F477130

General Info

Members Datasets Scaffolds Average Seq Length
717 353 628 261

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221587|2643946291
Length 290
Sequence IVKDAKAGGELIADGIAGLLRRKPDALLGVATGSTPLPIYDALIAQVEAGSVDASRARIAQLDEYVGLPXGHPESYRSTVLRQVVEPLGLSQEAFMGPDGSAEDVLAACEAYDKALAAAGGVDLQILGIGTDGHIGFNEPCSSLASRTRIKTLTEQTRVDNARFFDXDIEQVPHHVITQGIGTILEARHLVLLATGEGKAEAVAQTVEGPVAALVPASALQLHPHATVVVDEAAASKLKLADYFRHTXPASALQLHPHATVVVDEAAASKLKLADYFRHTXANKPAWQGL

Samples

Sample ID Description Type Environment
1 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
2 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
3 2558860280 Kutzneria sp. 744 Isolate Unclassified
4 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
5 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
6 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
7 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
8 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
9 2643221548 Streptomyces sp. Root55 Isolate Unclassified
10 2643221578 Streptomyces sp. Root63 Isolate Unclassified
11 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
12 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
13 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
14 2643221647 Streptomyces sp. Root369 Isolate Unclassified
15 2643221670 Streptomyces sp. Root431 Isolate Unclassified
16 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
17 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
18 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
19 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
20 2643221714 Streptomyces sp. Root264 Isolate Unclassified
21 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
22 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
23 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
24 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
25 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
26 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
27 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
28 2808606448 Streptomyces sp. 193411 Isolate Unclassified
29 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
30 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
31 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
32 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
33 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
34 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
35 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
36 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
37 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
38 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
39 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
40 2862574272 Streptomyces sp. AcE210 Isolate Nodule
41 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
42 2867428634 Streptomyces sp. RP5T Isolate Unclassified
43 2867475112 Streptomyces sp. TM32 Isolate Unclassified
44 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
45 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
46 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
47 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
48 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
49 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
50 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
51 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
52 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
53 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
54 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
55 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
56 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
57 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
58 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
59 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
60 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
61 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
62 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
63 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
64 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
65 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
66 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
67 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
68 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
69 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
70 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
71 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
72 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
73 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
74 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
75 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
76 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
77 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
78 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
79 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
80 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
81 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
82 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
83 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
84 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
85 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
86 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
87 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
88 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
89 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
90 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
91 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
92 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
93 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
94 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
95 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
96 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
97 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
98 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
99 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
100 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
101 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
102 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
103 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
106 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
112 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
113 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
114 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
115 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
129 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
130 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
131 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
132 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
133 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
134 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
135 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
136 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
137 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
138 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
139 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
140 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
141 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
142 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
143 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
144 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
145 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
146 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
147 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
148 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
149 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
154 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
155 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
156 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
157 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
158 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
159 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
160 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
161 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
162 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
163 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
165 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
166 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
167 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
168 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
169 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
170 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
171 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
172 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
173 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
174 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
175 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
176 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
177 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
178 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
179 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
180 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
181 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
182 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
183 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
184 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
185 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
186 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
187 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
188 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
189 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
190 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
191 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
192 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
193 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
194 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
195 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
196 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
197 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
198 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
199 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
200 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
201 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
202 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
203 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
204 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
205 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
206 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
207 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
208 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
209 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
210 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
211 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
212 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
213 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
214 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
215 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
216 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
217 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
218 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
219 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
220 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
221 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
