 | Ga0495602_0008825 | 3300048088 | Bacteria | 10513 |
| 495 | Ga0496100_0008322 | 3300048903 | Bacteria | 5783 |
| 496 | Ga0496100_0050405 | 3300048903 | Bacteria | 2697 |
| 497 | Ga0496100_0068539 | 3300048903 | Bacteria | 2360 |
| 498 | Ga0496100_0490645 | 3300048903 | Bacteria | 945 |
| 499 | Ga0496100_1015673 | 3300048903 | Bacteria | 653 |
| 500 | Ga0496101_0003443 | 3300048904 | Bacteria | 9876 |
| 501 | Ga0496101_0021289 | 3300048904 | Bacteria | 4454 |
| 502 | Ga0496101_0086395 | 3300048904 | Bacteria | 2326 |
| 503 | Ga0496101_0123323 | 3300048904 | Bacteria | 1961 |
| 504 | Ga0496101_0163236 | 3300048904 | Unclassified | 1710 |
| 505 | Ga0496101_0195002 | 3300048904 | Bacteria | 1564 |
| 506 | Ga0496101_0195082 | 3300048904 | Bacteria | 1564 |
| 507 | Ga0496101_0293000 | 3300048904 | Unclassified | 1274 |
| 508 | Ga0496101_0684536 | 3300048904 | Bacteria | 810 |
| 509 | Ga0496102_0021038 | 3300048905 | Bacteria | 5769 |
| 510 | Ga0496102_0073701 | 3300048905 | Bacteria | 3137 |
| 511 | Ga0496102_0123627 | 3300048905 | Bacteria | 2418 |
| 512 | Ga0496102_0276430 | 3300048905 | Bacteria | 1583 |
| 513 | Ga0496102_0428324 | 3300048905 | Bacteria | 1242 |
| 514 | Ga0496102_0683151 | 3300048905 | Bacteria | 950 |
| 515 | Ga0496102_0759285 | 3300048905 | Bacteria | 892 |
| 516 | Ga0496102_0775469 | 3300048905 | Bacteria | 881 |
| 517 | Ga0496102_1278363 | 3300048905 | Bacteria | 653 |
| 518 | Ga0496103_0008697 | 3300048906 | Bacteria | 6026 |
| 519 | Ga0496103_0012452 | 3300048906 | Bacteria | 5045 |
| 520 | Ga0496103_0042072 | 3300048906 | Bacteria | 2810 |
| 521 | Ga0496103_0355274 | 3300048906 | Unclassified | 942 |
| 522 | Ga0496103_0635320 | 3300048906 | Bacteria | 679 |
| 523 | Ga0496104_0002034 | 3300048907 | Bacteria | 17569 |
| 524 | Ga0496104_0042982 | 3300048907 | Bacteria | 4243 |
| 525 | Ga0496104_0066774 | 3300048907 | Bacteria | 3415 |
| 526 | Ga0496104_0120343 | 3300048907 | Bacteria | 2520 |
| 527 | Ga0496104_0194310 | 3300048907 | Bacteria | 1941 |
| 528 | Ga0496104_0277597 | 3300048907 | Bacteria | 1588 |
| 529 | Ga0496104_0339960 | 3300048907 | Bacteria | 1414 |
| 530 | Ga0496104_0925365 | 3300048907 | Bacteria | 777 |
| 531 | Ga0496104_1555478 | 3300048907 | Bacteria | 564 |
| 532 | Ga0496105_0000050 | 3300048908 | Bacteria | 93402 |
| 533 | Ga0496105_0005896 | 3300048908 | Bacteria | 9343 |
| 534 | Ga0496105_0022619 | 3300048908 | Bacteria | 5092 |
| 535 | Ga0496105_0121180 | 3300048908 | Bacteria | 2156 |
| 536 | Ga0496105_0331293 | 3300048908 | Bacteria | 1218 |
| 537 | Ga0496105_0609726 | 3300048908 | Bacteria | 846 |
| 538 | Ga0496105_1396852 | 3300048908 | Bacteria | 507 |
| 539 | Ga0496106_0010212 | 3300048909 | Bacteria | 6938 |
| 540 | Ga0496106_0047440 | 3300048909 | Bacteria | 3233 |
| 541 | Ga0496106_0050758 | 3300048909 | Bacteria | 3126 |
| 542 | Ga0496106_0199165 | 3300048909 | Bacteria | 1593 |
| 543 | Ga0496106_0461778 | 3300048909 | Bacteria | 1020 |
| 544 | Ga0496106_1023289 | 3300048909 | Bacteria | 649 |
| 545 | Ga0496106_1150374 | 3300048909 | Bacteria | 607 |
| 546 | Ga0496107_0002732 | 3300048910 | Bacteria | 11587 |
| 547 | Ga0496107_0016043 | 3300048910 | Bacteria | 5256 |
| 548 | Ga0496107_0041450 | 3300048910 | Bacteria | 3305 |
| 549 | Ga0496107_0080575 | 3300048910 | Bacteria | 2374 |
| 550 | Ga0496107_0127694 | 3300048910 | Bacteria | 1876 |
| 551 | Ga0496107_0232135 | 3300048910 | Bacteria | 1373 |
| 552 | Ga0496107_0319079 | 3300048910 | Bacteria | 1156 |
| 553 | Ga0496107_0563207 | 3300048910 | Bacteria | 843 |
| 554 | Ga0496108_0002704 | 3300048911 | Bacteria | 14173 |
| 555 | Ga0496108_0053502 | 3300048911 | Unclassified | 3386 |
| 556 | Ga0496108_0099780 | 3300048911 | Bacteria | 2475 |
| 557 | Ga0496108_0374764 | 3300048911 | Bacteria | 1243 |
| 558 | Ga0496108_0510765 | 3300048911 | Bacteria | 1049 |
| 559 | Ga0496108_1474451 | 3300048911 | Bacteria | 567 |
| 560 | Ga0496109_0001247 | 3300048912 | Bacteria | 21102 |
| 561 | Ga0496109_0002493 | 3300048912 | Bacteria | 15427 |
| 562 | Ga0496109_0105146 | 3300048912 | Unclassified | 2621 |
| 563 | Ga0496109_0162660 | 3300048912 | Unclassified | 2091 |
| 564 | Ga0496109_0289337 | 3300048912 | Bacteria | 1544 |
| 565 | Ga0496109_0325860 | 3300048912 | Bacteria | 1450 |
| 566 | Ga0496109_0439677 | 3300048912 | Bacteria | 1232 |
| 567 | Ga0496109_1458529 | 3300048912 | Unclassified | 619 |
| 568 | Ga0496110_0002214 | 3300048913 | Bacteria | 14529 |
| 569 | Ga0496110_0004510 | 3300048913 | Bacteria | 10804 |
| 570 | Ga0496110_0021471 | 3300048913 | Bacteria | 5467 |
| 571 | Ga0496110_0276563 | 3300048913 | Bacteria | 1529 |
| 572 | Ga0496110_0796234 | 3300048913 | Bacteria | 849 |
| 573 | Ga0496110_1122684 | 3300048913 | Bacteria | 694 |
| 574 | Ga0496110_1257533 | 3300048913 | Bacteria | 649 |
| 575 | Ga0496110_1708431 | 3300048913 | Unclassified | 540 |
| 576 | Ga0496111_0000325 | 3300048914 | Bacteria | 23677 |
