F477118
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 717 | 317 | 717 | 150 |
Family's Representative Sequence
| Representative Sequence | 3300046684|Ga0495669_0000076|Ga0495669_0000076_36273_36764 |
| Length | 163 |
| Sequence | VSVAAKRRNEIKSHTAYMTFNTERRRELIRITEEVQAAVDEAGIEEGMVLVSAMHITAGVWVNDDEPGLHEDTLEWLDKVAPPSWKPAANGVAAELSPDGGDYRHHRGGEDNGDAHLKNLLVHHQAIVPVTAGRLDLGPWQQVFYCEFDGGRPKRLVIKAMGE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000531 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 3 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 71 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 76 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 77 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 78 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 79 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 81 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 82 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 86 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 87 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 88 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 89 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 90 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 91 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 92 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 93 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 94 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 96 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 97 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 110 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 126 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 128 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 129 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 178 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 181 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 182 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 183 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 184 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 185 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 186 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 187 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 188 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 189 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 190 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 191 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 192 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 193 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 194 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 195 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 196 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 197 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 198 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 199 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 200 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 201 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 202 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 203 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 204 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 205 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 206 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 207 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 208 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 209 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 210 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 211 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 212 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 213 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 214 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 215 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 216 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 217 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 218 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 219 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 220 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 261 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 262 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 263 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 264 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 265 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 266 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 267 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 268 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 269 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 270 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 271 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 272 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 273 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 274 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 275 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 276 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 277 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 290 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 291 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 295 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 296 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 299 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 300 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 314 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 317 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.56 |
| Nodule | 0 |
| Rhizoplane | 6 |
| Rhizosphere | 92.05 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.39 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | CNBas_1002498 | 3300000531 | Bacteria | 1014 |
| 2 | JGI25407J50210_10057872 | 3300003373 | Bacteria | 976 |
| 3 | Ga0065704_10186197 | 3300005289 | Bacteria | 1212 |
| 4 | Ga0065712_10120808 | 3300005290 | Unclassified | 1674 |
| 5 | Ga0065712_10307204 | 3300005290 | Bacteria | 850 |
| 6 | Ga0065715_10089219 | 3300005293 | Bacteria | 12358 |
| 7 | Ga0065715_10164629 | 3300005293 | Bacteria | 1597 |
| 8 | Ga0070658_10094939 | 3300005327 | Bacteria | 2461 |
| 9 | Ga0070658_10408452 | 3300005327 | Unclassified | 1167 |
| 10 | Ga0070658_10941978 | 3300005327 | Bacteria | 751 |
| 11 | Ga0070676_10008896 | 3300005328 | Bacteria | 5426 |
| 12 | Ga0070676_10427833 | 3300005328 | Bacteria | 926 |
| 13 | Ga0070683_100007221 | 3300005329 | Bacteria | 9373 |
| 14 | Ga0070683_100032094 | 3300005329 | Bacteria | 4780 |
| 15 | Ga0070683_100056215 | 3300005329 | Unclassified | 3654 |
| 16 | Ga0070683_100088896 | 3300005329 | Bacteria | 2899 |
| 17 | Ga0070670_100048916 | 3300005331 | Bacteria | 3638 |
| 18 | Ga0070670_100333071 | 3300005331 | Bacteria | 1331 |
| 19 | Ga0070670_100336399 | 3300005331 | Bacteria | 1325 |
| 20 | Ga0070670_101469079 | 3300005331 | Bacteria | 626 |