222 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
223 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
224 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
225 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
226 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
227 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
228 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
229 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
230 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
231 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
232 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
233 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
234 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
235 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
236 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
237 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
238 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
239 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
240 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
241 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
242 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
243 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
244 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
245 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
246 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
247 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
248 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
249 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
250 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
251 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
252 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
253 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
254 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
255 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
256 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
257 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
258 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
259 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
260 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
261 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
262 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
263 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
264 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
265 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
266 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
267 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
268 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
269 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
270 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
271 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
272 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
273 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
274 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
275 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
276 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
277 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
278 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
279 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
280 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
281 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
282 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
283 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
284 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
285 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
301 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
302 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
303 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
304 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
305 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
306 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
307 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
308 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
309 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
310 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
311 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
312 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
313 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
314 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
315 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
316 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
319 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
320 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
321 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
322 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
323 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
324 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
325 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
326 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
327 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
328 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
329 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
330 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
331 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
332 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
333 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
334 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
335 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
336 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
337 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
338 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
339 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
340 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
341 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
342 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
343 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
344 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
345 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
346 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
347 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
348 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
349 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
350 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
351 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
352 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
353 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.17
Metatranscriptomes 0.42
Isolates 12.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.93
Nodule 0.42
Rhizoplane 1.26
Rhizosphere 84.52
Stem 0
Stem Tuber 0
Unclassified 10.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10046265 3300001989 Bacteria 1425
2 rootH1_10004151 3300003316 Bacteria 24173
3 rootH2_10014916 3300003320 Bacteria 7471
4 rootH2_10067347 3300003320 Bacteria 4039
5 rootH1_10002980 3300003323 Bacteria 3487
6 JGI25407J50210_10000308 3300003373 Bacteria 8960
7 Ga0006562J51391_1062118 3300003578 Bacteria 3030
8 Ga0006562J51391_1151006 3300003578 Bacteria 3809
9 Ga0006562J51391_1151007 3300003578 Bacteria 3830
10 Ga0070690_100072576 3300005330 Bacteria 2238
11 Ga0070687_100010814 3300005343 Bacteria 3969
12 Ga0070663_100042554 3300005455 Bacteria 3192
13 Ga0068853_100039038 3300005539 Bacteria 4048
14 Ga0068853_100178766 3300005539 Bacteria 1923
15 Ga0070686_100034779 3300005544 Bacteria 3108
16 Ga0070665_100399942 3300005548 Bacteria 1381
17 Ga0070665_100554361 3300005548 Bacteria 1162
18 Ga0068855_100074440 3300005563 Bacteria 3944
19 Ga0068856_100514702 3300005614 Bacteria 1218
20 Ga0068852_100068287 3300005616 Bacteria 3110
21 Ga0068870_10108254 3300005840 Bacteria 1582
22 Ga0068863_100059863 3300005841 Bacteria 3603
23 Ga0081455_10003831 3300005937 Bacteria 17155
24 Ga0081538_10016788 3300005981 Bacteria 5591
25 Ga0075368_10027892 3300006042 Bacteria 2180
26 Ga0075432_10024054 3300006058 Bacteria 2086
27 Ga0075367_10001580 3300006178 Bacteria 9864
28 Ga0075428_100082440 3300006844 Bacteria 3509
29 Ga0075428_100219394 3300006844 Bacteria 2054
30 Ga0075430_100248608 3300006846 Bacteria 1473
31 Ga0075431_100388037 3300006847 Bacteria 1399
32 Ga0111539_10018042 3300009094 Bacteria 8741
33 Ga0114129_10519992 3300009147 Bacteria 1552
34 Ga0105241_10030012 3300009174 Bacteria 4061
35 Ga0105238_10244509 3300009551 Bacteria 1772
36 Ga0105239_10139352 3300010375 Bacteria 2702
37 Ga0105239_10799907 3300010375 Bacteria 1080
38 Ga0105246_10007527 3300011119 Bacteria 6680
39 Ga0157369_10058736 3300013105 Bacteria 4149
40 Ga0157369_10264581 3300013105 Bacteria 1793
41 Ga0157375_10364667 3300013308 Bacteria 1611
42 Ga0182008_10004552 3300014497 Bacteria 8080
43 Ga0182007_10000456 3300015262 Bacteria 24668
44 Ga0183367_1002 3300015688 Bacteria 1101531
45 Ga0209758_1002959 3300025297 Bacteria 16295
46 Ga0207426_1002333 3300025302 Bacteria 12397
47 Ga0207426_1004035 3300025302 Bacteria 7437
48 Ga0207426_1027227 3300025302 Bacteria 1906
49 Ga0207647_10051049 3300025904 Bacteria 2558
50 Ga0207654_10022550 3300025911 Bacteria 3361
51 Ga0207695_10051895 3300025913 Bacteria 4302
52 Ga0207695_10455356 3300025913 Bacteria 1162
53 Ga0207671_10029288 3300025914 Bacteria 4111
54 Ga0207662_10003833 3300025918 Bacteria 7817
55 Ga0207694_10033876 3300025924 Bacteria 3914
56 Ga0207667_10082521 3300025949 Bacteria 3329
57 Ga0207639_10024209 3300026041 Bacteria 4391
58 Ga0207641_10048002 3300026088 Bacteria 3603
59 Ga0207675_100462031 3300026118 Bacteria 1259
60 Ga0209371_1021066 3300027312 Bacteria 1589
61 Ga0268266_10284169 3300028379 Bacteria 1539
62 Ga0307517_10002122 3300028786 Bacteria 32257
63 Ga0307517_10020199 3300028786 Bacteria 8498
64 Ga0307515_10000699 3300028794 Bacteria 77489
65 Ga0307515_10192472 3300028794 Bacteria 1944
66 Ga0268256_1023683 3300030500 Bacteria 1589
67 Ga0307511_10000358 3300030521 Bacteria 48452
68 Ga0307511_10000438 3300030521 Bacteria 44529
69 Ga0307511_10046666 3300030521 Bacteria 3558
70 Ga0307511_10147276 3300030521 Bacteria 1363
71 Ga0307512_10004491 3300030522 Bacteria 15270
72 Ga0307512_10014211 3300030522 Bacteria 7428
73 Ga0307512_10099707 3300030522 Bacteria 1975
74 Ga0265332_10055323 3300031238 Bacteria 1701
75 Ga0265320_10008949 3300031240 Bacteria 6080
76 Ga0265339_10014035 3300031249 Bacteria 4839
77 Ga0307513_10005125 3300031456 Bacteria 17345
78 Ga0307513_10325142 3300031456 Bacteria 1294
79 Ga0307509_10030667 3300031507 Bacteria 5944
80 Ga0307509_10044286 3300031507 Bacteria 4810
81 Ga0307509_10057387 3300031507 Bacteria 4128
82 Ga0307509_10096328 3300031507 Bacteria 3011
83 Ga0307509_10210542 3300031507 Bacteria 1769
84 Ga0307408_100218557 3300031548 Bacteria 1554
85 Ga0307408_100371605 3300031548 Bacteria 1219
86 Ga0265313_10031218 3300031595 Bacteria 2733
87 Ga0265313_10035055 3300031595 Bacteria 2531
88 Ga0307508_10007077 3300031616 Bacteria 10455
89 Ga0307508_10030324 3300031616 Bacteria 4887
90 Ga0307508_10057020 3300031616 Bacteria 3457
91 Ga0307508_10078582 3300031616 Bacteria 2880
92 Ga0307514_10010429 3300031649 Bacteria 7765
93 Ga0307514_10083754 3300031649 Bacteria 2349
94 Ga0307514_10129746 3300031649 Bacteria 1738
95 Ga0265314_10003116 3300031711 Bacteria 16300
96 Ga0265314_10063598 3300031711 Bacteria 2502
97 Ga0307516_10011516 3300031730 Bacteria 9600
98 Ga0307405_10048554 3300031731 Bacteria 2618
99 Ga0307405_10219109 3300031731 Bacteria 1395
100 Ga0307413_10025236 3300031824 Bacteria 3255
101 Ga0307518_10083769 3300031838 Bacteria 2299
102 Ga0307518_10114381 3300031838 Bacteria 1918
103 Ga0307410_10019258 3300031852 Bacteria 4147
104 Ga0307406_10009225 3300031901 Bacteria 5526