| 577 | Ga0496111_0003419 | 3300048914 | Bacteria | 9822 |
| 578 | Ga0496111_0021716 | 3300048914 | Bacteria | 4484 |
| 579 | Ga0496111_0030321 | 3300048914 | Bacteria | 3846 |
| 580 | Ga0496111_0277859 | 3300048914 | Bacteria | 1242 |
| 581 | Ga0496111_0333377 | 3300048914 | Bacteria | 1123 |
| 582 | Ga0496111_0510511 | 3300048914 | Bacteria | 884 |
| 583 | Ga0496111_0882896 | 3300048914 | Bacteria | 644 |
| 584 | Ga0496111_1055480 | 3300048914 | Unclassified | 580 |
| 585 | Ga0496112_0013131 | 3300048915 | Bacteria | 7644 |
| 586 | Ga0496112_0328436 | 3300048915 | Bacteria | 1473 |
| 587 | Ga0496112_0424069 | 3300048915 | Bacteria | 1269 |
| 588 | Ga0496112_0669577 | 3300048915 | Bacteria | 967 |
| 589 | Ga0496112_1229657 | 3300048915 | Unclassified | 665 |
| 590 | Ga0496113_0021017 | 3300048916 | Bacteria | 4599 |
| 591 | Ga0496113_0036347 | 3300048916 | Bacteria | 3608 |
| 592 | Ga0496113_0053473 | 3300048916 | Bacteria | 3020 |
| 593 | Ga0496113_0266177 | 3300048916 | Bacteria | 1370 |
| 594 | Ga0496113_0556608 | 3300048916 | Bacteria | 920 |
| 595 | Ga0496113_0669363 | 3300048916 | Bacteria | 829 |
| 596 | Ga0496113_0781778 | 3300048916 | Bacteria | 759 |
| 597 | Ga0496114_0000304 | 3300048917 | Bacteria | 36209 |
| 598 | Ga0496114_0005710 | 3300048917 | Bacteria | 9757 |
| 599 | Ga0496114_0038317 | 3300048917 | Bacteria | 3966 |
| 600 | Ga0496114_0038679 | 3300048917 | Bacteria | 3947 |
| 601 | Ga0496114_0057760 | 3300048917 | Bacteria | 3239 |
| 602 | Ga0496114_0061999 | 3300048917 | Bacteria | 3129 |
| 603 | Ga0496114_0092121 | 3300048917 | Unclassified | 2575 |
| 604 | Ga0496114_0094133 | 3300048917 | Bacteria | 2548 |
| 605 | Ga0496114_1014102 | 3300048917 | Bacteria | 713 |
| 606 | Ga0496115_0005373 | 3300048918 | Bacteria | 9322 |
| 607 | Ga0496115_0061096 | 3300048918 | Bacteria | 3037 |
| 608 | Ga0496115_0082242 | 3300048918 | Bacteria | 2623 |
| 609 | Ga0496115_0263207 | 3300048918 | Bacteria | 1418 |
| 610 | Ga0496115_1014618 | 3300048918 | Bacteria | 633 |
| 611 | Ga0496115_1156379 | 3300048918 | Bacteria | 584 |
| 612 | Ga0501031_0253407 | 3300049568 | Bacteria | 1144 |
| 613 | Ga0501031_0309224 | 3300049568 | Unclassified | 1024 |
| 614 | Ga0501036_0902828 | 3300049572 | Unclassified | 725 |
| 615 | Ga0501036_1440220 | 3300049572 | Bacteria | 558 |
| 616 | Ga0501039_0413211 | 3300049575 | Unclassified | 1060 |
| 617 | Ga0501040_0045087 | 3300049576 | Bacteria | 3007 |
| 618 | Ga0501040_0148261 | 3300049576 | Bacteria | 1654 |
| 619 | Ga0501040_0486626 | 3300049576 | Unclassified | 889 |
| 620 | Ga0501041_0035486 | 3300049577 | Bacteria | 3021 |
| 621 | Ga0501041_0212732 | 3300049577 | Bacteria | 1213 |
| 622 | Ga0501042_0316756 | 3300049578 | Bacteria | 1127 |
| 623 | Ga0501042_0471862 | 3300049578 | Unclassified | 910 |
| 624 | Ga0501042_0551103 | 3300049578 | Bacteria | 838 |
| 625 | Ga0501042_0587788 | 3300049578 | Bacteria | 809 |
| 626 | Ga0501046_0180414 | 3300049580 | Unclassified | 1579 |
| 627 | Ga0501067_0019822 | 3300049583 | Bacteria | 3723 |
| 628 | Ga0501067_0121183 | 3300049583 | Bacteria | 1455 |
| 629 | Ga0501067_0208114 | 3300049583 | Bacteria | 1089 |
| 630 | Ga0501068_0630891 | 3300049584 | Unclassified | 699 |
| 631 | Ga0501069_0007322 | 3300049585 | Bacteria | 5791 |
| 632 | Ga0501069_0127297 | 3300049585 | Unclassified | 1457 |
| 633 | Ga0501069_0228143 | 3300049585 | Bacteria | 1084 |
| 634 | Ga0501069_0235958 | 3300049585 | Bacteria | 1065 |
| 635 | Ga0501069_0291302 | 3300049585 | Bacteria | 956 |
| 636 | Ga0501070_0136223 | 3300049586 | Bacteria | 2027 |
| 637 | Ga0501070_0789067 | 3300049586 | Unclassified | 746 |
| 638 | Ga0501071_0330774 | 3300049587 | Bacteria | 1158 |
| 639 | Ga0501072_0183812 | 3300049588 | Bacteria | 1668 |
| 640 | Ga0501072_0463248 | 3300049588 | Unclassified | 1003 |
| 641 | Ga0501074_0251574 | 3300049590 | Bacteria | 1257 |
| 642 | Ga0501074_0623280 | 3300049590 | Bacteria | 762 |
| 643 | Ga0501075_0165869 | 3300049591 | Bacteria | 1685 |
| 644 | Ga0501075_0177814 | 3300049591 | Bacteria | 1624 |
| 645 | Ga0501076_0010820 | 3300049592 | Bacteria | 6783 |
| 646 | Ga0501076_1000310 | 3300049592 | Unclassified | 689 |
| 647 | Ga0501076_1221809 | 3300049592 | Bacteria | 618 |
| 648 | Ga0501076_1222505 | 3300049592 | Bacteria | 618 |
| 649 | Ga0501077_0080152 | 3300049593 | Bacteria | 2069 |
| 650 | Ga0501077_0326108 | 3300049593 | Unclassified | 979 |
| 651 | Ga0501077_0698189 | 3300049593 | Unclassified | 652 |
| 652 | Ga0501077_1049263 | 3300049593 | Bacteria | 524 |
| 653 | Ga0501079_0069629 | 3300049741 | Archaea | 2716 |
| 654 | Ga0501079_0125948 | 3300049741 | Bacteria | 1993 |
| 655 | Ga0501080_0208797 | 3300049742 | Bacteria | 1790 |
| 656 | Ga0501080_1178936 | 3300049742 | Bacteria | 659 |
| 657 | Ga0501080_1332551 | 3300049742 | Bacteria | 614 |
| 658 | Ga0501081_0221185 | 3300049743 | Bacteria | 1377 |