| 21 | Ga0070677_10000015 | 3300005333 | Bacteria | 52793 |
| 22 | Ga0068869_100017547 | 3300005334 | Bacteria | 4853 |
| 23 | Ga0068869_100018855 | 3300005334 | Bacteria | 4704 |
| 24 | Ga0068869_100187384 | 3300005334 | Bacteria | 1625 |
| 25 | Ga0070666_10038088 | 3300005335 | Bacteria | 3199 |
| 26 | Ga0070666_10416615 | 3300005335 | Bacteria | 967 |
| 27 | Ga0070680_100001000 | 3300005336 | Bacteria | 20117 |
| 28 | Ga0070680_100004158 | 3300005336 | Bacteria | 10844 |
| 29 | Ga0070680_100098331 | 3300005336 | Unclassified | 2427 |
| 30 | Ga0070682_100002611 | 3300005337 | Bacteria | 9950 |
| 31 | Ga0070682_100005034 | 3300005337 | Bacteria | 7344 |
| 32 | Ga0070682_100022910 | 3300005337 | Bacteria | 3705 |
| 33 | Ga0070682_100035137 | 3300005337 | Bacteria | 3057 |
| 34 | Ga0070682_100072785 | 3300005337 | Bacteria | 2203 |
| 35 | Ga0070682_100299938 | 3300005337 | Bacteria | 1179 |
| 36 | Ga0068868_100008846 | 3300005338 | Bacteria | 7214 |
| 37 | Ga0068868_100043808 | 3300005338 | Bacteria | 3496 |
| 38 | Ga0068868_100131979 | 3300005338 | Bacteria | 2044 |
| 39 | Ga0070660_100039302 | 3300005339 | Bacteria | 3596 |
| 40 | Ga0070660_100047557 | 3300005339 | Bacteria | 3293 |
| 41 | Ga0070660_100107638 | 3300005339 | Unclassified | 2215 |
| 42 | Ga0070660_100572524 | 3300005339 | Bacteria | 943 |
| 43 | Ga0070660_100728691 | 3300005339 | Unclassified | 832 |
| 44 | Ga0070660_101076415 | 3300005339 | Unclassified | 680 |
| 45 | Ga0070689_100048812 | 3300005340 | Bacteria | 3266 |
| 46 | Ga0070691_10091063 | 3300005341 | Bacteria | 1504 |
| 47 | Ga0070687_100000591 | 3300005343 | Bacteria | 12045 |
| 48 | Ga0070687_100999341 | 3300005343 | Unclassified | 606 |
| 49 | Ga0070661_100010002 | 3300005344 | Bacteria | 6583 |
| 50 | Ga0070661_100016393 | 3300005344 | Bacteria | 5237 |
| 51 | Ga0070661_100037902 | 3300005344 | Bacteria | 3508 |
| 52 | Ga0070661_100055181 | 3300005344 | Unclassified | 2910 |
| 53 | Ga0070661_100473180 | 3300005344 | Bacteria | 999 |
| 54 | Ga0070661_100964084 | 3300005344 | Unclassified | 706 |
| 55 | Ga0070692_10007544 | 3300005345 | Bacteria | 4796 |
| 56 | Ga0070692_10060475 | 3300005345 | Bacteria | 1994 |
| 57 | Ga0070692_10088121 | 3300005345 | Bacteria | 1683 |
| 58 | Ga0070692_10174083 | 3300005345 | Bacteria | 1243 |
| 59 | Ga0070668_100003850 | 3300005347 | Bacteria | 11077 |
| 60 | Ga0070668_100007138 | 3300005347 | Bacteria | 8280 |
| 61 | Ga0070668_100047269 | 3300005347 | Bacteria | 3308 |
| 62 | Ga0070668_100251306 | 3300005347 | Bacteria | 1468 |
| 63 | Ga0070668_100274659 | 3300005347 | Bacteria | 1406 |
| 64 | Ga0070669_100001600 | 3300005353 | Bacteria | 16366 |
| 65 | Ga0070669_100006094 | 3300005353 | Bacteria | 8701 |
| 66 | Ga0070669_100118683 | 3300005353 | Bacteria | 2015 |
| 67 | Ga0070669_100176485 | 3300005353 | Bacteria | 1669 |
| 68 | Ga0070675_100039320 | 3300005354 | Bacteria | 3860 |
| 69 | Ga0070675_100077057 | 3300005354 | Bacteria | 2774 |
| 70 | Ga0070675_100165595 | 3300005354 | Unclassified | 1904 |
| 71 | Ga0070671_100050443 | 3300005355 | Bacteria | 3461 |
| 72 | Ga0070671_100101987 | 3300005355 | Bacteria | 2408 |
| 73 | Ga0070671_101036606 | 3300005355 | Bacteria | 719 |
| 74 | Ga0070674_100019485 | 3300005356 | Bacteria | 4310 |
| 75 | Ga0070673_100058428 | 3300005364 | Bacteria | 3049 |
| 76 | Ga0070673_100083889 | 3300005364 | Bacteria | 2589 |
| 77 | Ga0070673_100403274 | 3300005364 | Bacteria | 1223 |
| 78 | Ga0070688_100012935 | 3300005365 | Bacteria | 4691 |