105 Ga0307407_10000754 3300031903 Bacteria 10630
106 Ga0307412_10305962 3300031911 Bacteria 1258
107 Ga0307409_100000237 3300031995 Bacteria 22304
108 Ga0307416_100000124 3300032002 Bacteria 46509
109 Ga0307416_100073021 3300032002 Bacteria 2858
110 Ga0307416_100084444 3300032002 Bacteria 2698
111 Ga0307411_10017436 3300032005 Bacteria 4092
112 Ga0307415_100002913 3300032126 Bacteria 8579
113 Ga0307507_10028327 3300033179 Bacteria 5973
114 Ga0307507_10055781 3300033179 Bacteria 3740
115 Ga0307510_10057603 3300033180 Bacteria 4030
116 Ga0373950_0000002 3300034818 Bacteria 933559
117 Ga0373950_0000055 3300034818 Bacteria 80935
118 Ga0373926_0001812 3300035083 Bacteria 6630
119 Ga0373941_0077365 3300035115 Bacteria 1117
120 Ga0373954_0173989 3300035118 Bacteria 1055
121 Ga0373931_0011036 3300035691 Bacteria 4356
122 Ga0373931_0235975 3300035691 Bacteria 1107
123 Ga0373933_0000142 3300035724 Bacteria 46265
124 Ga0373937_0005943 3300036401 Bacteria 10505
125 Ga0395899_0009493 3300037312 Bacteria 7468
126 Ga0395898_0003329 3300037466 Bacteria 18046
127 Ga0395898_0006626 3300037466 Bacteria 12345
128 Ga0395905_0039029 3300037471 Bacteria 4455
129 Ga0395901_0046131 3300038443 Bacteria 4525
130 Ga0395901_0290767 3300038443 Bacteria 1696
131 Ga0439436_0002737 3300041404 Bacteria 5330
132 Ga0439436_0022920 3300041404 Bacteria 1848
133 Ga0439439_0001260 3300041406 Bacteria 4936
134 Ga0451837_1767802 3300041494 Bacteria 2181
135 Ga0451849_1538132 3300041505 Bacteria 1499
136 Ga0451853_0299947 3300041512 Bacteria 11652
137 Ga0451853_1037359 3300041512 Bacteria 4203
138 Ga0439448_0015074 3300042005 Bacteria 2338
139 Ga0439449_0000611 3300042007 Bacteria 13394
140 Ga0439449_0008467 3300042007 Bacteria 3909
141 Ga0439449_0107782 3300042007 Bacteria 1031
142 Ga0439451_017111 3300042009 Unclassified 1461
143 Ga0439457_000227 3300042014 Bacteria 15018
144 Ga0439457_004521 3300042014 Bacteria 3610
145 Ga0439457_044425 3300042014 Bacteria 992
146 Ga0439462_0005386 3300042015 Bacteria 3154
147 Ga0450894_000764 3300042131 Bacteria 5262
148 Ga0450896_012448 3300042133 Bacteria 1204
149 Ga0450898_027235 3300042134 Bacteria 1033
150 Ga0450899_008064 3300042135 Bacteria 1151
151 Ga0450900_003511 3300042136 Bacteria 1744
152 Ga0450903_000411 3300042138 Bacteria 9200
153 Ga0439458_0001037 3300042157 Bacteria 7094
154 Ga0450908_007024 3300042184 Bacteria 2131
155 Ga0466969_0000620 3300044656 Bacteria 19233
156 Ga0466969_0000813 3300044656 Bacteria 16963
157 Ga0466969_0028351 3300044656 Bacteria 2862
158 Ga0466969_0063958 3300044656 Bacteria 1782
159 Ga0466972_0005097 3300044658 Bacteria 6581
160 Ga0466972_0009735 3300044658 Bacteria 4824
161 Ga0466972_0013665 3300044658 Bacteria 4073
162 Ga0466966_0000546 3300044684 Bacteria 23991
163 Ga0466966_0002337 3300044684 Bacteria 12374
164 Ga0466966_0005998 3300044684 Bacteria 8021
165 Ga0466966_0008357 3300044684 Bacteria 6856
166 Ga0466966_0009710 3300044684 Bacteria 6373
167 Ga0466966_0210229 3300044684 Bacteria 1176
168 Ga0466961_0000215 3300044693 Bacteria 38990
169 Ga0466961_0001323 3300044693 Bacteria 15293
170 Ga0466961_0004031 3300044693 Bacteria 9202
171 Ga0466961_0005927 3300044693 Bacteria 7746
172 Ga0466961_0006299 3300044693 Bacteria 7535
173 Ga0466961_0347808 3300044693 Bacteria 902
174 Ga0466963_0018813 3300044694 Bacteria 4324
175 Ga0466963_0044503 3300044694 Bacteria 2922
176 Ga0466963_0107390 3300044694 Bacteria 1914
177 Ga0466964_0058630 3300044706 Bacteria 1597
178 Ga0453684_0082756 3300044712 Bacteria 3997
179 Ga0466971_0000053 3300044719 Bacteria 44476
180 Ga0466971_0000518 3300044719 Bacteria 15232
181 Ga0466971_0026193 3300044719 Bacteria 2605
182 Ga0466971_0080152 3300044719 Bacteria 1488
183 Ga0466971_0093439 3300044719 Bacteria 1378
184 Ga0466971_0140005 3300044719 Bacteria 1126
185 Ga0466971_0197481 3300044719 Bacteria 949
186 Ga0466968_0057304 3300044735 Bacteria 1675
187 Ga0466970_0000657 3300044765 Bacteria 16987
188 Ga0466970_0042778 3300044765 Bacteria 2409
189 Ga0466970_0086650 3300044765 Bacteria 1697
190 Ga0466970_0095024 3300044765 Bacteria 1620
191 Ga0466970_0141349 3300044765 Bacteria 1326
192 Ga0466957_0000445 3300044842 Bacteria 20385
193 Ga0466957_0233657 3300044842 Bacteria 1218
194 Ga0466957_0323302 3300044842 Bacteria 1041
195 Ga0466960_0154454 3300044901 Bacteria 1228
196 Ga0466959_0001391 3300045049 Bacteria 14794
197 Ga0466959_0001702 3300045049 Bacteria 13666
198 Ga0466959_0004565 3300045049 Bacteria 9292
199 Ga0466959_0067308 3300045049 Bacteria 2597
200 Ga0466959_0077885 3300045049 Bacteria 2391
201 Ga0466959_0502988 3300045049 Bacteria 819
202 Ga0466958_0001212 3300045836 Bacteria 12056
203 Ga0466967_0003250 3300045976 Bacteria 10522
204 Ga0466967_0012258 3300045976 Bacteria 6546
205 Ga0466967_0053846 3300045976 Bacteria 3538
206 Ga0466967_0062693 3300045976 Bacteria 3301
207 Ga0466967_0155038 3300045976 Bacteria 2144
208 Ga0466967_0467925 3300045976 Bacteria 1234
209 Ga0466967_0485319 3300045976 Bacteria 1211
210 Ga0495617_049038 3300046452 Bacteria 1405
211 Ga0495627_060065 3300046453 Bacteria 1127
212 Ga0495592_0008886 3300046454 Bacteria 7546
213 Ga0495592_0014548 3300046454 Bacteria 5971
214 Ga0495592_0032622 3300046454 Bacteria 3928
215 Ga0495592_0087646 3300046454 Bacteria 2238
216 Ga0495603_0004097 3300046455 Bacteria 8682
217 Ga0495603_0004551 3300046455 Bacteria 8270
218 Ga0495603_0009852 3300046455 Bacteria 5782
219 Ga0495603_0014035 3300046455 Bacteria 4843
220 Ga0495603_0024152 3300046455 Bacteria 3675
221 Ga0495629_0001340 3300046459 Bacteria 19372
222 Ga0495629_0004677 3300046459 Bacteria 10254
223 Ga0495629_0010237 3300046459 Bacteria 6831
224 Ga0495629_0013199 3300046459 Bacteria 5965
225 Ga0495629_0037180 3300046459 Bacteria 3431
226 Ga0495629_0074780 3300046459 Bacteria 2365
227 Ga0495629_0081004 3300046459 Bacteria 2266
228 Ga0495629_0092147 3300046459 Bacteria 2115
229 Ga0495629_0146447 3300046459 Bacteria 1642
230 Ga0495629_0279211 3300046459 Bacteria 1146
231 Ga0495638_0074582 3300046460 Bacteria 2069
232 Ga0495651_0002457 3300046462 Bacteria 14322
233 Ga0495651_0002478 3300046462 Bacteria 14264
234 Ga0495651_0030452 3300046462 Bacteria 4208
235 Ga0495651_0059137 3300046462 Bacteria 2940
236 Ga0495651_0181924 3300046462 Bacteria 1487
237 Ga0495580_0131326 3300046472 Bacteria 1737
238 Ga0495582_0085577 3300046473 Bacteria 1754
239 Ga0495605_0014355 3300046474 Bacteria 4343
240 Ga0495639_0010002 3300046475 Bacteria 4076
241 Ga0495662_0000647 3300046476 Bacteria 16321
242 Ga0495662_0024342 3300046476 Bacteria 2921
243 Ga0495662_0228514 3300046476 Bacteria 917
244 Ga0495664_0000608 3300046477 Bacteria 18170
245 Ga0495664_0097545 3300046477 Bacteria 1769
246 Ga0495584_0250682 3300046491 Bacteria 900
247 Ga0495585_0115096 3300046492 Bacteria 1427
248 Ga0495585_0207872 3300046492 Bacteria 993
249 Ga0495594_0022251 3300046499 Bacteria 3389
250 Ga0495594_0039697 3300046499 Bacteria 2574
251 Ga0495594_0075203 3300046499 Bacteria 1882
252 Ga0495594_0077271 3300046499 Bacteria 1857
253 Ga0495596_0090269 3300046500 Bacteria 1189
254 Ga0495607_0093270 3300046501 Bacteria 1627
255 Ga0495583_0032979 3300046506 Bacteria 2494
256 Ga0495606_0041372 3300046507 Bacteria 3090
257 Ga0495608_0014062 3300046511 Bacteria 5554
258 Ga0495608_0049973 3300046511 Bacteria 2775
259 Ga0495610_0025761 3300046512 Bacteria 3150
260 Ga0495618_0017099 3300046514 Bacteria 4445
261 Ga0495620_0032968 3300046515 Bacteria 2355
262 Ga0495628_0009319 3300046516 Bacteria 8387
263 Ga0495628_0012239 3300046516 Bacteria 7232
264 Ga0495628_0036966 3300046516 Bacteria 3916
265 Ga0495628_0079239 3300046516 Bacteria 2554
266 Ga0495628_0131908 3300046516 Bacteria 1910
267 Ga0495628_0291206 3300046516 Bacteria 1210
268 Ga0495630_0052043 3300046517 Bacteria 3065
269 Ga0495631_0054765 3300046518 Bacteria 1738
270 Ga0495643_0014519 3300046522 Bacteria 4684
271 Ga0495643_0030805 3300046522 Bacteria 2991
272 Ga0495643_0117266 3300046522 Bacteria 1348
273 Ga0495648_0100000 3300046524 Bacteria 1603
274 Ga0495666_0006850 3300046526 Bacteria 5722
275 Ga0495666_0050809 3300046526 Bacteria 1992
276 Ga0495666_0095076 3300046526 Bacteria 1405
277 Ga0495652_0000504 3300046529 Bacteria 45501
278 Ga0495652_0001421 3300046529 Bacteria 26571
279 Ga0495652_0044672 3300046529 Bacteria 3813
280 Ga0495652_0124798 3300046529 Bacteria 2047
281 Ga0495652_0309956 3300046529 Bacteria 1144
282 Ga0495652_0358666 3300046529 Bacteria 1042
283 Ga0495654_0029354 3300046530 Bacteria 2805
284 Ga0495665_0106201 3300046531 Bacteria 1473
285 Ga0495640_0010045 3300046533 Bacteria 7337
286 Ga0495640_0011506 3300046533 Bacteria 6807
287 Ga0495640_0099233 3300046533 Bacteria 1913
288 Ga0495640_0123022 3300046533 Bacteria 1684
289 Ga0495586_0013685 3300046535 Bacteria 4305
290 Ga0495586_0036608 3300046535 Bacteria 2634
291 Ga0495587_0001767 3300046536 Bacteria 14453
292 Ga0495609_0017242 3300046538 Bacteria 3355
293 Ga0495609_0124664 3300046538 Bacteria 1106
294 Ga0495597_0124072 3300046542 Bacteria 1075
295 Ga0495645_0016066 3300046543 Bacteria 5337
296 Ga0495645_0032330 3300046543 Bacteria 3816
297 Ga0495645_0071115 3300046543 Bacteria 2509
298 Ga0495645_0176908 3300046543 Bacteria 1465
299 Ga0495622_0056467 3300046557 Bacteria 1821
300 Ga0495622_0073878 3300046557 Bacteria 1572
301 Ga0495667_0013490 3300046559 Bacteria 5529
302 Ga0495667_0070270 3300046559 Bacteria 2284
303 Ga0495667_0365434 3300046559 Bacteria 911
304 Ga0495668_0135575 3300046616 Bacteria 1347
305 Ga0495634_0017020 3300046642 Bacteria 5192
306 Ga0495634_0032902 3300046642 Bacteria 3563
307 Ga0495634_0201870 3300046642 Bacteria 1235
308 Ga0495611_0072611 3300046648 Bacteria 1575
309 Ga0495611_0094371 3300046648 Bacteria 1384
310 Ga0495625_0003655 3300046660 Bacteria 15074
311 Ga0495625_0054320 3300046660 Bacteria 2861
312 Ga0495635_0002320 3300046663 Bacteria 12930
313 Ga0495635_0006051 3300046663 Bacteria 8440
314 Ga0495635_0032274 3300046663 Bacteria 3633
315 Ga0495661_0195565 3300046665 Bacteria 1062
316 Ga0495588_0001021 3300046674 Bacteria 12163
317 Ga0495588_0002959 3300046674 Bacteria 7337
318 Ga0495588_0135206 3300046674 Bacteria 1301
319 Ga0495657_0004925 3300046675 Bacteria 10624
320 Ga0495657_0006104 3300046675 Bacteria 9445
321 Ga0495657_0171162 3300046675 Bacteria 1337
322 Ga0495657_0215411 3300046675 Bacteria 1166
323 Ga0495599_0056230 3300046678 Bacteria 2462
324 Ga0495599_0198710 3300046678 Bacteria 1232
325 Ga0495623_0040330 3300046679 Bacteria 2981
326 Ga0495623_0081719 3300046679 Bacteria 1998
327 Ga0495623_0175534 3300046679 Bacteria 1249
328 Ga0495646_0011440 3300046680 Bacteria 5635
329 Ga0495646_0018236 3300046680 Bacteria 4444
330 Ga0495613_0005912 3300046689 Bacteria 9159
331 Ga0495613_0007790 3300046689 Bacteria 7968
332 Ga0495613_0012202 3300046689 Bacteria 6385
333 Ga0495613_0014412 3300046689 Bacteria 5868
334 Ga0495613_0089623 3300046689 Bacteria 2228
335 Ga0495613_0178959 3300046689 Bacteria 1502
336 Ga0495613_0206598 3300046689 Bacteria 1382
337 Ga0495613_0360821 3300046689 Bacteria 996
338 Ga0495624_0017471 3300046690 Bacteria 4817
339 Ga0495624_0031151 3300046690 Bacteria 3471
340 Ga0495670_0024234 3300046691 Bacteria 2999
341 Ga0495670_0181233 3300046691 Bacteria 1112
342 Ga0495671_0007615 3300046692 Bacteria 6154
343 Ga0495649_0104337 3300046694 Bacteria 1505
344 Ga0495589_0019341 3300046794 Bacteria 3493
345 Ga0495589_0038574 3300046794 Bacteria 2390
346 Ga0495589_0153333 3300046794 Bacteria 1099
347 Ga0495600_0011047 3300046809 Bacteria 5619
348 Ga0495600_0048952 3300046809 Bacteria 2757
349 Ga0495600_0143823 3300046809 Bacteria 1546
350 Ga0495581_0097800 3300047315 Bacteria 1705
351 Ga0495604_0000946 3300047317 Bacteria 24219
352 Ga0495604_0035305 3300047317 Bacteria 3948
353 Ga0495604_0037168 3300047317 Bacteria 3837
354 Ga0495636_0018650 3300047318 Bacteria 2784