| 659 | Ga0501081_0302036 | 3300049743 | Bacteria | 1174 |
| 660 | Ga0501083_0460841 | 3300049744 | Bacteria | 827 |
| 661 | Ga0501045_0046796 | 3300049824 | Bacteria | 3150 |
| 662 | Ga0501045_0171441 | 3300049824 | Bacteria | 1616 |
| 663 | Ga0501045_0220805 | 3300049824 | Bacteria | 1411 |
| 664 | Ga0501045_0383759 | 3300049824 | Bacteria | 1046 |
| 665 | Ga0501045_0609778 | 3300049824 | Bacteria | 808 |
| 666 | Ga0501045_0666779 | 3300049824 | Bacteria | 768 |
| 667 | nmdc:mga05p37_225851_c1 | 3300050507 | Bacteria | 2258 |
| 668 | nmdc:mga05p37_6822_c1 | 3300050507 | Bacteria | 13456 |
| 669 | nmdc:mga05p37_874125_c1 | 3300050507 | Bacteria | 973 |
| 670 | nmdc:mga09592_726211_c1 | 3300050508 | Archaea | 844 |
| 671 | nmdc:mga0qj67_102122_c1 | 3300050509 | Bacteria | 2312 |
| 672 | nmdc:mga06r32_65503_c1 | 3300050510 | Archaea | 3504 |
| 673 | nmdc:mga08y16_1786338_c1 | 3300050511 | Bacteria | 568 |
| 674 | nmdc:mga0n895_352319_c1 | 3300050512 | Bacteria | 1491 |
| 675 | nmdc:mga0n895_587487_c1 | 3300050512 | Bacteria | 1117 |
| 676 | nmdc:mga0n895_610783_c1 | 3300050512 | Bacteria | 1092 |
| 677 | nmdc:mga0n895_654599_c1 | 3300050512 | Bacteria | 1049 |
| 678 | nmdc:mga0n895_863643_c1 | 3300050512 | Bacteria | 892 |
| 679 | nmdc:mga0rr50_1507103_c1 | 3300050513 | Bacteria | 568 |
| 680 | nmdc:mga0rr50_1729039_c1 | 3300050513 | Unclassified | 527 |
| 681 | nmdc:mga0rr50_653234_c1 | 3300050513 | Bacteria | 897 |
| 682 | nmdc:mga0a205_349417_c1 | 3300050515 | Bacteria | 1346 |
| 683 | nmdc:mga0a205_99110_c1 | 3300050515 | Bacteria | 2812 |
| 684 | nmdc:mga0a205_996486_c1 | 3300050515 | Bacteria | 685 |
| 685 | Ga0495601_0055485 | 3300053077 | Bacteria | 2508 |
| 686 | Ga0495601_0285623 | 3300053077 | Bacteria | 1076 |
| 687 | Ga0495612_0170435 | 3300053078 | Unclassified | 953 |
| 688 | Ga0495595_0292457 | 3300053084 | Bacteria | 819 |
| 689 | Ga0495595_0377070 | 3300053084 | Bacteria | 717 |
| 690 | Ga0495595_0412199 | 3300053084 | Bacteria | 685 |
| 691 | Ga0495619_0008941 | 3300053085 | Bacteria | 6322 |
| 692 | Ga0495619_0017786 | 3300053085 | Bacteria | 4504 |
| 693 | Ga0495619_0322626 | 3300053085 | Bacteria | 1069 |
| 694 | Ga0495619_0434363 | 3300053085 | Bacteria | 905 |
| 695 | Ga0495619_0503920 | 3300053085 | Bacteria | 832 |
| 696 | Ga0501084_0096322 | 3300054114 | Bacteria | 2485 |
| 697 | Ga0501084_0181322 | 3300054114 | Bacteria | 1778 |
| 698 | Ga0501084_0432007 | 3300054114 | Bacteria | 1113 |
| 699 | Ga0501084_0615519 | 3300054114 | Bacteria | 917 |
| 700 | Ga0501084_0956633 | 3300054114 | Bacteria | 720 |
| 701 | Ga0501084_1326619 | 3300054114 | Bacteria | 603 |
| 702 | Ga0501082_0028754 | 3300060353 | Bacteria | 4788 |
| 703 | Ga0501082_0637322 | 3300060353 | Bacteria | 933 |
| 704 | Ga0501082_0929055 | 3300060353 | Bacteria | 761 |
| 705 | Ga0501082_1587817 | 3300060353 | Bacteria | 571 |
| 706 | Ga0466962_0011189 | 3300061719 | Bacteria | 4320 |
| 707 | Ga0466962_0070927 | 3300061719 | Archaea | 1665 |
| 708 | Ga0466962_0101645 | 3300061719 | Bacteria | 1380 |
| 709 | Ga0466962_0146023 | 3300061719 | Bacteria | 1147 |
| 710 | Ga0466962_0255513 | 3300061719 | Bacteria | 862 |
| 711 | Ga0530510_0030617 | 3300061734 | Bacteria | 3866 |
| 712 | Ga0530510_0104154 | 3300061734 | Bacteria | 2076 |
| 713 | Ga0530510_0150529 | 3300061734 | Bacteria | 1718 |
| 714 | Ga0530510_0216025 | 3300061734 | Bacteria | 1425 |
| 715 | Ga0530510_0283555 | 3300061734 | Bacteria | 1238 |
| 716 | Ga0530510_0291932 | 3300061734 | Bacteria | 1219 |
| 717 | Ga0530510_1045462 | 3300061734 | Bacteria | 625 |
| 718 | Ga0530510_1170520 | 3300061734 | Bacteria | 589 |
| 719 | Ga0070660_101269957 | |||
| 720 | Ga0070683_100103859 | |||
| 721 | Ga0070683_100583868 | |||
| 722 | Ga0068869_100591254 | |||
| 723 | Ga0070680_100046131 | |||
| 724 | Ga0070680_100091334 | |||
| 725 | Ga0070680_101028228 | |||
| 726 | Ga0070680_101444312 | |||
| 727 | Ga0070682_100117193 | |||
| 728 | Ga0070682_100412777 | |||
| 729 | Ga0068868_100051484 | |||
| 730 | Ga0068868_101011893 | |||
| 731 | Ga0070660_100041964 | |||
| 732 | Ga0070660_100463755 | |||
| 733 | Ga0070660_100813767 | |||
| 734 | Ga0070691_10558887 | |||
| 735 | Ga0070687_101329949 | |||
| 736 | Ga0070661_100665458 | |||
| 737 | Ga0070669_101885250 | |||
| 738 | Ga0070675_101343567 | |||
| 739 | Ga0070671_100104671 | |||
| 740 | Ga0070671_100113070 | |||
| 741 | Ga0070671_100288288 | |||
| 742 | Ga0070671_100356284 | |||
| 743 | Ga0070671_100782506 | |||
| 744 | Ga0070674_100380870 | |||
| 745 | Ga0070673_101538764 | |||
| 746 | Ga0070688_101166762 | |||
| 747 | Ga0070659_101225628 | |||
| 748 | Ga0070667_100011225 | |||
| 749 | Ga0070703_10012025 | |||
| 750 | Ga0070703_10038264 | |||
| 751 | Ga0070709_10030007 | |||
| 752 | Ga0070709_10095908 | |||
| 753 | Ga0070709_10176918 | |||
| 754 | Ga0070714_100032272 | |||
| 755 | Ga0070713_100016209 | |||