| 79 | Ga0070659_100013862 | 3300005366 | Bacteria | 6013 |
| 80 | Ga0070659_100035381 | 3300005366 | Bacteria | 3889 |
| 81 | Ga0070659_100110145 | 3300005366 | Bacteria | 2223 |
| 82 | Ga0070659_100788323 | 3300005366 | Bacteria | 826 |
| 83 | Ga0070667_100001076 | 3300005367 | Bacteria | 24988 |
| 84 | Ga0070667_100031163 | 3300005367 | Bacteria | 4445 |
| 85 | Ga0070667_101153971 | 3300005367 | Unclassified | 725 |
| 86 | Ga0070667_101423527 | 3300005367 | Unclassified | 650 |
| 87 | Ga0070703_10284665 | 3300005406 | Bacteria | 683 |
| 88 | Ga0070709_10001518 | 3300005434 | Bacteria | 12545 |
| 89 | Ga0070709_10198710 | 3300005434 | Bacteria | 1419 |
| 90 | Ga0070714_100008647 | 3300005435 | Bacteria | 7962 |
| 91 | Ga0070714_100063920 | 3300005435 | Bacteria | 3166 |
| 92 | Ga0070714_100487223 | 3300005435 | Bacteria | 1174 |
| 93 | Ga0070713_100257901 | 3300005436 | Bacteria | 1592 |
| 94 | Ga0070713_100268753 | 3300005436 | Bacteria | 1561 |
| 95 | Ga0070713_100286600 | 3300005436 | Bacteria | 1512 |
| 96 | Ga0070713_100542561 | 3300005436 | Bacteria | 1100 |
| 97 | Ga0070710_10030600 | 3300005437 | Bacteria | 2898 |
| 98 | Ga0070710_10052550 | 3300005437 | Bacteria | 2292 |
| 99 | Ga0070710_10159492 | 3300005437 | Bacteria | 1398 |
| 100 | Ga0070701_10014736 | 3300005438 | Bacteria | 3591 |
| 101 | Ga0070701_10168672 | 3300005438 | Bacteria | 1273 |
| 102 | Ga0070711_100022896 | 3300005439 | Bacteria | 4056 |
| 103 | Ga0070711_100154693 | 3300005439 | Bacteria | 1732 |
| 104 | Ga0070705_100031635 | 3300005440 | Bacteria | 2932 |
| 105 | Ga0070705_100693042 | 3300005440 | Bacteria | 799 |
| 106 | Ga0070705_100921558 | 3300005440 | Bacteria | 704 |
| 107 | Ga0070700_100030817 | 3300005441 | Bacteria | 3209 |
| 108 | Ga0070694_100142495 | 3300005444 | Bacteria | 1742 |
| 109 | Ga0070663_100009811 | 3300005455 | Bacteria | 5948 |
| 110 | Ga0070663_100083146 | 3300005455 | Bacteria | 2357 |
| 111 | Ga0070663_101272667 | 3300005455 | Bacteria | 648 |
| 112 | Ga0070678_100456361 | 3300005456 | Bacteria | 1120 |
| 113 | Ga0070662_100000676 | 3300005457 | Bacteria | 20794 |
| 114 | Ga0070662_100200299 | 3300005457 | Unclassified | 1584 |
| 115 | Ga0070681_10000554 | 3300005458 | Bacteria | 30814 |
| 116 | Ga0070681_10006906 | 3300005458 | Bacteria | 11050 |
| 117 | Ga0070681_10011203 | 3300005458 | Bacteria | 8872 |
| 118 | Ga0070681_10033452 | 3300005458 | Bacteria | 5161 |
| 119 | Ga0070681_10460822 | 3300005458 | Unclassified | 1183 |
| 120 | Ga0068867_100097053 | 3300005459 | Bacteria | 2245 |
| 121 | Ga0068867_100491234 | 3300005459 | Bacteria | 1053 |
| 122 | Ga0068867_100519253 | 3300005459 | Bacteria | 1027 |
| 123 | Ga0068867_100913298 | 3300005459 | Bacteria | 791 |
| 124 | Ga0070685_10097302 | 3300005466 | Bacteria | 1791 |
| 125 | Ga0070685_10128988 | 3300005466 | Bacteria | 1579 |
| 126 | Ga0070707_100029570 | 3300005468 | Bacteria | 5216 |
| 127 | Ga0070698_100000181 | 3300005471 | Bacteria | 59362 |
| 128 | Ga0070699_100068841 | 3300005518 | Bacteria | 3075 |
| 129 | Ga0070699_100091673 | 3300005518 | Bacteria | 2657 |
| 130 | Ga0070699_100319450 | 3300005518 | Bacteria | 1395 |
| 131 | Ga0070679_100000913 | 3300005530 | Bacteria | 25634 |
| 132 | Ga0070679_100001151 | 3300005530 | Bacteria | 23151 |
| 133 | Ga0070679_100024888 | 3300005530 | Bacteria | 5868 |
| 134 | Ga0070679_100038355 | 3300005530 | Bacteria | 4763 |
| 135 | Ga0070679_100206251 | 3300005530 | Bacteria | 1930 |
| 136 | Ga0070679_101569044 | 3300005530 | Bacteria | 606 |