355 Ga0495674_0224943 3300047319 Bacteria 1550
356 Ga0495674_0426729 3300047319 Bacteria 1067
357 Ga0495672_0215723 3300047320 Bacteria 950
358 Ga0495676_0000760 3300047321 Bacteria 26888
359 Ga0495676_0002333 3300047321 Bacteria 16821
360 Ga0495676_0002484 3300047321 Bacteria 16405
361 Ga0495676_0006534 3300047321 Bacteria 10743
362 Ga0495676_0042159 3300047321 Bacteria 3749
363 Ga0495680_0003973 3300047322 Bacteria 14286
364 Ga0495683_0044453 3300047323 Bacteria 2233
365 Ga0495683_0062407 3300047323 Bacteria 1844
366 Ga0495687_001311 3300047443 Bacteria 23302
367 Ga0495687_001496 3300047443 Bacteria 21346
368 Ga0495687_013749 3300047443 Bacteria 4203
369 Ga0495687_040135 3300047443 Bacteria 2064
370 Ga0495687_091398 3300047443 Bacteria 1164
371 Ga0495687_094230 3300047443 Bacteria 1139
372 Ga0495675_0016679 3300047444 Bacteria 4644
373 Ga0495675_0023080 3300047444 Bacteria 3964
374 Ga0495675_0042980 3300047444 Bacteria 2879
375 Ga0495679_029928 3300047446 Bacteria 1772
376 Ga0495685_014534 3300047447 Bacteria 2676
377 Ga0495685_027558 3300047447 Bacteria 1954
378 Ga0495685_051592 3300047447 Bacteria 1394
379 Ga0495685_081065 3300047447 Bacteria 1080
380 Ga0495681_0001659 3300047470 Bacteria 16506
381 Ga0495681_0047111 3300047470 Bacteria 2052
382 Ga0495684_0116919 3300047471 Bacteria 2010
383 Ga0495686_0020812 3300047472 Bacteria 4371
384 Ga0495686_0253400 3300047472 Bacteria 988
385 Ga0495593_0001823 3300047673 Bacteria 12670
386 Ga0495593_0018422 3300047673 Bacteria 3922
387 Ga0495593_0056066 3300047673 Bacteria 2072
388 Ga0495602_0087937 3300048088 Bacteria 2588
389 Ga0495602_0100561 3300048088 Bacteria 2374
390 Ga0495602_0194049 3300048088 Bacteria 1554
391 Ga0495614_0008038 3300048089 Bacteria 4688
392 Ga0495614_0010658 3300048089 Bacteria 4051
393 Ga0495614_0026010 3300048089 Bacteria 2522
394 Ga0495614_0056097 3300048089 Bacteria 1690
395 Ga0495626_0074772 3300048091 Bacteria 1515
396 Ga0496102_0028488 3300048905 Bacteria 4989
397 Ga0496103_0005070 3300048906 Bacteria 7938
398 Ga0496107_0264484 3300048910 Bacteria 1280
399 Ga0496108_0198234 3300048911 Bacteria 1742
400 Ga0496108_0284679 3300048911 Bacteria 1439
401 Ga0496109_0087551 3300048912 Bacteria 2877
402 Ga0496109_0276248 3300048912 Bacteria 1583
403 Ga0496114_0018691 3300048917 Bacteria 5608
404 Ga0496114_0125690 3300048917 Bacteria 2210
405 Ga0501031_0002776 3300049568 Bacteria 11152
406 Ga0501031_0022707 3300049568 Bacteria 4090
407 Ga0501031_0401415 3300049568 Bacteria 886
408 Ga0501032_0005717 3300049569 Bacteria 9206
409 Ga0501032_0006643 3300049569 Bacteria 8489
410 Ga0501032_0022210 3300049569 Bacteria 4401
411 Ga0501032_0050333 3300049569 Bacteria 2809
412 Ga0501032_0218778 3300049569 Bacteria 1240
413 Ga0501033_0000756 3300049570 Bacteria 29733
414 Ga0501033_0000947 3300049570 Bacteria 26325
415 Ga0501033_0004830 3300049570 Bacteria 10754
416 Ga0501033_0006391 3300049570 Bacteria 9230
417 Ga0501033_0008120 3300049570 Bacteria 8130
418 Ga0501033_0018961 3300049570 Bacteria 5200
419 Ga0501033_0021640 3300049570 Bacteria 4852
420 Ga0501033_0133536 3300049570 Unclassified 1797
421 Ga0501034_0001075 3300049571 Bacteria 38694
422 Ga0501034_0002496 3300049571 Bacteria 22077
423 Ga0501034_0013124 3300049571 Bacteria 8538
424 Ga0501034_0020830 3300049571 Bacteria 6691
425 Ga0501034_0100524 3300049571 Bacteria 2886
426 Ga0501034_0111796 3300049571 Bacteria 2722
427 Ga0501034_0118067 3300049571 Bacteria 2640
428 Ga0501036_0000417 3300049572 Bacteria 30022
429 Ga0501036_0003255 3300049572 Bacteria 12949
430 Ga0501036_0012777 3300049572 Bacteria 6965
431 Ga0501036_0022966 3300049572 Bacteria 5251
432 Ga0501036_0023130 3300049572 Bacteria 5232
433 Ga0501036_0030468 3300049572 Bacteria 4556
434 Ga0501036_0058239 3300049572 Bacteria 3273
435 Ga0501036_0100969 3300049572 Bacteria 2440
436 Ga0501036_0228721 3300049572 Bacteria 1561
437 Ga0501036_0523082 3300049572 Bacteria 986
438 Ga0501037_0000553 3300049573 Bacteria 29785
439 Ga0501037_0141837 3300049573 Bacteria 1719
440 Ga0501037_0147737 3300049573 Bacteria 1681
441 Ga0501037_0243003 3300049573 Bacteria 1261
442 Ga0501038_0001453 3300049574 Bacteria 21771
443 Ga0501038_0009098 3300049574 Bacteria 9115
444 Ga0501038_0049443 3300049574 Bacteria 3635
445 Ga0501038_0054062 3300049574 Bacteria 3454
446 Ga0501038_0114855 3300049574 Bacteria 2226
447 Ga0501038_0211114 3300049574 Bacteria 1553
448 Ga0501038_0211906 3300049574 Bacteria 1549
449 Ga0501038_0303996 3300049574 Bacteria 1251
450 Ga0501039_0007781 3300049575 Bacteria 8173
451 Ga0501039_0043544 3300049575 Bacteria 3467
452 Ga0501039_0083080 3300049575 Bacteria 2494
453 Ga0501039_0111438 3300049575 Bacteria 2139
454 Ga0501039_0304536 3300049575 Bacteria 1253
455 Ga0501039_0395535 3300049575 Bacteria 1085
456 Ga0501039_0499388 3300049575 Bacteria 955
457 Ga0501040_0005142 3300049576 Bacteria 8461
458 Ga0501040_0007045 3300049576 Bacteria 7287
459 Ga0501040_0013257 3300049576 Bacteria 5421
460 Ga0501041_0000587 3300049577 Bacteria 18994
461 Ga0501041_0006679 3300049577 Bacteria 6758
462 Ga0501042_0000391 3300049578 Bacteria 22243
463 Ga0501042_0026297 3300049578 Bacteria 4091
464 Ga0501042_0095974 3300049578 Bacteria 2130
465 Ga0501042_0172560 3300049578 Bacteria 1560
466 Ga0501043_0001506 3300049579 Bacteria 20343
467 Ga0501043_0006947 3300049579 Bacteria 9020
468 Ga0501043_0010866 3300049579 Bacteria 7129
469 Ga0501043_0024986 3300049579 Bacteria 4688
470 Ga0501043_0045422 3300049579 Bacteria 3455
471 Ga0501043_0068120 3300049579 Bacteria 2794
472 Ga0501043_0087598 3300049579 Bacteria 2447
473 Ga0501043_0214168 3300049579 Bacteria 1492
474 Ga0501043_0254592 3300049579 Bacteria 1352
475 Ga0501043_0288143 3300049579 Bacteria 1257
476 Ga0501043_0384681 3300049579 Bacteria 1062
477 Ga0501046_0002619 3300049580 Bacteria 16807
478 Ga0501046_0003032 3300049580 Bacteria 15523
479 Ga0501046_0011543 3300049580 Bacteria 7554
480 Ga0501046_0036282 3300049580 Bacteria 3968
481 Ga0501046_0044959 3300049580 Bacteria 3510
482 Ga0501046_0118678 3300049580 Bacteria 2014
483 Ga0501046_0399183 3300049580 Bacteria 993
484 Ga0501046_0573811 3300049580 Bacteria 802
485 Ga0501047_0000013 3300049581 Bacteria 364111
486 Ga0501047_0000046 3300049581 Bacteria 170205
487 Ga0501047_0007655 3300049581 Bacteria 10172
488 Ga0501047_0016937 3300049581 Bacteria 6967
489 Ga0501047_0056927 3300049581 Bacteria 3781
490 Ga0501047_0172582 3300049581 Bacteria 2031
491 Ga0501047_0173560 3300049581 Bacteria 2024
492 Ga0501047_0206096 3300049581 Bacteria 1826
493 Ga0501047_0247542 3300049581 Bacteria 1631
494 Ga0501047_0592813 3300049581 Bacteria 930
495 Ga0501048_0002110 3300049582 Bacteria 15156
496 Ga0501048_0005468 3300049582 Bacteria 9664
497 Ga0501048_0021525 3300049582 Bacteria 4722
498 Ga0501048_0048665 3300049582 Bacteria 3023
499 Ga0501048_0071267 3300049582 Bacteria 2453
500 Ga0501048_0120071 3300049582 Bacteria 1857
501 Ga0501067_0000136 3300049583 Bacteria 40150
502 Ga0501067_0004793 3300049583 Bacteria 7501
503 Ga0501068_0012877 3300049584 Bacteria 4751
504 Ga0501068_0017283 3300049584 Bacteria 4170
505 Ga0501068_0222594 3300049584 Bacteria 1199
506 Ga0501069_0003792 3300049585 Bacteria 7778
507 Ga0501069_0144057 3300049585 Bacteria 1368
508 Ga0501069_0169376 3300049585 Bacteria 1259
509 Ga0501070_0000009 3300049586 Bacteria 197868
510 Ga0501070_0001543 3300049586 Bacteria 20487
511 Ga0501070_0001654 3300049586 Bacteria 19763
512 Ga0501070_0008182 3300049586 Bacteria 8844
513 Ga0501070_0051885 3300049586 Bacteria 3404
514 Ga0501070_0584674 3300049586 Bacteria 891
515 Ga0501071_0003427 3300049587 Bacteria 9904
516 Ga0501071_0003832 3300049587 Bacteria 9463
517 Ga0501071_0119115 3300049587 Bacteria 1956
518 Ga0501072_0000193 3300049588 Bacteria 44363
519 Ga0501072_0000511 3300049588 Bacteria 27865
520 Ga0501072_0058347 3300049588 Bacteria 3042
521 Ga0501073_0009102 3300049589 Bacteria 7329
522 Ga0501073_0023600 3300049589 Bacteria 4414
523 Ga0501073_0173873 3300049589 Bacteria 1491
524 Ga0501073_0262036 3300049589 Bacteria 1193
525 Ga0501074_0003198 3300049590 Bacteria 11550
526 Ga0501074_0006914 3300049590 Bacteria 8191
527 Ga0501074_0013819 3300049590 Bacteria 5872
528 Ga0501074_0017558 3300049590 Bacteria 5194
529 Ga0501075_0008964 3300049591 Bacteria 6979
530 Ga0501075_0027048 3300049591 Bacteria 4226
531 Ga0501075_0336356 3300049591 Unclassified 1151
532 Ga0501076_0002833 3300049592 Bacteria 11989
533 Ga0501076_0004537 3300049592 Bacteria 9893
534 Ga0501077_0001954 3300049593 Bacteria 12487
535 Ga0501077_0119944 3300049593 Bacteria 1666
536 Ga0501077_0137629 3300049593 Bacteria 1548
537 Ga0501257_046834 3300049686 Bacteria 1072
538 Ga0501079_0000833 3300049741 Bacteria 20970
539 Ga0501079_0001173 3300049741 Bacteria 18345
540 Ga0501079_0001551 3300049741 Bacteria 16278
541 Ga0501079_0011384 3300049741 Bacteria 6789
542 Ga0501080_0000794 3300049742 Bacteria 25798
543 Ga0501080_0021091 3300049742 Bacteria 6031
544 Ga0501080_0036161 3300049742 Bacteria 4610
545 Ga0501080_0071279 3300049742 Bacteria 3232
546 Ga0501080_0076461 3300049742 Bacteria 3113
547 Ga0501080_0077242 3300049742 Bacteria 3097
548 Ga0501080_0084329 3300049742 Bacteria 2952
549 Ga0501080_0096633 3300049742 Bacteria 2743
550 Ga0501080_0643634 3300049742 Bacteria 938
551 Ga0501081_0032752 3300049743 Bacteria 3527
552 Ga0501083_0000503 3300049744 Bacteria 24974
553 Ga0501083_0035706 3300049744 Bacteria 3394
554 Ga0501083_0036624 3300049744 Bacteria 3346
555 Ga0501083_0049746 3300049744 Bacteria 2824
556 Ga0501083_0067350 3300049744 Bacteria 2384
557 Ga0501083_0093264 3300049744 Bacteria 1987
558 Ga0501035_0000936 3300049822 Bacteria 30815
559 Ga0501035_0003520 3300049822 Bacteria 14966
560 Ga0501035_0009974 3300049822 Bacteria 8815
561 Ga0501035_0013864 3300049822 Bacteria 7439
562 Ga0501035_0042647 3300049822 Bacteria 4092
563 Ga0501035_0057006 3300049822 Bacteria 3483
564 Ga0501035_0084387 3300049822 Bacteria 2801
565 Ga0501035_0116022 3300049822 Bacteria 2343
566 Ga0501035_0246792 3300049822 Bacteria 1517
567 Ga0501035_0529211 3300049822 Bacteria 967
568 Ga0501044_0001273 3300049823 Bacteria 29785
569 Ga0501044_0006283 3300049823 Bacteria 13129
570 Ga0501044_0011385 3300049823 Bacteria 9633
571 Ga0501044_0032261 3300049823 Bacteria 5507
572 Ga0501044_0074534 3300049823 Bacteria 3447
573 Ga0501044_0074911 3300049823 Bacteria 3437
574 Ga0501044_0208478 3300049823 Bacteria 1909
575 Ga0501044_0227882 3300049823 Bacteria 1812
576 Ga0501044_0236615 3300049823 Bacteria 1771
577 Ga0501044_0315008 3300049823 Bacteria 1490
578 Ga0501044_0651565 3300049823 Bacteria 942
579 Ga0501045_0041628 3300049824 Bacteria 3342
580 Ga0501045_0049203 3300049824 Unclassified 3073
581 Ga0501045_0154011 3300049824 Bacteria 1710
582 Ga0501045_0282654 3300049824 Bacteria 1235
583 Ga0501045_0376192 3300049824 Bacteria 1057
584 Ga0501045_0610335 3300049824 Bacteria 807
585 nmdc:mga03n38_29807_c1 3300050490 Bacteria 2287
586 nmdc:mga06z11_2553_c1 3300050494 Bacteria 6963
587 nmdc:mga0qj67_257823_c1 3300050509 Bacteria 1415
588 nmdc:mga0qj67_281470_c1 3300050509 Bacteria 1348
589 nmdc:mga06r32_170736_c1 3300050510 Bacteria 2159
590 nmdc:mga06r32_374620_c1 3300050510 Bacteria 1407
591 nmdc:mga06r32_375588_c1 3300050510 Bacteria 1405
592 nmdc:mga08y16_64062_c1 3300050511 Bacteria 3839
593 Ga0495601_0000180 3300053077 Bacteria 33436
594 Ga0495601_0017579 3300053077 Bacteria 4343
595 Ga0495601_0202654 3300053077 Bacteria 1296
596 Ga0495612_0001522 3300053078 Bacteria 9541
597 Ga0495612_0004105 3300053078 Bacteria 6036
598 Ga0495612_0006956 3300053078 Bacteria 4629
599 Ga0495612_0133132 3300053078 Bacteria 1075
600 Ga0500610_0124468 3300053079 Bacteria 1316
601 Ga0495619_0113402 3300053085 Bacteria 1854
602 Ga0495619_0444373 3300053085 Bacteria 894
603 Ga0500640_000514 3300053095 Bacteria 9693
604 Ga0500654_119600 3300053099 Bacteria 1042