| 756 | Ga0070713_100286867 | |||
| 757 | Ga0070710_10018809 | |||
| 758 | Ga0070701_10481977 | |||
| 759 | Ga0070711_100035679 | |||
| 760 | Ga0070711_100164442 | |||
| 761 | Ga0070705_100018060 | |||
| 762 | Ga0070705_100101885 | |||
| 763 | Ga0070705_100255865 | |||
| 764 | Ga0070708_100070663 | |||
| 765 | Ga0070663_101052009 | |||
| 766 | Ga0070678_100053401 | |||
| 767 | Ga0070678_100630501 | |||
| 768 | Ga0070681_10012878 | |||
| 769 | Ga0070681_10062891 | |||
| 770 | Ga0070681_11169175 | |||
| 771 | Ga0070706_100127727 | |||
| 772 | Ga0070706_100492329 | |||
| 773 | Ga0070707_100385118 | |||
| 774 | Ga0070707_101482409 | |||
| 775 | Ga0070679_100028844 | |||
| 776 | Ga0070679_100160701 | |||
| 777 | Ga0070679_100817507 | |||
| 778 | Ga0070679_100939889 | |||
| 779 | Ga0070679_100940509 | |||
| 780 | Ga0070684_100023568 | |||
| 781 | Ga0070684_100204992 | |||
| 782 | Ga0070684_100260013 | |||
| 783 | Ga0070684_100271688 | |||
| 784 | Ga0070684_100304284 | |||
| 785 | Ga0070697_100676753 | |||
| 786 | Ga0068853_100231999 | |||
| 787 | Ga0070686_100165180 | |||
| 788 | Ga0070686_100498363 | |||
| 789 | Ga0070695_100090028 | |||
| 790 | Ga0070695_100553569 | |||
| 791 | Ga0070696_100031409 | |||
| 792 | Ga0070696_100189970 | |||
| 793 | Ga0070696_100360709 | |||
| 794 | Ga0070693_100002841 | |||
| 795 | Ga0070693_100857173 | |||
| 796 | Ga0070704_100579580 | |||
| 797 | Ga0070704_100819628 | |||
| 798 | Ga0070704_101134665 | |||
| 799 | Ga0068855_100086582 | |||
| 800 | Ga0068855_101793681 | |||
| 801 | Ga0070664_100234591 | |||
| 802 | Ga0068857_101242320 | |||
| 803 | Ga0068857_102362975 | |||
| 804 | Ga0068854_100831768 | |||
| 805 | Ga0068856_100044239 | |||
| 806 | Ga0068856_100065336 | |||
| 807 | Ga0068856_100109761 | |||
| 808 | Ga0068856_100202068 | |||
| 809 | Ga0068856_100235152 | |||
| 810 | Ga0068856_100310444 | |||
| 811 | Ga0070702_100123721 | |||
| 812 | Ga0068866_10195727 | |||
| 813 | Ga0068861_100186791 | |||
| 814 | Ga0068858_101123002 | |||
| 815 | Ga0068860_102565346 | |||
| 816 | Ga0081455_10060297 | |||
| 817 | Ga0081455_10475290 | |||
| 818 | Ga0081538_10219870 | |||
| 819 | Ga0081539_10080281 | |||
| 820 | Ga0081539_10213773 | |||
| 821 | Ga0070717_10006807 | |||
| 822 | Ga0070717_10035760 | |||
| 823 | Ga0070717_11385673 | |||
| 824 | Ga0075365_10783352 | |||
| 825 | Ga0070715_10020836 | |||
| 826 | Ga0070715_10099165 | |||
| 827 | Ga0070716_100008436 | |||
| 828 | Ga0070716_100204601 | |||
| 829 | Ga0070712_100263455 | |||
| 830 | Ga0097621_100114359 | |||
| 831 | Ga0097621_100674046 | |||
| 832 | Ga0068871_101122442 | |||
| 833 | Ga0075428_100000374 | |||
| 834 | Ga0075430_100194930 | |||
| 835 | Ga0075431_100791044 | |||
| 836 | Ga0075431_101117968 | |||
| 837 | Ga0075433_10086435 | |||
| 838 | Ga0075433_11173375 | |||
| 839 | Ga0075434_100300091 | |||
| 840 | Ga0075434_100568764 | |||
| 841 | Ga0075434_100617741 | |||
| 842 | Ga0075434_100859122 | |||
| 843 | Ga0068865_101152457 | |||
| 844 | Ga0075435_100345585 | |||
| 845 | Ga0075435_100583298 | |||
| 846 | Ga0075435_101941800 | |||
| 847 | Ga0111539_10083399 | |||
| 848 | Ga0111539_10458737 | |||
| 849 | Ga0111539_10954589 | |||
| 850 | Ga0105245_10012378 | |||
| 851 | Ga0105245_10067558 | |||
| 852 | Ga0105245_10086385 | |||
| 853 | Ga0105245_10778814 | |||
| 854 | Ga0105245_10864788 | |||
| 855 | Ga0105245_12128249 | |||
| 856 | Ga0105245_13049201 | |||
| 857 | Ga0105247_10140642 | |||
| 858 | Ga0105247_11266019 | |||
| 859 | Ga0114129_10042699 | |||
| 860 | Ga0105243_10112132 | |||
| 861 | Ga0105243_10275195 | |||
| 862 | Ga0105243_10914080 | |||
| 863 | Ga0105243_11176474 | |||
| 864 | Ga0105243_11369112 | |||
| 865 | Ga0105243_12741369 | |||
| 866 | Ga0105241_10805801 | |||
| 867 | Ga0105242_11199273 | |||
| 868 | Ga0105242_11548464 | |||
| 869 | Ga0105248_10725446 | |||
| 870 | Ga0105248_11345559 | |||
| 871 | Ga0105248_11924222 | |||
| 872 | Ga0105238_10676658 | |||
| 873 | Ga0105249_10311958 | |||
| 874 | Ga0105239_10045576 | |||
| 875 | Ga0105239_11878249 | |||
| 876 | Ga0105246_10065395 | |||
| 877 | Ga0105246_10400652 | |||
| 878 | Ga0105246_11305577 | |||
| 879 | Ga0157373_11037287 | |||
| 880 | Ga0157371_10422889 | |||
| 881 | Ga0157371_11127424 | |||
| 882 | Ga0157371_11209104 | |||
| 883 | Ga0157370_11300304 | |||
| 884 | Ga0157369_10370807 | |||
| 885 | Ga0157369_10522246 | |||
| 886 | Ga0157369_10536138 | |||
| 887 | Ga0157374_10004478 | |||
| 888 | Ga0157374_11457389 | |||
| 889 | Ga0163162_11441386 | |||
| 890 | Ga0163162_13001697 | |||
| 891 | Ga0157372_10383777 | |||
| 892 | Ga0157372_10795947 | |||
| 893 | Ga0157372_10872409 | |||
| 894 | Ga0157372_10986474 | |||
| 895 | Ga0157375_10449449 | |||
| 896 | Ga0157375_10593696 | |||
| 897 | Ga0163163_10119734 | |||
| 898 | Ga0163163_10994856 | |||
| 899 | Ga0163163_11303255 | |||
| 900 | Ga0182008_10153005 | |||
| 901 | Ga0157377_10081557 | |||