| 137 | Ga0070684_100014938 | 3300005535 | Bacteria | 6303 |
| 138 | Ga0070684_100036110 | 3300005535 | Bacteria | 4234 |
| 139 | Ga0070684_100122424 | 3300005535 | Bacteria | 2341 |
| 140 | Ga0070684_100220425 | 3300005535 | Bacteria | 1731 |
| 141 | Ga0070684_100235410 | 3300005535 | Bacteria | 1673 |
| 142 | Ga0070684_100550508 | 3300005535 | Bacteria | 1071 |
| 143 | Ga0068853_100014672 | 3300005539 | Bacteria | 6426 |
| 144 | Ga0068853_101129578 | 3300005539 | Unclassified | 756 |
| 145 | Ga0070672_100044304 | 3300005543 | Bacteria | 3435 |
| 146 | Ga0070672_100053208 | 3300005543 | Bacteria | 3164 |
| 147 | Ga0070672_100372343 | 3300005543 | Bacteria | 1221 |
| 148 | Ga0070672_100755194 | 3300005543 | Unclassified | 854 |
| 149 | Ga0070672_100801550 | 3300005543 | Bacteria | 829 |
| 150 | Ga0070686_100078179 | 3300005544 | Bacteria | 2184 |
| 151 | Ga0070686_101223968 | 3300005544 | Unclassified | 624 |
| 152 | Ga0070695_100005050 | 3300005545 | Bacteria | 7777 |
| 153 | Ga0070695_100169338 | 3300005545 | Bacteria | 1540 |
| 154 | Ga0070695_100365579 | 3300005545 | Bacteria | 1085 |
| 155 | Ga0070696_100556086 | 3300005546 | Unclassified | 920 |
| 156 | Ga0070693_100572296 | 3300005547 | Bacteria | 812 |
| 157 | Ga0070665_100000141 | 3300005548 | Bacteria | 135473 |
| 158 | Ga0070665_100011876 | 3300005548 | Bacteria | 8796 |
| 159 | Ga0070665_100071712 | 3300005548 | Bacteria | 3471 |
| 160 | Ga0070665_100940423 | 3300005548 | Bacteria | 877 |
| 161 | Ga0070704_100056539 | 3300005549 | Bacteria | 2786 |
| 162 | Ga0070704_100618818 | 3300005549 | Bacteria | 953 |
| 163 | Ga0068855_100077943 | 3300005563 | Bacteria | 3845 |
| 164 | Ga0068855_100135428 | 3300005563 | Bacteria | 2811 |
| 165 | Ga0068855_100476014 | 3300005563 | Bacteria | 1360 |
| 166 | Ga0068855_100887862 | 3300005563 | Bacteria | 942 |
| 167 | Ga0070664_100007495 | 3300005564 | Bacteria | 8809 |
| 168 | Ga0070664_100007931 | 3300005564 | Bacteria | 8577 |
| 169 | Ga0070664_100044347 | 3300005564 | Bacteria | 3755 |
| 170 | Ga0070664_100045589 | 3300005564 | Unclassified | 3703 |
| 171 | Ga0070664_100163606 | 3300005564 | Bacteria | 1970 |
| 172 | Ga0070664_100916220 | 3300005564 | Bacteria | 822 |
| 173 | Ga0070664_101941682 | 3300005564 | Bacteria | 558 |
| 174 | Ga0068857_100005823 | 3300005577 | Bacteria | 10526 |
| 175 | Ga0068857_100060125 | 3300005577 | Bacteria | 3376 |
| 176 | Ga0068857_100061539 | 3300005577 | Bacteria | 3335 |
| 177 | Ga0068854_100006720 | 3300005578 | Bacteria | 7332 |
| 178 | Ga0068854_100081160 | 3300005578 | Bacteria | 2395 |
| 179 | Ga0068854_101312474 | 3300005578 | Bacteria | 652 |
| 180 | Ga0068856_100011418 | 3300005614 | Bacteria | 8616 |
| 181 | Ga0068856_100015710 | 3300005614 | Bacteria | 7318 |
| 182 | Ga0068856_100165712 | 3300005614 | Bacteria | 2221 |
| 183 | Ga0068856_100571679 | 3300005614 | Bacteria | 1151 |
| 184 | Ga0068856_102126307 | 3300005614 | Bacteria | 571 |
| 185 | Ga0070702_100011078 | 3300005615 | Bacteria | 4474 |
| 186 | Ga0070702_101613597 | 3300005615 | Bacteria | 537 |
| 187 | Ga0068852_100005517 | 3300005616 | Bacteria | 9067 |
| 188 | Ga0068852_101632956 | 3300005616 | Unclassified | 667 |
| 189 | Ga0068859_100256946 | 3300005617 | Bacteria | 1838 |
| 190 | Ga0068864_100000015 | 3300005618 | Bacteria | 303368 |
| 191 | Ga0068864_100267203 | 3300005618 | Bacteria | 1593 |
| 192 | Ga0068864_100557033 | 3300005618 | Bacteria | 1109 |
| 193 | Ga0068864_101309178 | 3300005618 | Bacteria | 725 |