605 Ga0500553_055909 3300053101 Bacteria 1873
606 Ga0500560_002042 3300053107 Bacteria 3738
607 Ga0500560_065651 3300053107 Bacteria 1189
608 Ga0500572_094231 3300053111 Bacteria 952
609 Ga0500628_005383 3300053129 Bacteria 2135
610 Ga0500652_059054 3300053131 Bacteria 1576
611 Ga0500573_0027859 3300053140 Bacteria 3251
612 Ga0500634_0101469 3300053161 Bacteria 1439
613 Ga0500656_003980 3300053732 Bacteria 1408
614 Ga0500587_009371 3300053739 Bacteria 1251
615 Ga0501084_0000007 3300054114 Bacteria 215126
616 Ga0501084_0004469 3300054114 Bacteria 11418
617 Ga0501084_0343108 3300054114 Bacteria 1261
618 Ga0501084_0545772 3300054114 Bacteria 979
619 Ga0501082_0001044 3300060353 Bacteria 24497
620 Ga0501082_0011336 3300060353 Bacteria 7663
621 Ga0501082_0012989 3300060353 Bacteria 7159
622 Ga0501082_0017005 3300060353 Bacteria 6263
623 Ga0501082_0025004 3300060353 Bacteria 5144
624 Ga0501082_0164712 3300060353 Bacteria 1927
625 Ga0466962_0000145 3300061719 Bacteria 29261
626 Ga0466962_0003454 3300061719 Bacteria 7532
627 Ga0530510_0000789 3300061734 Bacteria 20601
628 Ga0530510_0423875 3300061734 Bacteria 1004

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049580 Ga0501046_0573811 Ga0501046_0573811_116_757 213
2 3300045049 Ga0466959_0502988 Ga0466959_0502988_149_805 218
3 3300049742 Ga0501080_0096633 Ga0501080_0096633_366_1106 233
4 3300005937 Ga0081455_10003831 Ga0081455_100038315 238
5 iso_pu_bacteria 2862382967 2862388768 238
6 3300049742 Ga0501080_0643634 Ga0501080_0643634_41_760 239
7 3300044712 Ga0453684_0082756 Ga0453684_0082756_1381_2187 241
8 3300049571 Ga0501034_0118067 Ga0501034_0118067_36_764 242
9 3300005343 Ga0070687_100010814 Ga0070687_1000108144 243
10 3300005544 Ga0070686_100034779 Ga0070686_1000347793 243
11 3300005841 Ga0068863_100059863 Ga0068863_1000598633 243
12 3300025918 Ga0207662_10003833 Ga0207662_100038337 243
13 3300026088 Ga0207641_10048002 Ga0207641_100480024 243
14 3300049570 Ga0501033_0018961 Ga0501033_0018961_761_1543 247
15 3300049574 Ga0501038_0211114 Ga0501038_0211114_114_896 247
16 3300049575 Ga0501039_0083080 Ga0501039_0083080_60_842 247
17 3300049576 Ga0501040_0007045 Ga0501040_0007045_2691_3473 247
18 3300049578 Ga0501042_0095974 Ga0501042_0095974_413_1195 247
19 3300049579 Ga0501043_0384681 Ga0501043_0384681_195_977 247
20 3300049580 Ga0501046_0044959 Ga0501046_0044959_2598_3380 247
21 3300049582 Ga0501048_0048665 Ga0501048_0048665_2057_2839 247
22 3300049587 Ga0501071_0119115 Ga0501071_0119115_269_1051 247
23 3300049591 Ga0501075_0027048 Ga0501075_0027048_2978_3760 247
24 3300049593 Ga0501077_0119944 Ga0501077_0119944_232_1014 247
25 3300049741 Ga0501079_0011384 Ga0501079_0011384_4379_5161 247
26 3300049744 Ga0501083_0067350 Ga0501083_0067350_1193_1975 247
27 3300049824 Ga0501045_0041628 Ga0501045_0041628_488_1270 247
28 3300060353 Ga0501082_0012989 Ga0501082_0012989_3325_4107 247
29 3300049591 Ga0501075_0336356 Ga0501075_0336356_167_946 249
30 3300005330 Ga0070690_100072576 Ga0070690_1000725762 252
31 3300009147 Ga0114129_10519992 Ga0114129_105199922 252
32 3300035083 Ga0373926_0001812 Ga0373926_0001812_2672_3430 252
33 3300049570 Ga0501033_0133536 Ga0501033_0133536_821_1579 252
34 3300049572 Ga0501036_0058239 Ga0501036_0058239_286_1044 252
35 3300049575 Ga0501039_0111438 Ga0501039_0111438_403_1161 252
36 3300049575 Ga0501039_0395535 Ga0501039_0395535_44_802 252
37 3300049579 Ga0501043_0254592 Ga0501043_0254592_506_1276 252
38 3300049824 Ga0501045_0376192 Ga0501045_0376192_140_898 252
39 iso_pu_bacteria 2862574272 2862577652 254
40 iso_pu_bacteria 2867428634 2867435349 254
41 3300006844 Ga0075428_100082440 Ga0075428_1000824403 255
42 3300034818 Ga0373950_0000055 Ga0373950_0000055_17192_17959 255
43 3300049572 Ga0501036_0012777 Ga0501036_0012777_2403_3170 255
44 3300049572 Ga0501036_0523082 Ga0501036_0523082_183_950 255
45 3300049742 Ga0501080_0084329 Ga0501080_0084329_1484_2251 255
46 iso_pu_bacteria 2558860280 2559430978 255
47 3300014497 Ga0182008_10004552 Ga0182008_100045526 256
48 iso_pu_bacteria 2643221601 2644019363 256
49 iso_pu_bacteria 2643221631 2644175249 256
50 iso_pu_bacteria 2802429296 2804847780 256
51 iso_pu_bacteria 2808606982 2811846541 256
52 iso_pu_bacteria 2818991472 2819744269 256
53 iso_pu_bacteria 2867475112 2867477632 256
54 iso_pu_bacteria 2912757875 2912762624 256
55 iso_pu_bacteria 2919391150 2919391282 256
56 iso_pu_bacteria 2945956166 2945959700 256
57 iso_pu_bacteria 2997451912 2997453201 256
58 iso_pu_bacteria 8025413630 8025414705 256
59 iso_pu_bacteria 8025530807 8025531469 256
60 iso_pu_bacteria 8056447290 8056447735 256
61 3300031238 Ga0265332_10055323 Ga0265332_100553232 257
62 3300031240 Ga0265320_10008949 Ga0265320_100089492 257
63 3300031595 Ga0265313_10035055 Ga0265313_100350552 257
64 3300031711 Ga0265314_10063598 Ga0265314_100635982 257
65 3300044684 Ga0466966_0210229 Ga0466966_0210229_324_1097 257
66 3300049589 Ga0501073_0173873 Ga0501073_0173873_55_828 257
67 iso_pu_bacteria 2547132111 2547408510 257
68 iso_pu_bacteria 2554235005 2554256339 257
69 iso_pu_bacteria 2582581312 2585296468 257
70 iso_pu_bacteria 2582581313 2585311189 257
71 iso_pu_bacteria 2582581314 2585318606 257
72 iso_pu_bacteria 2616644814 2616697170 257
73 iso_pu_bacteria 2616644941 2616900043 257
74 iso_pu_bacteria 2643221548 2643763872 257
75 iso_pu_bacteria 2643221587 2643946291 257
76 iso_pu_bacteria 2643221647 2644265938 257
77 iso_pu_bacteria 2643221670 2644386768 257
78 iso_pu_bacteria 2643221677 2644433080 257
79 iso_pu_bacteria 2643221678 2644439899 257
80 iso_pu_bacteria 2643221682 2644461694 257
81 iso_pu_bacteria 2643221714 2644632770 257
82 iso_pu_bacteria 2784132148 2784590282 257
83 iso_pu_bacteria 2784746763 2785341332 257
84 iso_pu_bacteria 2784746768 2785371350 257
85 iso_pu_bacteria 2786546132 2786672542 257
86 iso_pu_bacteria 2808606359 2808843906 257
87 iso_pu_bacteria 2808606375 2808913462 257
88 iso_pu_bacteria 2808606448 2809233956 257
89 iso_pu_bacteria 2811994879 2812356121 257
90 iso_pu_bacteria 2811994917 2812478893 257
91 iso_pu_bacteria 2818991463 2819694743 257
92 iso_pu_bacteria 2852635781 2852640876 257
93 iso_pu_bacteria 2862178590 2862179084 257
94 iso_pu_bacteria 2862281513 2862284892 257
95 iso_pu_bacteria 2862507626 2862513348 257
96 iso_pu_bacteria 2863404153 2863408478 257
97 iso_pu_bacteria 2873151551 2873154177 257
98 iso_pu_bacteria 2875391855 2875396566 257
99 iso_pu_bacteria 2877676314 2877679249 257
100 iso_pu_bacteria 2912715099 2912717851 257
101 iso_pu_bacteria 2912723979 2912730285 257
102 iso_pu_bacteria 2918501144 2918506366 257
103 iso_pu_bacteria 2919468124 2919471587 257
104 iso_pu_bacteria 2946064051 2946069727 257
105 iso_pu_bacteria 2946072368 2946077614 257
106 iso_pu_bacteria 2947224130 2947227069 257
107 iso_pu_bacteria 2954002825 2954005326 257
108 iso_pu_bacteria 2954380949 2954384137 257
109 iso_pu_bacteria 2954673503 2954678814 257
110 iso_pu_bacteria 2954682443 2954685338 257
111 iso_pu_bacteria 2954691527 2954694957 257
112 iso_pu_bacteria 2954701450 2954710134 257
113 iso_pu_bacteria 2954711539 2954714453 257
114 iso_pu_bacteria 2954721474 2954724399 257
115 iso_pu_bacteria 2954731030 2954737419 257
116 iso_pu_bacteria 2954740390 2954743321 257
117 iso_pu_bacteria 2954749733 2954756273 257
118 iso_pu_bacteria 2954759201 2954762278 257
119 iso_pu_bacteria 2966598605 2966600977 257
120 iso_pu_bacteria 2990059506 2990064509 257
121 iso_pu_bacteria 2995463766 2995465155 257
122 iso_pu_bacteria 3006321560 3006323795 257
123 iso_pu_bacteria 3006493962 3006498125 257
124 iso_pu_bacteria 8008558824 8008562649 257
125 iso_pu_bacteria 8008574985 8008577294 257
126 iso_pu_bacteria 8023623736 8023627934 257
127 iso_pu_bacteria 8025413630 8025416662 257
128 iso_pu_bacteria 8025478263 8025481517 257
129 iso_pu_bacteria 8048406513 8048406593 257
130 iso_pu_bacteria 8056667051 8056671518 257
131 iso_pu_bacteria 8056829672 8056832017 257
132 3300025913 Ga0207695_10455356 Ga0207695_104553561 258
133 3300031249 Ga0265339_10014035 Ga0265339_100140352 258
134 3300031595 Ga0265313_10031218 Ga0265313_100312182 258
135 3300031711 Ga0265314_10003116 Ga0265314_1000311612 258
136 3300034818 Ga0373950_0000002 Ga0373950_0000002_797201_797977 258
137 3300035115 Ga0373941_0077365 Ga0373941_0077365_142_918 258
138 3300035691 Ga0373931_0011036 Ga0373931_0011036_1344_2120 258
139 3300035724 Ga0373933_0000142 Ga0373933_0000142_16538_17314 258
140 3300036401 Ga0373937_0005943 Ga0373937_0005943_5903_6679 258
141 3300049571 Ga0501034_0001075 Ga0501034_0001075_1238_2014 258
142 3300049574 Ga0501038_0303996 Ga0501038_0303996_429_1205 258
143 3300049579 Ga0501043_0214168 Ga0501043_0214168_688_1464 258
144 3300049580 Ga0501046_0003032 Ga0501046_0003032_13634_14410 258
145 3300049581 Ga0501047_0000013 Ga0501047_0000013_110471_111247 258
146 3300049582 Ga0501048_0071267 Ga0501048_0071267_159_935 258
147 3300049583 Ga0501067_0000136 Ga0501067_0000136_12329_13105 258
148 3300049584 Ga0501068_0012877 Ga0501068_0012877_2809_3585 258
149 3300049584 Ga0501068_0017283 Ga0501068_0017283_1131_1907 258
150 3300049585 Ga0501069_0003792 Ga0501069_0003792_5278_6054 258
151 3300049585 Ga0501069_0169376 Ga0501069_0169376_354_1130 258
152 3300049586 Ga0501070_0000009 Ga0501070_0000009_38682_39458 258
153 3300049586 Ga0501070_0001654 Ga0501070_0001654_4032_4808 258
154 3300049588 Ga0501072_0000193 Ga0501072_0000193_24959_25735 258
155 3300049589 Ga0501073_0009102 Ga0501073_0009102_5316_6092 258
156 3300049589 Ga0501073_0023600 Ga0501073_0023600_1088_1864 258
157 3300049590 Ga0501074_0006914 Ga0501074_0006914_2902_3678 258
158 3300049590 Ga0501074_0013819 Ga0501074_0013819_1344_2120 258
159 3300049590 Ga0501074_0017558 Ga0501074_0017558_4259_5035 258
160 3300049741 Ga0501079_0000833 Ga0501079_0000833_18957_19733 258
161 3300049742 Ga0501080_0000794 Ga0501080_0000794_7345_8121 258
162 3300049742 Ga0501080_0036161 Ga0501080_0036161_1170_1946 258
163 3300049742 Ga0501080_0071279 Ga0501080_0071279_1950_2726 258
164 3300049744 Ga0501083_0035706 Ga0501083_0035706_1159_1935 258
165 3300049744 Ga0501083_0049746 Ga0501083_0049746_705_1481 258
166 3300049744 Ga0501083_0093264 Ga0501083_0093264_98_874 258
167 3300054114 Ga0501084_0000007 Ga0501084_0000007_18808_19584 258
168 3300054114 Ga0501084_0545772 Ga0501084_0545772_189_965 258
169 3300060353 Ga0501082_0011336 Ga0501082_0011336_1534_2310 258
170 3300060353 Ga0501082_0017005 Ga0501082_0017005_3416_4192 258
171 3300060353 Ga0501082_0025004 Ga0501082_0025004_4035_4811 258
172 3300030521 Ga0307511_10000358 Ga0307511_100003586 259
173 3300035118 Ga0373954_0173989 Ga0373954_0173989_60_905 259
174 3300044656 Ga0466969_0000813 Ga0466969_0000813_11064_11843 259
175 3300044684 Ga0466966_0008357 Ga0466966_0008357_2289_3068 259
176 3300044684 Ga0466966_0009710 Ga0466966_0009710_4241_5020 259
177 3300044693 Ga0466961_0000215 Ga0466961_0000215_34710_35489 259
178 3300044693 Ga0466961_0001323 Ga0466961_0001323_5779_6558 259
179 3300044719 Ga0466971_0000053 Ga0466971_0000053_19463_20242 259
180 3300044765 Ga0466970_0042778 Ga0466970_0042778_636_1415 259
181 3300045049 Ga0466959_0001391 Ga0466959_0001391_9455_10234 259
182 3300045049 Ga0466959_0077885 Ga0466959_0077885_610_1389 259
183 3300046462 Ga0495651_0002457 Ga0495651_0002457_6717_7496 259
184 3300046514 Ga0495618_0017099 Ga0495618_0017099_184_963 259
185 3300046516 Ga0495628_0009319 Ga0495628_0009319_326_1105 259
186 3300049572 Ga0501036_0023130 Ga0501036_0023130_2976_3755 259
187 3300049576 Ga0501040_0013257 Ga0501040_0013257_754_1533 259
188 3300049577 Ga0501041_0000587 Ga0501041_0000587_10970_11749 259
189 3300049578 Ga0501042_0000391 Ga0501042_0000391_7071_7850 259
190 3300049579 Ga0501043_0087598 Ga0501043_0087598_353_1132 259
191 3300049580 Ga0501046_0011543 Ga0501046_0011543_2211_2990 259