| 902 | Ga0157379_10656130 | |||
| 903 | Ga0157379_11139308 | |||
| 904 | Ga0157376_10501042 | |||
| 905 | Ga0157376_10553053 | |||
| 906 | Ga0157376_11506461 | |||
| 907 | Ga0157376_12092376 | |||
| 908 | Ga0163161_10747845 | |||
| 909 | Ga0206350_10015215 | |||
| 910 | Ga0206354_10600778 | |||
| 911 | Ga0206353_10173132 | |||
| 912 | Ga0213874_10250900 | |||
| 913 | Ga0207653_10047140 | |||
| 914 | Ga0207692_10018783 | |||
| 915 | Ga0207692_10539565 | |||
| 916 | Ga0207642_10884718 | |||
| 917 | Ga0207688_10360577 | |||
| 918 | Ga0207685_10001990 | |||
| 919 | Ga0207685_10176678 | |||
| 920 | Ga0207699_10012177 | |||
| 921 | Ga0207699_10658381 | |||
| 922 | Ga0207705_10392816 | |||
| 923 | Ga0207705_10519259 | |||
| 924 | Ga0207684_10136177 | |||
| 925 | Ga0207684_10831104 | |||
| 926 | Ga0207654_10201867 | |||
| 927 | Ga0207707_10009696 | |||
| 928 | Ga0207707_10097369 | |||
| 929 | Ga0207707_10978484 | |||
| 930 | Ga0207695_11153403 | |||
| 931 | Ga0207693_10000699 | |||
| 932 | Ga0207693_10001532 | |||
| 933 | Ga0207663_10004229 | |||
| 934 | Ga0207663_10787857 | |||
| 935 | Ga0207660_10018008 | |||
| 936 | Ga0207660_10052957 | |||
| 937 | Ga0207660_10352322 | |||
| 938 | Ga0207660_11147695 | |||
| 939 | Ga0207660_11152133 | |||
| 940 | Ga0207657_10041733 | |||
| 941 | Ga0207657_10284930 | |||
| 942 | Ga0207652_10011117 | |||
| 943 | Ga0207652_10197173 | |||
| 944 | Ga0207652_10393164 | |||
| 945 | Ga0207652_10423859 | |||
| 946 | Ga0207652_10685642 | |||
| 947 | Ga0207652_11041841 | |||
| 948 | Ga0207652_11263824 | |||
| 949 | Ga0207646_10950822 | |||
| 950 | Ga0207646_11751052 | |||
| 951 | Ga0207681_11460124 | |||
| 952 | Ga0207650_11850000 | |||
| 953 | Ga0207659_11089461 | |||
| 954 | Ga0207687_10032466 | |||
| 955 | Ga0207687_10191617 | |||
| 956 | Ga0207687_10202635 | |||
| 957 | Ga0207687_10728328 | |||
| 958 | Ga0207700_10011439 | |||
| 959 | Ga0207700_10082845 | |||
| 960 | Ga0207700_10259033 | |||
| 961 | Ga0207664_10006925 | |||
| 962 | Ga0207664_10022035 | |||
| 963 | Ga0207664_10477087 | |||
| 964 | Ga0207664_11464007 | |||
| 965 | Ga0207644_10130719 | |||
| 966 | Ga0207644_10137205 | |||
| 967 | Ga0207690_11822589 | |||
| 968 | Ga0207706_10119888 | |||
| 969 | Ga0207686_10250058 | |||
| 970 | Ga0207709_10174247 | |||
| 971 | Ga0207709_10388205 | |||
| 972 | Ga0207709_10409664 | |||
| 973 | Ga0207709_10888654 | |||
| 974 | Ga0207669_10300373 | |||
| 975 | Ga0207704_10159201 | |||
| 976 | Ga0207665_10000653 | |||
| 977 | Ga0207665_10022103 | |||
| 978 | Ga0207691_10792520 | |||
| 979 | Ga0207711_10794155 | |||
| 980 | Ga0207661_10007239 | |||
| 981 | Ga0207661_10048360 | |||
| 982 | Ga0207661_10111408 | |||
| 983 | Ga0207661_10536514 | |||
| 984 | Ga0207679_10672213 | |||
| 985 | Ga0207667_10169991 | |||
| 986 | Ga0207651_11588810 | |||
| 987 | Ga0207640_10359623 | |||
| 988 | Ga0207640_11057505 | |||
| 989 | Ga0207658_10003886 | |||
| 990 | Ga0207677_10023274 | |||
| 991 | Ga0207703_10617176 | |||
| 992 | Ga0207703_11580098 | |||
| 993 | Ga0207639_11282139 | |||
| 994 | Ga0207678_11607544 | |||
| 995 | Ga0207708_10703690 | |||
| 996 | Ga0207702_10006756 | |||
| 997 | Ga0207702_10114640 | |||
| 998 | Ga0207702_10174053 | |||
| 999 | Ga0207702_10394665 | |||
| 1000 | Ga0207702_10526424 | |||
| 1001 | Ga0207702_11045958 | |||
| 1002 | Ga0207674_11837566 | |||
| 1003 | Ga0207675_100292291 | |||
| 1004 | Ga0207683_10159125 | |||
| 1005 | Ga0207683_10252800 | |||
| 1006 | Ga0207428_10474544 | |||
| 1007 | Ga0268266_10985531 | |||
| 1008 | Ga0268264_12241432 | |||
| 1009 | Ga0265334_10242620 | |||
| 1010 | Ga0265318_10014404 | |||
| 1011 | Ga0265322_10003297 | |||
| 1012 | Ga0265322_10189494 | |||
| 1013 | Ga0265338_10065268 | |||
| 1014 | Ga0265324_10022113 | |||
| 1015 | Ga0265330_10078977 | |||
| 1016 | Ga0265325_10056460 | |||
| 1017 | Ga0265331_10037812 | |||
| 1018 | Ga0265331_10092934 | |||
| 1019 | Ga0265327_10015440 | |||
| 1020 | Ga0265327_10061461 | |||
| 1021 | Ga0265327_10166616 | |||
| 1022 | Ga0265316_10020606 | |||
| 1023 | Ga0265316_10520772 | |||
| 1024 | Ga0265313_10030323 | |||
| 1025 | Ga0265314_10060773 | |||
| 1026 | Ga0265314_10072278 | |||
| 1027 | Ga0265342_10168893 | |||
| 1028 | Ga0307407_10059593 | |||
| 1029 | Ga0307409_100029860 | |||
| 1030 | Ga0307416_100753969 | |||
| 1031 | Ga0307415_100955011 | |||
| 1032 | Ga0307415_101494175 | |||
| 1033 | Ga0373930_0010717 | |||
| 1034 | Ga0373950_0001843 | |||
| 1035 | Ga0373958_0095395 | |||
| 1036 | Ga0373929_0010623 | |||
| 1037 | Ga0373929_0138614 | |||
| 1038 | Ga0373934_0352671 | |||
| 1039 | Ga0373949_0001938 | |||
| 1040 | Ga0373952_0276840 | |||
| 1041 | Ga0373932_0053886 | |||
| 1042 | Ga0373939_0046938 | |||
| 1043 | Ga0373954_0264599 | |||
| 1044 | Ga0373957_0121052 | |||
| 1045 | Ga0373946_0165408 | |||
| 1046 | Ga0373955_0053225 | |||
| 1047 | Ga0373955_0723849 | |||