| 194 | Ga0068861_100008729 | 3300005719 | Bacteria | 6975 |
| 195 | Ga0068861_100049676 | 3300005719 | Bacteria | 3177 |
| 196 | Ga0068861_100084338 | 3300005719 | Bacteria | 2494 |
| 197 | Ga0068861_100313583 | 3300005719 | Bacteria | 1364 |
| 198 | Ga0068861_100987796 | 3300005719 | Bacteria | 803 |
| 199 | Ga0068851_10011400 | 3300005834 | Bacteria | 4168 |
| 200 | Ga0068851_10036814 | 3300005834 | Bacteria | 2451 |
| 201 | Ga0068870_10038721 | 3300005840 | Bacteria | 2464 |
| 202 | Ga0068870_10148011 | 3300005840 | Bacteria | 1380 |
| 203 | Ga0068870_10211698 | 3300005840 | Bacteria | 1181 |
| 204 | Ga0068863_100006324 | 3300005841 | Bacteria | 11614 |
| 205 | Ga0068863_100131471 | 3300005841 | Bacteria | 2390 |
| 206 | Ga0068863_100488496 | 3300005841 | Bacteria | 1211 |
| 207 | Ga0068863_100618811 | 3300005841 | Bacteria | 1073 |
| 208 | Ga0068858_100000118 | 3300005842 | Bacteria | 83359 |
| 209 | Ga0068858_100014761 | 3300005842 | Bacteria | 7350 |
| 210 | Ga0068858_100314685 | 3300005842 | Unclassified | 1495 |
| 211 | Ga0068860_100013620 | 3300005843 | Bacteria | 7971 |
| 212 | Ga0068860_100275466 | 3300005843 | Bacteria | 1643 |
| 213 | Ga0068862_100000266 | 3300005844 | Bacteria | 58197 |
| 214 | Ga0068862_100000943 | 3300005844 | Bacteria | 28026 |
| 215 | Ga0068862_100076020 | 3300005844 | Bacteria | 2906 |
| 216 | Ga0068862_100103960 | 3300005844 | Bacteria | 2488 |
| 217 | Ga0068862_100478540 | 3300005844 | Bacteria | 1178 |
| 218 | Ga0081455_10025195 | 3300005937 | Bacteria | 5495 |
| 219 | Ga0081455_10414886 | 3300005937 | Bacteria | 930 |
| 220 | Ga0081538_10000099 | 3300005981 | Bacteria | 83947 |
| 221 | Ga0081538_10000318 | 3300005981 | Bacteria | 55086 |
| 222 | Ga0081538_10000473 | 3300005981 | Bacteria | 45178 |
| 223 | Ga0081538_10000623 | 3300005981 | Bacteria | 39341 |
| 224 | Ga0081538_10001033 | 3300005981 | Bacteria | 29696 |
| 225 | Ga0081538_10001060 | 3300005981 | Bacteria | 29322 |
| 226 | Ga0081538_10003949 | 3300005981 | Bacteria | 13830 |
| 227 | Ga0081538_10004775 | 3300005981 | Bacteria | 12388 |
| 228 | Ga0081538_10005946 | 3300005981 | Bacteria | 10859 |
| 229 | Ga0081538_10019166 | 3300005981 | Bacteria | 5100 |
| 230 | Ga0081538_10026358 | 3300005981 | Bacteria | 4066 |
| 231 | Ga0081538_10026976 | 3300005981 | Bacteria | 3997 |
| 232 | Ga0081538_10135688 | 3300005981 | Bacteria | 1146 |
| 233 | Ga0081539_10006318 | 3300005985 | Bacteria | 11443 |
| 234 | Ga0081539_10179135 | 3300005985 | Bacteria | 996 |
| 235 | Ga0070717_10012514 | 3300006028 | Bacteria | 6472 |
| 236 | Ga0070717_10035953 | 3300006028 | Bacteria | 4014 |
| 237 | Ga0070717_10037977 | 3300006028 | Bacteria | 3912 |
| 238 | Ga0070717_10829022 | 3300006028 | Bacteria | 842 |
| 239 | Ga0075364_10519368 | 3300006051 | Bacteria | 814 |
| 240 | Ga0075432_10003469 | 3300006058 | Bacteria | 5336 |
| 241 | Ga0070716_100001196 | 3300006173 | Bacteria | 11430 |
| 242 | Ga0070712_100013357 | 3300006175 | Bacteria | 5247 |
| 243 | Ga0097621_100051997 | 3300006237 | Bacteria | 3336 |
| 244 | Ga0097621_100563917 | 3300006237 | Unclassified | 1038 |
| 245 | Ga0068871_100370167 | 3300006358 | Bacteria | 1271 |
| 246 | Ga0075428_100022990 | 3300006844 | Bacteria | 6900 |
| 247 | Ga0075428_100319517 | 3300006844 | Bacteria | 1668 |
| 248 | Ga0075428_100376070 | 3300006844 | Bacteria | 1523 |
| 249 | Ga0075428_100448401 | 3300006844 | Bacteria | 1382 |
| 250 | Ga0075428_100690460 | 3300006844 | Bacteria | 1087 |