192 3300049582 Ga0501048_0021525 Ga0501048_0021525_1618_2397 259
193 3300049587 Ga0501071_0003832 Ga0501071_0003832_2353_3132 259
194 3300049588 Ga0501072_0058347 Ga0501072_0058347_1509_2288 259
195 3300049591 Ga0501075_0008964 Ga0501075_0008964_2423_3202 259
196 3300049592 Ga0501076_0002833 Ga0501076_0002833_10957_11736 259
197 3300049593 Ga0501077_0001954 Ga0501077_0001954_10774_11553 259
198 3300049741 Ga0501079_0001173 Ga0501079_0001173_7190_7969 259
199 3300049742 Ga0501080_0021091 Ga0501080_0021091_2764_3543 259
200 3300049743 Ga0501081_0032752 Ga0501081_0032752_673_1452 259
201 3300049744 Ga0501083_0036624 Ga0501083_0036624_1221_2000 259
202 3300049822 Ga0501035_0246792 Ga0501035_0246792_570_1349 259
203 3300049824 Ga0501045_0049203 Ga0501045_0049203_974_1753 259
204 3300053077 Ga0495601_0000180 Ga0495601_0000180_26917_27696 259
205 3300053078 Ga0495612_0004105 Ga0495612_0004105_4968_5747 259
206 3300053078 Ga0495612_0006956 Ga0495612_0006956_3834_4613 259
207 3300054114 Ga0501084_0343108 Ga0501084_0343108_394_1173 259
208 3300060353 Ga0501082_0001044 Ga0501082_0001044_21475_22254 259
209 3300061719 Ga0466962_0000145 Ga0466962_0000145_4312_5091 259
210 3300061734 Ga0530510_0000789 Ga0530510_0000789_2576_3355 259
211 3300003373 JGI25407J50210_10000308 JGI25407J50210_100003086 260
212 3300005455 Ga0070663_100042554 Ga0070663_1000425541 260
213 3300005539 Ga0068853_100178766 Ga0068853_1001787662 260
214 3300005548 Ga0070665_100399942 Ga0070665_1003999422 260
215 3300005563 Ga0068855_100074440 Ga0068855_1000744403 260
216 3300005616 Ga0068852_100068287 Ga0068852_1000682873 260
217 3300005981 Ga0081538_10016788 Ga0081538_100167884 260
218 3300006058 Ga0075432_10024054 Ga0075432_100240542 260
219 3300006844 Ga0075428_100219394 Ga0075428_1002193942 260
220 3300006847 Ga0075431_100388037 Ga0075431_1003880372 260
221 3300009094 Ga0111539_10018042 Ga0111539_100180425 260
222 3300009174 Ga0105241_10030012 Ga0105241_100300123 260
223 3300009551 Ga0105238_10244509 Ga0105238_102445091 260
224 3300010375 Ga0105239_10139352 Ga0105239_101393523 260
225 3300010375 Ga0105239_10799907 Ga0105239_107999071 260
226 3300013105 Ga0157369_10264581 Ga0157369_102645812 260
227 3300025302 Ga0207426_1002333 Ga0207426_10023335 260
228 3300025302 Ga0207426_1004035 Ga0207426_10040355 260
229 3300025911 Ga0207654_10022550 Ga0207654_100225504 260
230 3300025913 Ga0207695_10051895 Ga0207695_100518953 260
231 3300025914 Ga0207671_10029288 Ga0207671_100292883 260
232 3300025924 Ga0207694_10033876 Ga0207694_100338762 260
233 3300025949 Ga0207667_10082521 Ga0207667_100825212 260
234 3300026118 Ga0207675_100462031 Ga0207675_1004620312 260
235 3300028379 Ga0268266_10284169 Ga0268266_102841691 260
236 3300028786 Ga0307517_10020199 Ga0307517_100201995 260
237 3300031507 Ga0307509_10044286 Ga0307509_100442862 260
238 3300031507 Ga0307509_10210542 Ga0307509_102105421 260
239 3300031548 Ga0307408_100218557 Ga0307408_1002185572 260
240 3300031548 Ga0307408_100371605 Ga0307408_1003716052 260
241 3300031616 Ga0307508_10057020 Ga0307508_100570202 260
242 3300031616 Ga0307508_10078582 Ga0307508_100785822 260
243 3300031649 Ga0307514_10083754 Ga0307514_100837542 260
244 3300031731 Ga0307405_10219109 Ga0307405_102191092 260
245 3300031911 Ga0307412_10305962 Ga0307412_103059621 260
246 3300032002 Ga0307416_100073021 Ga0307416_1000730212 260
247 3300035691 Ga0373931_0235975 Ga0373931_0235975_53_835 260
248 3300037312 Ga0395899_0009493 Ga0395899_0009493_702_1484 260
249 3300042009 Ga0439451_017111 Ga0439451_017111_504_1286 260
250 3300044693 Ga0466961_0006299 Ga0466961_0006299_1095_1877 260
251 3300044694 Ga0466963_0107390 Ga0466963_0107390_772_1554 260
252 3300044719 Ga0466971_0140005 Ga0466971_0140005_279_1061 260
253 3300044765 Ga0466970_0086650 Ga0466970_0086650_210_992 260
254 3300044765 Ga0466970_0141349 Ga0466970_0141349_386_1168 260
255 3300044842 Ga0466957_0233657 Ga0466957_0233657_191_973 260
256 3300045049 Ga0466959_0067308 Ga0466959_0067308_855_1637 260
257 3300045976 Ga0466967_0012258 Ga0466967_0012258_1997_2779 260
258 3300045976 Ga0466967_0062693 Ga0466967_0062693_1512_2294 260
259 3300045976 Ga0466967_0467925 Ga0466967_0467925_326_1108 260
260 3300046453 Ga0495627_060065 Ga0495627_060065_16_798 260
261 3300046454 Ga0495592_0008886 Ga0495592_0008886_3186_3968 260
262 3300046454 Ga0495592_0087646 Ga0495592_0087646_266_1048 260
263 3300046459 Ga0495629_0092147 Ga0495629_0092147_44_826 260
264 3300046462 Ga0495651_0002478 Ga0495651_0002478_11058_11840 260
265 3300046462 Ga0495651_0059137 Ga0495651_0059137_604_1386 260
266 3300046472 Ga0495580_0131326 Ga0495580_0131326_58_840 260
267 3300046511 Ga0495608_0014062 Ga0495608_0014062_4105_4887 260
268 3300046516 Ga0495628_0012239 Ga0495628_0012239_3635_4417 260
269 3300046516 Ga0495628_0036966 Ga0495628_0036966_2300_3082 260
270 3300046516 Ga0495628_0291206 Ga0495628_0291206_325_1107 260
271 3300046517 Ga0495630_0052043 Ga0495630_0052043_1690_2472 260
272 3300046522 Ga0495643_0030805 Ga0495643_0030805_2125_2907 260
273 3300046526 Ga0495666_0006850 Ga0495666_0006850_3861_4643 260
274 3300046529 Ga0495652_0000504 Ga0495652_0000504_8783_9565 260
275 3300046529 Ga0495652_0001421 Ga0495652_0001421_7958_8740 260
276 3300046529 Ga0495652_0044672 Ga0495652_0044672_287_1069 260
277 3300046529 Ga0495652_0309956 Ga0495652_0309956_273_1055 260
278 3300046531 Ga0495665_0106201 Ga0495665_0106201_659_1441 260
279 3300046533 Ga0495640_0123022 Ga0495640_0123022_891_1673 260
280 3300046535 Ga0495586_0036608 Ga0495586_0036608_1761_2543 260
281 3300046542 Ga0495597_0124072 Ga0495597_0124072_283_1065 260
282 3300046543 Ga0495645_0016066 Ga0495645_0016066_1695_2477 260
283 3300046543 Ga0495645_0071115 Ga0495645_0071115_11_793 260
284 3300046557 Ga0495622_0056467 Ga0495622_0056467_494_1276 260
285 3300046559 Ga0495667_0013490 Ga0495667_0013490_1294_2076 260
286 3300046559 Ga0495667_0365434 Ga0495667_0365434_67_849 260
287 3300046642 Ga0495634_0032902 Ga0495634_0032902_1157_1939 260
288 3300046642 Ga0495634_0201870 Ga0495634_0201870_97_879 260
289 3300046648 Ga0495611_0072611 Ga0495611_0072611_709_1491 260
290 3300046663 Ga0495635_0006051 Ga0495635_0006051_277_1059 260
291 3300046675 Ga0495657_0215411 Ga0495657_0215411_117_899 260
292 3300046678 Ga0495599_0056230 Ga0495599_0056230_1319_2101 260
293 3300046679 Ga0495623_0040330 Ga0495623_0040330_1505_2287 260
294 3300046679 Ga0495623_0081719 Ga0495623_0081719_1165_1947 260
295 3300046680 Ga0495646_0011440 Ga0495646_0011440_4530_5312 260
296 3300046689 Ga0495613_0007790 Ga0495613_0007790_4815_5597 260
297 3300046691 Ga0495670_0024234 Ga0495670_0024234_984_1766 260
298 3300046809 Ga0495600_0011047 Ga0495600_0011047_3615_4397 260
299 3300046809 Ga0495600_0048952 Ga0495600_0048952_21_803 260
300 3300047315 Ga0495581_0097800 Ga0495581_0097800_451_1233 260
301 3300047317 Ga0495604_0035305 Ga0495604_0035305_21_803 260
302 3300047319 Ga0495674_0426729 Ga0495674_0426729_65_847 260
303 3300047323 Ga0495683_0062407 Ga0495683_0062407_254_1036 260
304 3300047443 Ga0495687_091398 Ga0495687_091398_345_1127 260
305 3300047444 Ga0495675_0016679 Ga0495675_0016679_340_1122 260
306 3300047444 Ga0495675_0023080 Ga0495675_0023080_2460_3242 260
307 3300047446 Ga0495679_029928 Ga0495679_029928_850_1632 260
308 3300047447 Ga0495685_027558 Ga0495685_027558_771_1553 260
309 3300047470 Ga0495681_0047111 Ga0495681_0047111_684_1466 260
310 3300047472 Ga0495686_0253400 Ga0495686_0253400_96_878 260
311 3300047673 Ga0495593_0056066 Ga0495593_0056066_1239_2021 260
312 3300048088 Ga0495602_0087937 Ga0495602_0087937_1713_2495 260
313 3300048088 Ga0495602_0194049 Ga0495602_0194049_761_1543 260
314 3300048905 Ga0496102_0028488 Ga0496102_0028488_3716_4498 260
315 3300048906 Ga0496103_0005070 Ga0496103_0005070_1057_1839 260
316 3300048910 Ga0496107_0264484 Ga0496107_0264484_176_958 260
317 3300048911 Ga0496108_0284679 Ga0496108_0284679_34_816 260
318 3300048917 Ga0496114_0018691 Ga0496114_0018691_3503_4288 260
319 3300048917 Ga0496114_0125690 Ga0496114_0125690_956_1738 260
320 3300049568 Ga0501031_0401415 Ga0501031_0401415_49_831 260
321 3300049569 Ga0501032_0022210 Ga0501032_0022210_567_1349 260
322 3300049570 Ga0501033_0008120 Ga0501033_0008120_5525_6307 260
323 3300049570 Ga0501033_0021640 Ga0501033_0021640_1071_1853 260
324 3300049572 Ga0501036_0030468 Ga0501036_0030468_2396_3178 260
325 3300049574 Ga0501038_0009098 Ga0501038_0009098_6845_7627 260
326 3300049574 Ga0501038_0211906 Ga0501038_0211906_586_1368 260
327 3300049579 Ga0501043_0045422 Ga0501043_0045422_267_1049 260
328 3300049579 Ga0501043_0068120 Ga0501043_0068120_1047_1829 260
329 3300049581 Ga0501047_0007655 Ga0501047_0007655_2339_3121 260
330 3300049586 Ga0501070_0008182 Ga0501070_0008182_2023_2805 260
331 3300049822 Ga0501035_0009974 Ga0501035_0009974_1048_1830 260
332 3300049822 Ga0501035_0057006 Ga0501035_0057006_914_1696 260
333 3300049823 Ga0501044_0074911 Ga0501044_0074911_521_1303 260
334 3300049824 Ga0501045_0610335 Ga0501045_0610335_11_793 260
335 3300050510 nmdc:mga06r32_170736_c1 nmdc:mga06r32_170736_c1_721_1503 260
336 3300050510 nmdc:mga06r32_374620_c1 nmdc:mga06r32_374620_c1_525_1307 260
337 3300050510 nmdc:mga06r32_375588_c1 nmdc:mga06r32_375588_c1_523_1305 260
338 3300050511 nmdc:mga08y16_64062_c1 nmdc:mga08y16_64062_c1_2293_3084 260
339 3300053077 Ga0495601_0017579 Ga0495601_0017579_2527_3309 260
340 3300053077 Ga0495601_0202654 Ga0495601_0202654_172_954 260
341 3300053078 Ga0495612_0001522 Ga0495612_0001522_3786_4568 260
342 3300053085 Ga0495619_0113402 Ga0495619_0113402_732_1514 260
343 3300053085 Ga0495619_0444373 Ga0495619_0444373_53_835 260
344 3300053099 Ga0500654_119600 Ga0500654_119600_170_952 260
345 3300053107 Ga0500560_065651 Ga0500560_065651_230_1012 260
346 3300053129 Ga0500628_005383 Ga0500628_005383_1069_1851 260
347 3300053131 Ga0500652_059054 Ga0500652_059054_220_1002 260
348 3300053161 Ga0500634_0101469 Ga0500634_0101469_25_807 260
349 3300053732 Ga0500656_003980 Ga0500656_003980_11_793 260
350 3300053739 Ga0500587_009371 Ga0500587_009371_412_1194 260
351 iso_pu_bacteria 8054160619 8054161133 260
352 3300001989 JGI24739J22299_10046265 JGI24739J22299_100462651 261
353 3300003316 rootH1_10004151 rootH1_100041516 261
354 3300003320 rootH2_10014916 rootH2_100149168 261
355 3300003320 rootH2_10067347 rootH2_100673471 261
356 3300003323 rootH1_10002980 rootH1_100029803 261
357 3300003578 Ga0006562J51391_1062118 Ga0006562J51391_10621182 261
358 3300003578 Ga0006562J51391_1151006 Ga0006562J51391_11510062 261
359 3300003578 Ga0006562J51391_1151007 Ga0006562J51391_11510072 261
360 3300005539 Ga0068853_100039038 Ga0068853_1000390382 261
361 3300005548 Ga0070665_100554361 Ga0070665_1005543611 261
362 3300005614 Ga0068856_100514702 Ga0068856_1005147022 261
363 3300005840 Ga0068870_10108254 Ga0068870_101082542 261
364 3300006042 Ga0075368_10027892 Ga0075368_100278922 261
365 3300006178 Ga0075367_10001580 Ga0075367_100015805 261
366 3300006846 Ga0075430_100248608 Ga0075430_1002486082 261
367 3300011119 Ga0105246_10007527 Ga0105246_100075274 261
368 3300013105 Ga0157369_10058736 Ga0157369_100587362 261
369 3300013308 Ga0157375_10364667 Ga0157375_103646672 261
370 3300015262 Ga0182007_10000456 Ga0182007_1000045620 261
371 3300015688 Ga0183367_1002 Ga0183367_1002180 261
372 3300025297 Ga0209758_1002959 Ga0209758_10029598 261
373 3300025302 Ga0207426_1027227 Ga0207426_10272272 261
374 3300025904 Ga0207647_10051049 Ga0207647_100510492 261
375 3300026041 Ga0207639_10024209 Ga0207639_100242093 261
376 3300027312 Ga0209371_1021066 Ga0209371_10210661 261
377 3300028786 Ga0307517_10002122 Ga0307517_1000212217 261
378 3300028794 Ga0307515_10000699 Ga0307515_1000069941 261
379 3300028794 Ga0307515_10192472 Ga0307515_101924722 261
380 3300030500 Ga0268256_1023683 Ga0268256_10236832 261
381 3300030521 Ga0307511_10000438 Ga0307511_100004386 261