| 1048 | Ga0373942_0109959 | |||
| 1049 | Ga0373961_0009927 | |||
| 1050 | Ga0373962_0056740 | |||
| 1051 | Ga0373931_0045649 | |||
| 1052 | Ga0373931_0145781 | |||
| 1053 | Ga0373931_0173730 | |||
| 1054 | Ga0373947_0477859 | |||
| 1055 | Ga0373947_0758614 | |||
| 1056 | Ga0373937_0045303 | |||
| 1057 | Ga0395899_0009642 | |||
| 1058 | Ga0395899_0373359 | |||
| 1059 | Ga0395900_0003795 | |||
| 1060 | Ga0395900_0022123 | |||
| 1061 | Ga0395900_1563037 | |||
| 1062 | Ga0395898_0024171 | |||
| 1063 | Ga0395898_0071989 | |||
| 1064 | Ga0395898_0358127 | |||
| 1065 | Ga0395898_0399653 | |||
| 1066 | Ga0395898_1361845 | |||
| 1067 | Ga0395905_0061092 | |||
| 1068 | Ga0395905_0291490 | |||
| 1069 | Ga0395905_1179669 | |||
| 1070 | Ga0395901_0109846 | |||
| 1071 | Ga0395901_0335410 | |||
| 1072 | Ga0395901_0392571 | |||
| 1073 | Ga0395901_0399698 | |||
| 1074 | Ga0395901_0516859 | |||
| 1075 | Ga0395901_1142926 | |||
| 1076 | Ga0395901_1180103 | |||
| 1077 | Ga0395901_1799644 | |||
| 1078 | Ga0436360_1255117 | |||
| 1079 | Ga0436363_0432503 | |||
| 1080 | Ga0439439_0263274 | |||
| 1081 | Ga0439461_0109614 | |||
| 1082 | Ga0439466_0107647 | |||
| 1083 | Ga0439465_0265760 | |||
| 1084 | Ga0439465_0381203 | |||
| 1085 | Ga0451800_0008995 | |||
| 1086 | Ga0451849_0198147 | |||
| 1087 | Ga0439432_119786 | |||
| 1088 | Ga0450898_104855 | |||
| 1089 | Ga0450906_045142 | |||
| 1090 | Ga0450907_007656 | |||
| 1091 | Ga0439446_0065937 | |||
| 1092 | Ga0439434_0071559 | |||
| 1093 | Ga0450918_049432 | |||
| 1094 | Ga0451577_1160832 | |||
| 1095 | Ga0466969_0027110 | |||
| 1096 | Ga0466972_0015132 | |||
| 1097 | Ga0466965_0256154 | |||
| 1098 | Ga0466966_0002641 | |||
| 1099 | Ga0466966_0031012 | |||
| 1100 | Ga0466961_0014040 | |||
| 1101 | Ga0466963_0235346 | |||
| 1102 | Ga0466963_0590600 | |||
| 1103 | Ga0453684_2463523 | |||
| 1104 | Ga0466971_0010069 | |||
| 1105 | Ga0466971_0011610 | |||
| 1106 | Ga0466968_0013298 | |||
| 1107 | Ga0466968_0336941 | |||
| 1108 | Ga0466970_0115763 | |||
| 1109 | Ga0466957_0021849 | |||
| 1110 | Ga0466957_0635475 | |||
| 1111 | Ga0466960_0302119 | |||
| 1112 | Ga0466959_0013756 | |||
| 1113 | Ga0466959_0207449 | |||
| 1114 | Ga0466959_0296555 | |||
| 1115 | Ga0451576_2193175 | |||
| 1116 | Ga0466958_0016821 | |||
| 1117 | Ga0466958_0037636 | |||
| 1118 | Ga0466967_0019791 | |||
| 1119 | Ga0466967_0064368 | |||
| 1120 | Ga0466967_0609872 | |||
| 1121 | Ga0495592_0023977 | |||
| 1122 | Ga0495603_0058687 | |||
| 1123 | Ga0495629_0031365 | |||
| 1124 | Ga0495629_0127896 | |||
| 1125 | Ga0495629_0141549 | |||
| 1126 | Ga0495629_0154153 | |||
| 1127 | Ga0495641_0230305 | |||
| 1128 | Ga0495651_0086316 | |||
| 1129 | Ga0495651_0092472 | |||
| 1130 | Ga0495651_0198185 | |||
| 1131 | Ga0495651_0327769 | |||
| 1132 | Ga0495653_0024865 | |||
| 1133 | Ga0495653_0097761 | |||
| 1134 | Ga0495653_0235781 | |||
| 1135 | Ga0495653_0276243 | |||
| 1136 | Ga0495653_0316994 | |||
| 1137 | Ga0495580_1045635 | |||
| 1138 | Ga0495582_0080905 | |||
| 1139 | Ga0495582_0110369 | |||
| 1140 | Ga0495582_0111138 | |||
| 1141 | Ga0495664_0087656 | |||
| 1142 | Ga0495664_0162054 | |||
| 1143 | Ga0495584_0643131 | |||
| 1144 | Ga0495594_0514276 | |||
| 1145 | Ga0495596_0048089 | |||
| 1146 | Ga0495608_0006906 | |||
| 1147 | Ga0495608_0150776 | |||
| 1148 | Ga0495608_0333923 | |||
| 1149 | Ga0495618_0321168 | |||
| 1150 | Ga0495618_0352245 | |||
| 1151 | Ga0495628_0024207 | |||
| 1152 | Ga0495628_0375630 | |||
| 1153 | Ga0495630_0335399 | |||
| 1154 | Ga0495630_0518064 | |||
| 1155 | Ga0495630_0862169 | |||
| 1156 | Ga0495644_0310485 | |||
| 1157 | Ga0495652_0069968 | |||
| 1158 | Ga0495652_0104401 | |||
| 1159 | Ga0495640_0179276 | |||
| 1160 | Ga0495586_0215966 | |||
| 1161 | Ga0495586_0632778 | |||
| 1162 | Ga0495587_0092975 | |||
| 1163 | Ga0495587_0356377 | |||
| 1164 | Ga0495645_0229408 | |||
| 1165 | Ga0495645_0940302 | |||
| 1166 | Ga0495667_0016328 | |||
| 1167 | Ga0495667_0025734 | |||
| 1168 | Ga0495667_0806650 | |||
| 1169 | Ga0495656_0076108 | |||
| 1170 | Ga0495634_0012968 | |||
| 1171 | Ga0495634_0342553 | |||
| 1172 | Ga0495634_0630783 | |||
| 1173 | Ga0495635_0026017 | |||
| 1174 | Ga0495635_0159259 | |||
| 1175 | Ga0495635_0232487 | |||
| 1176 | Ga0495635_0371177 | |||
| 1177 | Ga0495657_0006007 | |||
| 1178 | Ga0495599_0030958 | |||
| 1179 | Ga0495599_0496186 | |||
| 1180 | Ga0495599_0561578 | |||
| 1181 | Ga0495623_0028311 | |||
| 1182 | Ga0495623_0173097 | |||
| 1183 | Ga0495646_0030128 | |||
| 1184 | Ga0495646_0333494 | |||
| 1185 | Ga0495647_0042765 | |||
| 1186 | Ga0495658_0008377 | |||
| 1187 | Ga0495658_0558843 | |||
| 1188 | Ga0495613_0074572 | |||
| 1189 | Ga0495613_0232091 | |||
| 1190 | Ga0495613_0333394 | |||
| 1191 | Ga0495613_0501303 | |||
| 1192 | Ga0495600_0121277 | |||
| 1193 | Ga0495600_0145008 | |||
| 1194 | Ga0495600_0182539 | |||
| 1195 | Ga0495600_0305072 | |||
| 1196 | Ga0495581_0342347 | |||