| 251 | Ga0075428_100831705 | 3300006844 | Bacteria | 981 |
| 252 | Ga0075430_100005498 | 3300006846 | Bacteria | 10706 |
| 253 | Ga0075430_100005965 | 3300006846 | Bacteria | 10286 |
| 254 | Ga0075430_100040239 | 3300006846 | Bacteria | 3957 |
| 255 | Ga0075430_100055547 | 3300006846 | Bacteria | 3330 |
| 256 | Ga0075430_100146085 | 3300006846 | Bacteria | 1970 |
| 257 | Ga0075430_100183035 | 3300006846 | Bacteria | 1742 |
| 258 | Ga0075430_100228309 | 3300006846 | Bacteria | 1544 |
| 259 | Ga0075430_100776631 | 3300006846 | Bacteria | 789 |
| 260 | Ga0075430_100831671 | 3300006846 | Unclassified | 761 |
| 261 | Ga0075431_100006641 | 3300006847 | Bacteria | 11488 |
| 262 | Ga0075431_100061098 | 3300006847 | Bacteria | 3888 |
| 263 | Ga0075431_100085595 | 3300006847 | Bacteria | 3254 |
| 264 | Ga0075431_100140800 | 3300006847 | Bacteria | 2486 |
| 265 | Ga0075431_100152295 | 3300006847 | Bacteria | 2381 |
| 266 | Ga0075431_100166533 | 3300006847 | Bacteria | 2266 |
| 267 | Ga0075431_100316761 | 3300006847 | Bacteria | 1574 |
| 268 | Ga0075431_100627596 | 3300006847 | Bacteria | 1057 |
| 269 | Ga0075431_101471849 | 3300006847 | Bacteria | 640 |
| 270 | Ga0075433_10014812 | 3300006852 | Bacteria | 6382 |
| 271 | Ga0075433_10016407 | 3300006852 | Bacteria | 6104 |
| 272 | Ga0075433_10024484 | 3300006852 | Bacteria | 5096 |
| 273 | Ga0075433_10028882 | 3300006852 | Bacteria | 4718 |
| 274 | Ga0075433_10049608 | 3300006852 | Bacteria | 3652 |
| 275 | Ga0075433_10241441 | 3300006852 | Bacteria | 1604 |
| 276 | Ga0075433_10394248 | 3300006852 | Bacteria | 1222 |
| 277 | Ga0075434_100003789 | 3300006871 | Bacteria | 13517 |
| 278 | Ga0075434_100028929 | 3300006871 | Bacteria | 5449 |
| 279 | Ga0075434_100042447 | 3300006871 | Bacteria | 4508 |
| 280 | Ga0075434_100422865 | 3300006871 | Bacteria | 1353 |
| 281 | Ga0075434_100586871 | 3300006871 | Bacteria | 1133 |
| 282 | Ga0075429_100011262 | 3300006880 | Bacteria | 7741 |
| 283 | Ga0075429_100029286 | 3300006880 | Bacteria | 4783 |
| 284 | Ga0075429_100047715 | 3300006880 | Bacteria | 3725 |
| 285 | Ga0075429_100692558 | 3300006880 | Bacteria | 893 |
| 286 | Ga0075429_101042475 | 3300006880 | Bacteria | 715 |
| 287 | Ga0068865_100074035 | 3300006881 | Bacteria | 2424 |
| 288 | Ga0068865_100074186 | 3300006881 | Bacteria | 2422 |
| 289 | Ga0075436_100010365 | 3300006914 | Bacteria | 6385 |
| 290 | Ga0075436_100253750 | 3300006914 | Unclassified | 1253 |
| 291 | Ga0097620_100256959 | 3300006931 | Bacteria | 1838 |
| 292 | Ga0075435_100086662 | 3300007076 | Bacteria | 2579 |
| 293 | Ga0075435_100164988 | 3300007076 | Bacteria | 1867 |
| 294 | Ga0075435_100289660 | 3300007076 | Bacteria | 1399 |
| 295 | Ga0075435_100654677 | 3300007076 | Bacteria | 912 |
| 296 | Ga0075435_100924352 | 3300007076 | Unclassified | 761 |
| 297 | Ga0099795_10031030 | 3300007788 | Unclassified | 1838 |
| 298 | Ga0105244_10112939 | 3300009036 | Bacteria | 1320 |
| 299 | Ga0105240_11230602 | 3300009093 | Bacteria | 792 |
| 300 | Ga0111539_10015589 | 3300009094 | Bacteria | 9449 |
| 301 | Ga0111539_10016514 | 3300009094 | Bacteria | 9153 |
| 302 | Ga0111539_10061276 | 3300009094 | Bacteria | 4458 |
| 303 | Ga0111539_10099199 | 3300009094 | Bacteria | 3421 |
| 304 | Ga0111539_10881003 | 3300009094 | Bacteria | 1041 |
| 305 | Ga0111539_11165816 | 3300009094 | Unclassified | 895 |
| 306 | Ga0105245_10000517 | 3300009098 | Bacteria | 35353 |
| 307 | Ga0105245_10002315 | 3300009098 | Bacteria | 17235 |
| 308 | Ga0105245_10008594 | 3300009098 | Bacteria | 8906 |