382 3300030521 Ga0307511_10046666 Ga0307511_100466663 261
383 3300030521 Ga0307511_10147276 Ga0307511_101472761 261
384 3300030522 Ga0307512_10004491 Ga0307512_1000449112 261
385 3300030522 Ga0307512_10014211 Ga0307512_100142112 261
386 3300030522 Ga0307512_10099707 Ga0307512_100997072 261
387 3300031456 Ga0307513_10005125 Ga0307513_100051256 261
388 3300031456 Ga0307513_10325142 Ga0307513_103251421 261
389 3300031507 Ga0307509_10030667 Ga0307509_100306675 261
390 3300031507 Ga0307509_10057387 Ga0307509_100573872 261
391 3300031507 Ga0307509_10096328 Ga0307509_100963282 261
392 3300031616 Ga0307508_10007077 Ga0307508_100070775 261
393 3300031616 Ga0307508_10030324 Ga0307508_100303243 261
394 3300031649 Ga0307514_10010429 Ga0307514_100104297 261
395 3300031649 Ga0307514_10129746 Ga0307514_101297461 261
396 3300031730 Ga0307516_10011516 Ga0307516_100115167 261
397 3300031731 Ga0307405_10048554 Ga0307405_100485542 261
398 3300031824 Ga0307413_10025236 Ga0307413_100252362 261
399 3300031838 Ga0307518_10083769 Ga0307518_100837692 261
400 3300031838 Ga0307518_10114381 Ga0307518_101143811 261
401 3300031852 Ga0307410_10019258 Ga0307410_100192582 261
402 3300031901 Ga0307406_10009225 Ga0307406_100092254 261
403 3300031903 Ga0307407_10000754 Ga0307407_100007549 261
404 3300031995 Ga0307409_100000237 Ga0307409_1000002373 261
405 3300032002 Ga0307416_100000124 Ga0307416_10000012455 261
406 3300032002 Ga0307416_100084444 Ga0307416_1000844442 261
407 3300032005 Ga0307411_10017436 Ga0307411_100174362 261
408 3300032126 Ga0307415_100002913 Ga0307415_1000029138 261
409 3300033179 Ga0307507_10028327 Ga0307507_100283274 261
410 3300033179 Ga0307507_10055781 Ga0307507_100557812 261
411 3300033180 Ga0307510_10057603 Ga0307510_100576034 261
412 3300037466 Ga0395898_0003329 Ga0395898_0003329_16327_17112 261
413 3300037466 Ga0395898_0006626 Ga0395898_0006626_10835_11620 261
414 3300037471 Ga0395905_0039029 Ga0395905_0039029_2261_3046 261
415 3300038443 Ga0395901_0046131 Ga0395901_0046131_1196_1981 261
416 3300038443 Ga0395901_0290767 Ga0395901_0290767_629_1414 261
417 3300041404 Ga0439436_0002737 Ga0439436_0002737_251_1036 261
418 3300041404 Ga0439436_0022920 Ga0439436_0022920_970_1755 261
419 3300041406 Ga0439439_0001260 Ga0439439_0001260_3571_4356 261
420 3300041494 Ga0451837_1767802 Ga0451837_1767802_167_952 261
421 3300041505 Ga0451849_1538132 Ga0451849_1538132_217_1002 261
422 3300041512 Ga0451853_0299947 Ga0451853_0299947_5207_5992 261
423 3300041512 Ga0451853_1037359 Ga0451853_1037359_2830_3615 261
424 3300042005 Ga0439448_0015074 Ga0439448_0015074_744_1529 261
425 3300042007 Ga0439449_0000611 Ga0439449_0000611_56_841 261
426 3300042007 Ga0439449_0008467 Ga0439449_0008467_1207_1992 261
427 3300042007 Ga0439449_0107782 Ga0439449_0107782_106_891 261
428 3300042014 Ga0439457_000227 Ga0439457_000227_5235_6020 261
429 3300042014 Ga0439457_004521 Ga0439457_004521_599_1384 261
430 3300042014 Ga0439457_044425 Ga0439457_044425_78_863 261
431 3300042015 Ga0439462_0005386 Ga0439462_0005386_151_936 261
432 3300042131 Ga0450894_000764 Ga0450894_000764_4278_5147 261
433 3300042133 Ga0450896_012448 Ga0450896_012448_20_805 261
434 3300042134 Ga0450898_027235 Ga0450898_027235_72_857 261
435 3300042135 Ga0450899_008064 Ga0450899_008064_164_1033 261
436 3300042136 Ga0450900_003511 Ga0450900_003511_201_1031 261
437 3300042138 Ga0450903_000411 Ga0450903_000411_3872_4657 261
438 3300042157 Ga0439458_0001037 Ga0439458_0001037_1974_2759 261
439 3300042184 Ga0450908_007024 Ga0450908_007024_412_1281 261
440 3300044656 Ga0466969_0000620 Ga0466969_0000620_7437_8222 261
441 3300044656 Ga0466969_0028351 Ga0466969_0028351_93_878 261
442 3300044656 Ga0466969_0063958 Ga0466969_0063958_87_872 261
443 3300044658 Ga0466972_0005097 Ga0466972_0005097_5318_6103 261
444 3300044658 Ga0466972_0009735 Ga0466972_0009735_3717_4502 261
445 3300044658 Ga0466972_0013665 Ga0466972_0013665_2187_2972 261
446 3300044684 Ga0466966_0000546 Ga0466966_0000546_21555_22340 261
447 3300044684 Ga0466966_0002337 Ga0466966_0002337_8312_9097 261
448 3300044684 Ga0466966_0005998 Ga0466966_0005998_1510_2295 261
449 3300044693 Ga0466961_0004031 Ga0466961_0004031_8294_9079 261
450 3300044693 Ga0466961_0005927 Ga0466961_0005927_5198_5983 261
451 3300044693 Ga0466961_0347808 Ga0466961_0347808_80_865 261
452 3300044694 Ga0466963_0018813 Ga0466963_0018813_75_860 261
453 3300044694 Ga0466963_0044503 Ga0466963_0044503_144_929 261
454 3300044706 Ga0466964_0058630 Ga0466964_0058630_694_1479 261
455 3300044719 Ga0466971_0000518 Ga0466971_0000518_8319_9104 261
456 3300044719 Ga0466971_0026193 Ga0466971_0026193_1676_2461 261
457 3300044719 Ga0466971_0080152 Ga0466971_0080152_656_1441 261
458 3300044719 Ga0466971_0093439 Ga0466971_0093439_345_1130 261
459 3300044719 Ga0466971_0197481 Ga0466971_0197481_147_932 261
460 3300044735 Ga0466968_0057304 Ga0466968_0057304_800_1585 261
461 3300044765 Ga0466970_0000657 Ga0466970_0000657_10072_10857 261
462 3300044765 Ga0466970_0095024 Ga0466970_0095024_798_1583 261
463 3300044842 Ga0466957_0000445 Ga0466957_0000445_3207_3992 261
464 3300044842 Ga0466957_0323302 Ga0466957_0323302_209_994 261
465 3300044901 Ga0466960_0154454 Ga0466960_0154454_405_1190 261
466 3300045049 Ga0466959_0001702 Ga0466959_0001702_12534_13319 261
467 3300045049 Ga0466959_0004565 Ga0466959_0004565_8319_9104 261
468 3300045836 Ga0466958_0001212 Ga0466958_0001212_2950_3735 261
469 3300045976 Ga0466967_0003250 Ga0466967_0003250_1684_2469 261
470 3300045976 Ga0466967_0053846 Ga0466967_0053846_1798_2583 261
471 3300045976 Ga0466967_0155038 Ga0466967_0155038_1272_2057 261
472 3300045976 Ga0466967_0485319 Ga0466967_0485319_14_799 261
473 3300046452 Ga0495617_049038 Ga0495617_049038_94_879 261
474 3300046454 Ga0495592_0014548 Ga0495592_0014548_4868_5653 261
475 3300046454 Ga0495592_0032622 Ga0495592_0032622_1791_2576 261
476 3300046455 Ga0495603_0004097 Ga0495603_0004097_3540_4325 261
477 3300046455 Ga0495603_0004551 Ga0495603_0004551_3178_3963 261
478 3300046455 Ga0495603_0009852 Ga0495603_0009852_4915_5700 261
479 3300046455 Ga0495603_0014035 Ga0495603_0014035_3676_4461 261
480 3300046455 Ga0495603_0024152 Ga0495603_0024152_1790_2575 261
481 3300046459 Ga0495629_0001340 Ga0495629_0001340_8091_8876 261
482 3300046459 Ga0495629_0004677 Ga0495629_0004677_3177_3962 261
483 3300046459 Ga0495629_0010237 Ga0495629_0010237_4205_4990 261
484 3300046459 Ga0495629_0013199 Ga0495629_0013199_610_1395 261
485 3300046459 Ga0495629_0037180 Ga0495629_0037180_1645_2430 261
486 3300046459 Ga0495629_0074780 Ga0495629_0074780_578_1363 261
487 3300046459 Ga0495629_0081004 Ga0495629_0081004_36_821 261
488 3300046459 Ga0495629_0146447 Ga0495629_0146447_832_1617 261
489 3300046459 Ga0495629_0279211 Ga0495629_0279211_70_855 261
490 3300046460 Ga0495638_0074582 Ga0495638_0074582_543_1328 261
491 3300046462 Ga0495651_0030452 Ga0495651_0030452_1974_2759 261
492 3300046462 Ga0495651_0181924 Ga0495651_0181924_523_1308 261
493 3300046473 Ga0495582_0085577 Ga0495582_0085577_924_1709 261
494 3300046474 Ga0495605_0014355 Ga0495605_0014355_3271_4056 261
495 3300046475 Ga0495639_0010002 Ga0495639_0010002_1433_2218 261
496 3300046476 Ga0495662_0000647 Ga0495662_0000647_5084_5869 261
497 3300046476 Ga0495662_0024342 Ga0495662_0024342_2050_2835 261
498 3300046476 Ga0495662_0228514 Ga0495662_0228514_102_887 261
499 3300046477 Ga0495664_0000608 Ga0495664_0000608_15713_16498 261
500 3300046477 Ga0495664_0097545 Ga0495664_0097545_182_967 261
501 3300046491 Ga0495584_0250682 Ga0495584_0250682_49_834 261
502 3300046492 Ga0495585_0115096 Ga0495585_0115096_414_1199 261
503 3300046492 Ga0495585_0207872 Ga0495585_0207872_155_940 261
504 3300046499 Ga0495594_0022251 Ga0495594_0022251_815_1600 261
505 3300046499 Ga0495594_0039697 Ga0495594_0039697_1549_2334 261
506 3300046499 Ga0495594_0075203 Ga0495594_0075203_425_1210 261
507 3300046499 Ga0495594_0077271 Ga0495594_0077271_1011_1796 261
508 3300046500 Ga0495596_0090269 Ga0495596_0090269_115_900 261
509 3300046501 Ga0495607_0093270 Ga0495607_0093270_381_1166 261
510 3300046506 Ga0495583_0032979 Ga0495583_0032979_889_1674 261
511 3300046507 Ga0495606_0041372 Ga0495606_0041372_1192_1977 261
512 3300046511 Ga0495608_0049973 Ga0495608_0049973_1576_2361 261
513 3300046512 Ga0495610_0025761 Ga0495610_0025761_1892_2677 261
514 3300046515 Ga0495620_0032968 Ga0495620_0032968_383_1168 261
515 3300046516 Ga0495628_0079239 Ga0495628_0079239_970_1755 261
516 3300046516 Ga0495628_0131908 Ga0495628_0131908_814_1599 261
517 3300046518 Ga0495631_0054765 Ga0495631_0054765_541_1326 261
518 3300046522 Ga0495643_0014519 Ga0495643_0014519_3633_4418 261
519 3300046522 Ga0495643_0117266 Ga0495643_0117266_49_834 261
520 3300046524 Ga0495648_0100000 Ga0495648_0100000_566_1351 261
521 3300046526 Ga0495666_0050809 Ga0495666_0050809_362_1147 261
522 3300046526 Ga0495666_0095076 Ga0495666_0095076_578_1363 261
523 3300046529 Ga0495652_0124798 Ga0495652_0124798_800_1585 261
524 3300046529 Ga0495652_0358666 Ga0495652_0358666_26_811 261
525 3300046530 Ga0495654_0029354 Ga0495654_0029354_91_876 261
526 3300046533 Ga0495640_0010045 Ga0495640_0010045_3103_3888 261
527 3300046533 Ga0495640_0011506 Ga0495640_0011506_4569_5354 261
528 3300046533 Ga0495640_0099233 Ga0495640_0099233_836_1621 261
529 3300046535 Ga0495586_0013685 Ga0495586_0013685_1842_2627 261
530 3300046536 Ga0495587_0001767 Ga0495587_0001767_9339_10124 261
531 3300046538 Ga0495609_0017242 Ga0495609_0017242_204_989 261
532 3300046538 Ga0495609_0124664 Ga0495609_0124664_25_810 261
533 3300046543 Ga0495645_0032330 Ga0495645_0032330_1793_2578 261
534 3300046543 Ga0495645_0176908 Ga0495645_0176908_58_843 261
535 3300046557 Ga0495622_0073878 Ga0495622_0073878_758_1543 261
536 3300046559 Ga0495667_0070270 Ga0495667_0070270_1321_2106 261
537 3300046616 Ga0495668_0135575 Ga0495668_0135575_383_1168 261
538 3300046642 Ga0495634_0017020 Ga0495634_0017020_4179_4964 261
539 3300046648 Ga0495611_0094371 Ga0495611_0094371_46_831 261
540 3300046660 Ga0495625_0003655 Ga0495625_0003655_6038_6823 261
541 3300046660 Ga0495625_0054320 Ga0495625_0054320_1703_2488 261
542 3300046663 Ga0495635_0002320 Ga0495635_0002320_1423_2208 261
543 3300046663 Ga0495635_0032274 Ga0495635_0032274_2310_3095 261
544 3300046665 Ga0495661_0195565 Ga0495661_0195565_10_795 261
545 3300046674 Ga0495588_0001021 Ga0495588_0001021_8028_8813 261
546 3300046674 Ga0495588_0002959 Ga0495588_0002959_643_1428 261
547 3300046674 Ga0495588_0135206 Ga0495588_0135206_487_1272 261
548 3300046675 Ga0495657_0004925 Ga0495657_0004925_4825_5610 261
549 3300046675 Ga0495657_0006104 Ga0495657_0006104_1088_1873 261
550 3300046675 Ga0495657_0171162 Ga0495657_0171162_487_1272 261
551 3300046678 Ga0495599_0198710 Ga0495599_0198710_214_999 261
552 3300046679 Ga0495623_0175534 Ga0495623_0175534_235_1020 261
553 3300046680 Ga0495646_0018236 Ga0495646_0018236_1965_2750 261
554 3300046689 Ga0495613_0005912 Ga0495613_0005912_3193_3978 261
555 3300046689 Ga0495613_0012202 Ga0495613_0012202_535_1320 261
556 3300046689 Ga0495613_0014412 Ga0495613_0014412_243_1028 261
557 3300046689 Ga0495613_0089623 Ga0495613_0089623_925_1710 261
558 3300046689 Ga0495613_0178959 Ga0495613_0178959_562_1347 261
559 3300046689 Ga0495613_0206598 Ga0495613_0206598_67_852 261
560 3300046689 Ga0495613_0360821 Ga0495613_0360821_140_925 261
561 3300046690 Ga0495624_0017471 Ga0495624_0017471_173_958 261
562 3300046690 Ga0495624_0031151 Ga0495624_0031151_1366_2151 261
563 3300046691 Ga0495670_0181233 Ga0495670_0181233_309_1094 261
564 3300046692 Ga0495671_0007615 Ga0495671_0007615_1953_2738 261
565 3300046694 Ga0495649_0104337 Ga0495649_0104337_10_795 261
566 3300046794 Ga0495589_0019341 Ga0495589_0019341_605_1390 261
567 3300046794 Ga0495589_0038574 Ga0495589_0038574_819_1604 261