| 1197 | Ga0495581_0394702 | |||
| 1198 | Ga0495604_0142879 | |||
| 1199 | Ga0495604_0232317 | |||
| 1200 | Ga0495674_0182699 | |||
| 1201 | Ga0495674_0245725 | |||
| 1202 | Ga0495676_0046869 | |||
| 1203 | Ga0495676_0147318 | |||
| 1204 | Ga0495680_0026950 | |||
| 1205 | Ga0495680_0091709 | |||
| 1206 | Ga0495680_0100218 | |||
| 1207 | Ga0495680_0140378 | |||
| 1208 | Ga0495680_0966173 | |||
| 1209 | Ga0495684_0005859 | |||
| 1210 | Ga0495684_0081353 | |||
| 1211 | Ga0495684_0360168 | |||
| 1212 | Ga0495602_0008825 | |||
| 1213 | Ga0496100_0008322 | |||
| 1214 | Ga0496100_0050405 | |||
| 1215 | Ga0496100_0068539 | |||
| 1216 | Ga0496100_0490645 | |||
| 1217 | Ga0496100_1015673 | |||
| 1218 | Ga0496101_0003443 | |||
| 1219 | Ga0496101_0021289 | |||
| 1220 | Ga0496101_0086395 | |||
| 1221 | Ga0496101_0123323 | |||
| 1222 | Ga0496101_0163236 | |||
| 1223 | Ga0496101_0195002 | |||
| 1224 | Ga0496101_0195082 | |||
| 1225 | Ga0496101_0293000 | |||
| 1226 | Ga0496101_0684536 | |||
| 1227 | Ga0496102_0021038 | |||
| 1228 | Ga0496102_0073701 | |||
| 1229 | Ga0496102_0123627 | |||
| 1230 | Ga0496102_0276430 | |||
| 1231 | Ga0496102_0428324 | |||
| 1232 | Ga0496102_0683151 | |||
| 1233 | Ga0496102_0759285 | |||
| 1234 | Ga0496102_0775469 | |||
| 1235 | Ga0496102_1278363 | |||
| 1236 | Ga0496103_0008697 | |||
| 1237 | Ga0496103_0012452 | |||
| 1238 | Ga0496103_0042072 | |||
| 1239 | Ga0496103_0355274 | |||
| 1240 | Ga0496103_0635320 | |||
| 1241 | Ga0496104_0002034 | |||
| 1242 | Ga0496104_0042982 | |||
| 1243 | Ga0496104_0066774 | |||
| 1244 | Ga0496104_0120343 | |||
| 1245 | Ga0496104_0194310 | |||
| 1246 | Ga0496104_0277597 | |||
| 1247 | Ga0496104_0339960 | |||
| 1248 | Ga0496104_0925365 | |||
| 1249 | Ga0496104_1555478 | |||
| 1250 | Ga0496105_0000050 | |||
| 1251 | Ga0496105_0005896 | |||
| 1252 | Ga0496105_0022619 | |||
| 1253 | Ga0496105_0121180 | |||
| 1254 | Ga0496105_0331293 | |||
| 1255 | Ga0496105_0609726 | |||
| 1256 | Ga0496105_1396852 | |||
| 1257 | Ga0496106_0010212 | |||
| 1258 | Ga0496106_0047440 | |||
| 1259 | Ga0496106_0050758 | |||
| 1260 | Ga0496106_0199165 | |||
| 1261 | Ga0496106_0461778 | |||
| 1262 | Ga0496106_1023289 | |||
| 1263 | Ga0496106_1150374 | |||
| 1264 | Ga0496107_0002732 | |||
| 1265 | Ga0496107_0016043 | |||
| 1266 | Ga0496107_0041450 | |||
| 1267 | Ga0496107_0080575 | |||
| 1268 | Ga0496107_0127694 | |||
| 1269 | Ga0496107_0232135 | |||
| 1270 | Ga0496107_0319079 | |||
| 1271 | Ga0496107_0563207 | |||
| 1272 | Ga0496108_0002704 | |||
| 1273 | Ga0496108_0053502 | |||
| 1274 | Ga0496108_0099780 | |||
| 1275 | Ga0496108_0374764 | |||
| 1276 | Ga0496108_0510765 | |||
| 1277 | Ga0496108_1474451 | |||
| 1278 | Ga0496109_0001247 | |||
| 1279 | Ga0496109_0002493 | |||
| 1280 | Ga0496109_0105146 | |||
| 1281 | Ga0496109_0162660 | |||
| 1282 | Ga0496109_0289337 | |||
| 1283 | Ga0496109_0325860 | |||
| 1284 | Ga0496109_0439677 | |||
| 1285 | Ga0496109_1458529 | |||
| 1286 | Ga0496110_0002214 | |||
| 1287 | Ga0496110_0004510 | |||
| 1288 | Ga0496110_0021471 | |||
| 1289 | Ga0496110_0276563 | |||
| 1290 | Ga0496110_0796234 | |||
| 1291 | Ga0496110_1122684 | |||
| 1292 | Ga0496110_1257533 | |||
| 1293 | Ga0496110_1708431 | |||
| 1294 | Ga0496111_0000325 | |||
| 1295 | Ga0496111_0003419 | |||
| 1296 | Ga0496111_0021716 | |||
| 1297 | Ga0496111_0030321 | |||
| 1298 | Ga0496111_0277859 | |||
| 1299 | Ga0496111_0333377 | |||
| 1300 | Ga0496111_0510511 | |||
| 1301 | Ga0496111_0882896 | |||
| 1302 | Ga0496111_1055480 | |||
| 1303 | Ga0496112_0013131 | |||
| 1304 | Ga0496112_0328436 | |||
| 1305 | Ga0496112_0424069 | |||
| 1306 | Ga0496112_0669577 | |||
| 1307 | Ga0496112_1229657 | |||
| 1308 | Ga0496113_0021017 | |||
| 1309 | Ga0496113_0036347 | |||
| 1310 | Ga0496113_0053473 | |||
| 1311 | Ga0496113_0266177 | |||
| 1312 | Ga0496113_0556608 | |||
| 1313 | Ga0496113_0669363 | |||
| 1314 | Ga0496113_0781778 | |||
| 1315 | Ga0496114_0000304 | |||
| 1316 | Ga0496114_0005710 | |||
| 1317 | Ga0496114_0038317 | |||
| 1318 | Ga0496114_0038679 | |||
| 1319 | Ga0496114_0057760 | |||
| 1320 | Ga0496114_0061999 | |||
| 1321 | Ga0496114_0092121 | |||
| 1322 | Ga0496114_0094133 | |||
| 1323 | Ga0496114_1014102 | |||
| 1324 | Ga0496115_0005373 | |||
| 1325 | Ga0496115_0061096 | |||
| 1326 | Ga0496115_0082242 | |||
| 1327 | Ga0496115_0263207 | |||
| 1328 | Ga0496115_1014618 | |||
| 1329 | Ga0496115_1156379 | |||
| 1330 | Ga0501031_0253407 | |||
| 1331 | Ga0501031_0309224 | |||
| 1332 | Ga0501036_0902828 | |||
| 1333 | Ga0501036_1440220 | |||
| 1334 | Ga0501039_0413211 | |||
| 1335 | Ga0501040_0045087 | |||
| 1336 | Ga0501040_0148261 | |||
| 1337 | Ga0501040_0486626 | |||
| 1338 | Ga0501041_0035486 | |||
| 1339 | Ga0501041_0212732 | |||
| 1340 | Ga0501042_0316756 | |||
| 1341 | Ga0501042_0471862 | |||
| 1342 | Ga0501042_0551103 | |||
| 1343 | Ga0501042_0587788 | |||
| 1344 | Ga0501046_0180414 | |||