568 3300046794 Ga0495589_0153333 Ga0495589_0153333_39_824 261
569 3300046809 Ga0495600_0143823 Ga0495600_0143823_125_910 261
570 3300047317 Ga0495604_0000946 Ga0495604_0000946_20589_21374 261
571 3300047317 Ga0495604_0037168 Ga0495604_0037168_2326_3111 261
572 3300047318 Ga0495636_0018650 Ga0495636_0018650_80_865 261
573 3300047319 Ga0495674_0224943 Ga0495674_0224943_26_811 261
574 3300047320 Ga0495672_0215723 Ga0495672_0215723_46_831 261
575 3300047321 Ga0495676_0000760 Ga0495676_0000760_1601_2386 261
576 3300047321 Ga0495676_0002333 Ga0495676_0002333_5427_6212 261
577 3300047321 Ga0495676_0002484 Ga0495676_0002484_12454_13239 261
578 3300047321 Ga0495676_0006534 Ga0495676_0006534_6434_7219 261
579 3300047321 Ga0495676_0042159 Ga0495676_0042159_1548_2333 261
580 3300047322 Ga0495680_0003973 Ga0495680_0003973_2533_3318 261
581 3300047323 Ga0495683_0044453 Ga0495683_0044453_642_1427 261
582 3300047443 Ga0495687_001311 Ga0495687_001311_17716_18501 261
583 3300047443 Ga0495687_001496 Ga0495687_001496_12443_13228 261
584 3300047443 Ga0495687_013749 Ga0495687_013749_314_1099 261
585 3300047443 Ga0495687_040135 Ga0495687_040135_448_1233 261
586 3300047443 Ga0495687_094230 Ga0495687_094230_20_805 261
587 3300047444 Ga0495675_0042980 Ga0495675_0042980_1089_1874 261
588 3300047447 Ga0495685_014534 Ga0495685_014534_58_843 261
589 3300047447 Ga0495685_051592 Ga0495685_051592_562_1347 261
590 3300047447 Ga0495685_081065 Ga0495685_081065_85_870 261
591 3300047470 Ga0495681_0001659 Ga0495681_0001659_15079_15864 261
592 3300047471 Ga0495684_0116919 Ga0495684_0116919_569_1354 261
593 3300047472 Ga0495686_0020812 Ga0495686_0020812_1004_1789 261
594 3300047673 Ga0495593_0001823 Ga0495593_0001823_10749_11534 261
595 3300047673 Ga0495593_0018422 Ga0495593_0018422_1489_2274 261
596 3300048088 Ga0495602_0100561 Ga0495602_0100561_138_923 261
597 3300048089 Ga0495614_0008038 Ga0495614_0008038_2381_3166 261
598 3300048089 Ga0495614_0010658 Ga0495614_0010658_3206_3991 261
599 3300048089 Ga0495614_0026010 Ga0495614_0026010_1003_1788 261
600 3300048089 Ga0495614_0056097 Ga0495614_0056097_479_1264 261
601 3300048091 Ga0495626_0074772 Ga0495626_0074772_357_1142 261
602 3300048911 Ga0496108_0198234 Ga0496108_0198234_338_1123 261
603 3300048912 Ga0496109_0087551 Ga0496109_0087551_510_1295 261
604 3300048912 Ga0496109_0276248 Ga0496109_0276248_42_827 261
605 3300049568 Ga0501031_0002776 Ga0501031_0002776_10196_11032 261
606 3300049568 Ga0501031_0022707 Ga0501031_0022707_1313_2143 261
607 3300049569 Ga0501032_0005717 Ga0501032_0005717_11_796 261
608 3300049569 Ga0501032_0006643 Ga0501032_0006643_121_957 261
609 3300049569 Ga0501032_0050333 Ga0501032_0050333_1904_2689 261
610 3300049569 Ga0501032_0218778 Ga0501032_0218778_268_1053 261
611 3300049570 Ga0501033_0000756 Ga0501033_0000756_16556_17341 261
612 3300049570 Ga0501033_0000947 Ga0501033_0000947_22092_22937 261
613 3300049570 Ga0501033_0004830 Ga0501033_0004830_141_977 261
614 3300049570 Ga0501033_0006391 Ga0501033_0006391_6152_6937 261
615 3300049571 Ga0501034_0002496 Ga0501034_0002496_121_957 261
616 3300049571 Ga0501034_0013124 Ga0501034_0013124_2569_3414 261
617 3300049571 Ga0501034_0020830 Ga0501034_0020830_1660_2445 261
618 3300049571 Ga0501034_0100524 Ga0501034_0100524_1242_2027 261
619 3300049571 Ga0501034_0111796 Ga0501034_0111796_17_802 261
620 3300049572 Ga0501036_0000417 Ga0501036_0000417_1915_2760 261
621 3300049572 Ga0501036_0003255 Ga0501036_0003255_11993_12829 261
622 3300049572 Ga0501036_0022966 Ga0501036_0022966_2476_3261 261
623 3300049572 Ga0501036_0100969 Ga0501036_0100969_30_815 261
624 3300049572 Ga0501036_0228721 Ga0501036_0228721_523_1308 261
625 3300049573 Ga0501037_0000553 Ga0501037_0000553_28829_29665 261
626 3300049573 Ga0501037_0141837 Ga0501037_0141837_651_1514 261
627 3300049573 Ga0501037_0147737 Ga0501037_0147737_26_811 261
628 3300049573 Ga0501037_0243003 Ga0501037_0243003_25_810 261
629 3300049574 Ga0501038_0001453 Ga0501038_0001453_13_849 261
630 3300049574 Ga0501038_0049443 Ga0501038_0049443_1300_2085 261
631 3300049574 Ga0501038_0054062 Ga0501038_0054062_2456_3241 261
632 3300049574 Ga0501038_0114855 Ga0501038_0114855_847_1692 261
633 3300049575 Ga0501039_0007781 Ga0501039_0007781_7217_8053 261
634 3300049575 Ga0501039_0043544 Ga0501039_0043544_387_1232 261
635 3300049575 Ga0501039_0304536 Ga0501039_0304536_217_1002 261
636 3300049575 Ga0501039_0499388 Ga0501039_0499388_148_933 261
637 3300049576 Ga0501040_0005142 Ga0501040_0005142_281_1117 261
638 3300049577 Ga0501041_0006679 Ga0501041_0006679_4432_5268 261
639 3300049578 Ga0501042_0026297 Ga0501042_0026297_3116_3901 261
640 3300049578 Ga0501042_0172560 Ga0501042_0172560_74_937 261
641 3300049579 Ga0501043_0001506 Ga0501043_0001506_19387_20223 261
642 3300049579 Ga0501043_0006947 Ga0501043_0006947_8200_8985 261
643 3300049579 Ga0501043_0010866 Ga0501043_0010866_26_871 261
644 3300049579 Ga0501043_0024986 Ga0501043_0024986_3372_4157 261
645 3300049579 Ga0501043_0288143 Ga0501043_0288143_400_1185 261
646 3300049580 Ga0501046_0002619 Ga0501046_0002619_1956_2792 261
647 3300049580 Ga0501046_0036282 Ga0501046_0036282_110_895 261
648 3300049580 Ga0501046_0118678 Ga0501046_0118678_893_1678 261
649 3300049580 Ga0501046_0399183 Ga0501046_0399183_63_848 261
650 3300049581 Ga0501047_0000046 Ga0501047_0000046_161347_162210 261
651 3300049581 Ga0501047_0016937 Ga0501047_0016937_6106_6891 261
652 3300049581 Ga0501047_0056927 Ga0501047_0056927_1794_2579 261
653 3300049581 Ga0501047_0172582 Ga0501047_0172582_1012_1797 261
654 3300049581 Ga0501047_0173560 Ga0501047_0173560_643_1428 261
655 3300049581 Ga0501047_0206096 Ga0501047_0206096_20_805 261
656 3300049581 Ga0501047_0247542 Ga0501047_0247542_385_1221 261
657 3300049581 Ga0501047_0592813 Ga0501047_0592813_38_823 261
658 3300049582 Ga0501048_0002110 Ga0501048_0002110_14200_15036 261
659 3300049582 Ga0501048_0005468 Ga0501048_0005468_6425_7210 261
660 3300049582 Ga0501048_0120071 Ga0501048_0120071_768_1553 261
661 3300049583 Ga0501067_0004793 Ga0501067_0004793_6436_7272 261
662 3300049584 Ga0501068_0222594 Ga0501068_0222594_140_976 261
663 3300049585 Ga0501069_0144057 Ga0501069_0144057_335_1180 261
664 3300049586 Ga0501070_0001543 Ga0501070_0001543_4487_5332 261
665 3300049586 Ga0501070_0051885 Ga0501070_0051885_2374_3159 261
666 3300049586 Ga0501070_0584674 Ga0501070_0584674_61_846 261
667 3300049587 Ga0501071_0003427 Ga0501071_0003427_4637_5473 261
668 3300049588 Ga0501072_0000511 Ga0501072_0000511_26732_27568 261
669 3300049589 Ga0501073_0262036 Ga0501073_0262036_368_1153 261
670 3300049590 Ga0501074_0003198 Ga0501074_0003198_3926_4771 261
671 3300049592 Ga0501076_0004537 Ga0501076_0004537_8683_9519 261
672 3300049593 Ga0501077_0137629 Ga0501077_0137629_257_1093 261
673 3300049686 Ga0501257_046834 Ga0501257_046834_251_1036 261
674 3300049741 Ga0501079_0001551 Ga0501079_0001551_13833_14669 261
675 3300049742 Ga0501080_0076461 Ga0501080_0076461_214_1050 261
676 3300049742 Ga0501080_0077242 Ga0501080_0077242_1607_2392 261
677 3300049744 Ga0501083_0000503 Ga0501083_0000503_23871_24707 261
678 3300049822 Ga0501035_0000936 Ga0501035_0000936_7572_8417 261
679 3300049822 Ga0501035_0003520 Ga0501035_0003520_14010_14846 261
680 3300049822 Ga0501035_0013864 Ga0501035_0013864_6618_7403 261
681 3300049822 Ga0501035_0042647 Ga0501035_0042647_439_1224 261
682 3300049822 Ga0501035_0084387 Ga0501035_0084387_565_1350 261
683 3300049822 Ga0501035_0116022 Ga0501035_0116022_1359_2144 261
684 3300049822 Ga0501035_0529211 Ga0501035_0529211_106_891 261
685 3300049823 Ga0501044_0001273 Ga0501044_0001273_121_957 261
686 3300049823 Ga0501044_0006283 Ga0501044_0006283_9296_10081 261
687 3300049823 Ga0501044_0011385 Ga0501044_0011385_3431_4216 261
688 3300049823 Ga0501044_0032261 Ga0501044_0032261_1932_2717 261
689 3300049823 Ga0501044_0074534 Ga0501044_0074534_160_945 261
690 3300049823 Ga0501044_0208478 Ga0501044_0208478_21_806 261
691 3300049823 Ga0501044_0227882 Ga0501044_0227882_977_1762 261
692 3300049823 Ga0501044_0236615 Ga0501044_0236615_455_1240 261
693 3300049823 Ga0501044_0315008 Ga0501044_0315008_242_1027 261
694 3300049823 Ga0501044_0651565 Ga0501044_0651565_40_870 261
695 3300049824 Ga0501045_0154011 Ga0501045_0154011_401_1186 261
696 3300049824 Ga0501045_0282654 Ga0501045_0282654_28_813 261
697 3300050490 nmdc:mga03n38_29807_c1 nmdc:mga03n38_29807_c1_89_874 261
698 3300050494 nmdc:mga06z11_2553_c1 nmdc:mga06z11_2553_c1_1875_2660 261
699 3300050509 nmdc:mga0qj67_257823_c1 nmdc:mga0qj67_257823_c1_135_926 261
700 3300050509 nmdc:mga0qj67_281470_c1 nmdc:mga0qj67_281470_c1_471_1262 261
701 3300053078 Ga0495612_0133132 Ga0495612_0133132_210_995 261
702 3300053079 Ga0500610_0124468 Ga0500610_0124468_471_1256 261
703 3300053095 Ga0500640_000514 Ga0500640_000514_6561_7346 261
704 3300053101 Ga0500553_055909 Ga0500553_055909_52_837 261
705 3300053107 Ga0500560_002042 Ga0500560_002042_1517_2302 261
706 3300053111 Ga0500572_094231 Ga0500572_094231_116_901 261
707 3300053140 Ga0500573_0027859 Ga0500573_0027859_193_978 261
708 3300054114 Ga0501084_0004469 Ga0501084_0004469_149_985 261
709 3300060353 Ga0501082_0164712 Ga0501082_0164712_822_1658 261
710 3300061719 Ga0466962_0003454 Ga0466962_0003454_3941_4726 261
711 3300061734 Ga0530510_0423875 Ga0530510_0423875_140_976 261
712 iso_pu_bacteria 2643221578 2643902390 261
713 iso_pu_bacteria 2643221673 2644403961 261
714 iso_pu_bacteria 2862290372 2862292322 261
715 iso_pu_bacteria 2935390628 2935394546 261
716 iso_pu_bacteria 2946045630 2946047988 261
717 iso_pu_bacteria 3006393351 3006393365 261

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01182

Glucosamine_iso

Glucosamine-6-phosphate isomerases/6-phosphogluconolactonase

3

230

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hn6-assembly1.cif.gz_D crystal structure of glucosamine-6-phosphate deaminase from borrelia burgdorferi 0.9764 1 251
4r7t-assembly1.cif.gz_B crystal structure of glucosamine-6-phosphate deaminase from vibrio cholerae 0.9668 1 253
1cd5-assembly1.cif.gz_A glucosamine-6-phosphate deaminase from e.coli, t conformer 0.9606 1 253
7lqn-assembly2.cif.gz_I glucosamine-6-phosphate deaminase from h. influenzae 0.9595 2 251
4r7t-assembly1.cif.gz_C crystal structure of glucosamine-6-phosphate deaminase from vibrio cholerae 0.9587 1 253
ID Description Score Start End Superfamily
2bkxB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9529 1 242 3.40.50.1360
af_Q04802_1_247_3.40.50.1360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9527 1 243 3.40.50.1360
af_M0RCH5_1_250_3.40.50.1360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9525 36 253 3.40.50.1360
af_Q2G0K8_1_251_3.40.50.1360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9486 1 239 3.40.50.1360
2bkxB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9453 1 242 3.40.50.1360
ID Description Score Start End GO Terms
AF-A0A3D9QTE4-F1-model_v4 deleted 0.9996 1 261
AF-A0A0Q8YY92-F1-model_v4 Glucosamine-6-phosphate deaminase (EC 3.5.99.6) (GlcN6P deaminase) (GNPDA) (Glucosamine-6-phosphate isomerase) 0.999 1 261 GO:0004342
GO:0005737
GO:0005975
GO:0006043
GO:0006046
GO:0019262
GO:0042802
AF-A0A1H9WTI3-F1-model_v4 Glucosamine-6-phosphate deaminase (EC 3.5.99.6) (GlcN6P deaminase) (GNPDA) (Glucosamine-6-phosphate isomerase) 0.999 1 261 GO:0004342
GO:0005737
GO:0005975
GO:0006043
GO:0006046
GO:0019262
GO:0042802
AF-A0A7Y3PNN8-F1-model_v4 Glucosamine-6-phosphate deaminase (EC 3.5.99.6) (GlcN6P deaminase) (GNPDA) (Glucosamine-6-phosphate isomerase) 0.9986 1 261 GO:0004342
GO:0005737
GO:0005975
GO:0006043
GO:0006046
GO:0019262
GO:0042802
AF-A0A1C5ED19-F1-model_v4 Glucosamine-6-phosphate deaminase (EC 3.5.99.6) 0.9979 1 260 GO:0004342
GO:0005737
GO:0005975
GO:0006043
GO:0006046
GO:0019262
GO:0042802

Feature Viewer

pLDDT pTM Quality
96.24 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map