| 1345 | Ga0501067_0019822 | |||
| 1346 | Ga0501067_0121183 | |||
| 1347 | Ga0501067_0208114 | |||
| 1348 | Ga0501068_0630891 | |||
| 1349 | Ga0501069_0007322 | |||
| 1350 | Ga0501069_0127297 | |||
| 1351 | Ga0501069_0228143 | |||
| 1352 | Ga0501069_0235958 | |||
| 1353 | Ga0501069_0291302 | |||
| 1354 | Ga0501070_0136223 | |||
| 1355 | Ga0501070_0789067 | |||
| 1356 | Ga0501071_0330774 | |||
| 1357 | Ga0501072_0183812 | |||
| 1358 | Ga0501072_0463248 | |||
| 1359 | Ga0501074_0251574 | |||
| 1360 | Ga0501074_0623280 | |||
| 1361 | Ga0501075_0165869 | |||
| 1362 | Ga0501075_0177814 | |||
| 1363 | Ga0501076_0010820 | |||
| 1364 | Ga0501076_1000310 | |||
| 1365 | Ga0501076_1221809 | |||
| 1366 | Ga0501076_1222505 | |||
| 1367 | Ga0501077_0080152 | |||
| 1368 | Ga0501077_0326108 | |||
| 1369 | Ga0501077_0698189 | |||
| 1370 | Ga0501077_1049263 | |||
| 1371 | Ga0501079_0069629 | |||
| 1372 | Ga0501079_0125948 | |||
| 1373 | Ga0501080_0208797 | |||
| 1374 | Ga0501080_1178936 | |||
| 1375 | Ga0501080_1332551 | |||
| 1376 | Ga0501081_0221185 | |||
| 1377 | Ga0501081_0302036 | |||
| 1378 | Ga0501083_0460841 | |||
| 1379 | Ga0501045_0046796 | |||
| 1380 | Ga0501045_0171441 | |||
| 1381 | Ga0501045_0220805 | |||
| 1382 | Ga0501045_0383759 | |||
| 1383 | Ga0501045_0609778 | |||
| 1384 | Ga0501045_0666779 | |||
| 1385 | nmdc:mga05p37_225851_c1 | |||
| 1386 | nmdc:mga05p37_6822_c1 | |||
| 1387 | nmdc:mga05p37_874125_c1 | |||
| 1388 | nmdc:mga09592_726211_c1 | |||
| 1389 | nmdc:mga0qj67_102122_c1 | |||
| 1390 | nmdc:mga06r32_65503_c1 | |||
| 1391 | nmdc:mga08y16_1786338_c1 | |||
| 1392 | nmdc:mga0n895_352319_c1 | |||
| 1393 | nmdc:mga0n895_587487_c1 | |||
| 1394 | nmdc:mga0n895_610783_c1 | |||
| 1395 | nmdc:mga0n895_654599_c1 | |||
| 1396 | nmdc:mga0n895_863643_c1 | |||
| 1397 | nmdc:mga0rr50_1507103_c1 | |||
| 1398 | nmdc:mga0rr50_1729039_c1 | |||
| 1399 | nmdc:mga0rr50_653234_c1 | |||
| 1400 | nmdc:mga0a205_349417_c1 | |||
| 1401 | nmdc:mga0a205_99110_c1 | |||
| 1402 | nmdc:mga0a205_996486_c1 | |||
| 1403 | Ga0495601_0055485 | |||
| 1404 | Ga0495601_0285623 | |||
| 1405 | Ga0495612_0170435 | |||
| 1406 | Ga0495595_0292457 | |||
| 1407 | Ga0495595_0377070 | |||
| 1408 | Ga0495595_0412199 | |||
| 1409 | Ga0495619_0008941 | |||
| 1410 | Ga0495619_0017786 | |||
| 1411 | Ga0495619_0322626 | |||
| 1412 | Ga0495619_0434363 | |||
| 1413 | Ga0495619_0503920 | |||
| 1414 | Ga0501084_0096322 | |||
| 1415 | Ga0501084_0181322 | |||
| 1416 | Ga0501084_0432007 | |||
| 1417 | Ga0501084_0615519 | |||
| 1418 | Ga0501084_0956633 | |||
| 1419 | Ga0501084_1326619 | |||
| 1420 | Ga0501082_0028754 | |||
| 1421 | Ga0501082_0637322 | |||
| 1422 | Ga0501082_0929055 | |||
| 1423 | Ga0501082_1587817 | |||
| 1424 | Ga0466962_0011189 | |||
| 1425 | Ga0466962_0070927 | |||
| 1426 | Ga0466962_0101645 | |||
| 1427 | Ga0466962_0146023 | |||
| 1428 | Ga0466962_0255513 | |||
| 1429 | Ga0530510_0030617 | |||
| 1430 | Ga0530510_0104154 | |||
| 1431 | Ga0530510_0150529 | |||
| 1432 | Ga0530510_0216025 | |||
| 1433 | Ga0530510_0283555 | |||
| 1434 | Ga0530510_0291932 | |||
| 1435 | Ga0530510_1045462 | |||
| 1436 | Ga0530510_1170520 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2avp-assembly1.cif.gz_A | crystal structure of an 8 repeat consensus tpr superhelix | 0.9825 | 42 | 106 |
| 8fwd-assembly1.cif.gz_L | fast and versatile sequence- independent protein docking for nanomaterials design using rpxdock | 0.9824 | 5 | 101 |
| 8fwd-assembly1.cif.gz_P | fast and versatile sequence- independent protein docking for nanomaterials design using rpxdock | 0.9803 | 5 | 101 |
| 6vl6-assembly1.cif.gz_B | de novo designed tetrahedral nanoparticle t33_dn2 presenting bg505 sosip trimers | 0.9792 | 4 | 99 |
| 8fwd-assembly1.cif.gz_2 | fast and versatile sequence- independent protein docking for nanomaterials design using rpxdock | 0.9762 | 5 | 101 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q4DHE6_537_695_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.986 | 5 | 102 | 1.25.40.10 |
| af_Q1L5Z9_195_311_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.978 | 5 | 113 | 1.25.40.10 |
| af_Q4DCN5_541_666_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.9759 | 5 | 105 | 1.25.40.10 |
| af_D3ZX48_1_106_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.9757 | 35 | 113 | 1.25.40.10 |
| af_F1RBN2_267_425_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.9745 | 5 | 113 | 1.25.40.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3N5UNK9-F1-model_v4 | Uncharacterized protein | 0.9899 | 3 | 113 |
|
| AF-A0A0T5ZMU3-F1-model_v4 | Uncharacterized protein | 0.9891 | 2 | 113 |
|
| AF-A0A7V9M613-F1-model_v4 | Tetratricopeptide repeat protein | 0.9888 | 5 | 113 |
|
| AF-A0A538MKB9-F1-model_v4 | Tetratricopeptide repeat protein | 0.9833 | 1 | 117 |
|
| AF-A0A7J9WQT7-F1-model_v4 | Tetratricopeptide repeat protein | 0.9832 | 2 | 113 |
|