| 309 | Ga0105245_10027258 | 3300009098 | Bacteria | 5034 |
| 310 | Ga0105245_10260723 | 3300009098 | Bacteria | 1687 |
| 311 | Ga0105245_10572386 | 3300009098 | Bacteria | 1153 |
| 312 | Ga0105247_10059316 | 3300009101 | Bacteria | 2369 |
| 313 | Ga0105247_10475716 | 3300009101 | Unclassified | 906 |
| 314 | Ga0105247_10793586 | 3300009101 | Bacteria | 722 |
| 315 | Ga0114129_10009856 | 3300009147 | Bacteria | 13625 |
| 316 | Ga0114129_10028714 | 3300009147 | Bacteria | 7882 |
| 317 | Ga0114129_10034392 | 3300009147 | Bacteria | 7158 |
| 318 | Ga0114129_10070947 | 3300009147 | Bacteria | 4857 |
| 319 | Ga0114129_10071219 | 3300009147 | Bacteria | 4848 |
| 320 | Ga0114129_10126508 | 3300009147 | Bacteria | 3513 |
| 321 | Ga0114129_10299267 | 3300009147 | Bacteria | 2145 |
| 322 | Ga0114129_10337836 | 3300009147 | Bacteria | 1998 |
| 323 | Ga0114129_12708544 | 3300009147 | Bacteria | 591 |
| 324 | Ga0105243_10010712 | 3300009148 | Bacteria | 6947 |
| 325 | Ga0105241_10087270 | 3300009174 | Bacteria | 2455 |
| 326 | Ga0105241_10588904 | 3300009174 | Bacteria | 1003 |
| 327 | Ga0105242_10058363 | 3300009176 | Bacteria | 3163 |
| 328 | Ga0105242_10332659 | 3300009176 | Bacteria | 1397 |
| 329 | Ga0105242_10750350 | 3300009176 | Unclassified | 961 |
| 330 | Ga0105242_11230428 | 3300009176 | Unclassified | 769 |
| 331 | Ga0105248_10112123 | 3300009177 | Bacteria | 3076 |
| 332 | Ga0105248_10167255 | 3300009177 | Bacteria | 2478 |
| 333 | Ga0105248_10411253 | 3300009177 | Bacteria | 1523 |
| 334 | Ga0105237_11088948 | 3300009545 | Unclassified | 806 |
| 335 | Ga0105249_10000178 | 3300009553 | Bacteria | 74768 |
| 336 | Ga0105249_10000199 | 3300009553 | Bacteria | 68792 |
| 337 | Ga0105249_10003509 | 3300009553 | Bacteria | 13564 |
| 338 | Ga0105249_10013016 | 3300009553 | Bacteria | 7341 |
| 339 | Ga0105249_10027036 | 3300009553 | Bacteria | 5175 |
| 340 | Ga0105249_10523139 | 3300009553 | Bacteria | 1234 |
| 341 | Ga0099796_10204813 | 3300010159 | Unclassified | 802 |
| 342 | Ga0105239_10028036 | 3300010375 | Bacteria | 6197 |
| 343 | Ga0105239_10181598 | 3300010375 | Bacteria | 2354 |
| 344 | Ga0105246_10019647 | 3300011119 | Bacteria | 4322 |
| 345 | Ga0105246_10107963 | 3300011119 | Bacteria | 2039 |
| 346 | Ga0105246_10753625 | 3300011119 | Bacteria | 859 |
| 347 | Ga0157373_10121074 | 3300013100 | Bacteria | 1839 |
| 348 | Ga0157373_10142020 | 3300013100 | Bacteria | 1689 |
| 349 | Ga0157373_10308900 | 3300013100 | Bacteria | 1123 |
| 350 | Ga0157371_10017614 | 3300013102 | Bacteria | 5300 |
| 351 | Ga0157369_10128039 | 3300013105 | Bacteria | 2691 |
| 352 | Ga0157369_10257524 | 3300013105 | Bacteria | 1820 |
| 353 | Ga0157374_10036246 | 3300013296 | Bacteria | 4517 |
| 354 | Ga0157374_10206077 | 3300013296 | Bacteria | 1927 |
| 355 | Ga0157374_10390192 | 3300013296 | Unclassified | 1388 |
| 356 | Ga0157378_10067243 | 3300013297 | Bacteria | 3211 |
| 357 | Ga0157378_10618737 | 3300013297 | Bacteria | 1096 |
| 358 | Ga0163162_10006653 | 3300013306 | Bacteria | 11208 |
| 359 | Ga0163162_10011116 | 3300013306 | Bacteria | 8769 |
| 360 | Ga0163162_10072923 | 3300013306 | Bacteria | 3488 |
| 361 | Ga0163162_10350011 | 3300013306 | Bacteria | 1610 |
| 362 | Ga0157372_10006253 | 3300013307 | Bacteria | 12664 |
| 363 | Ga0157372_10030500 | 3300013307 | Bacteria | 5899 |
| 364 | Ga0157372_10119700 | 3300013307 | Bacteria | 3023 |
| 365 | Ga0157372_10295055 | 3300013307 | Bacteria | 1885 |
| 366 | Ga0157375_10015328 | 3300013308 | Bacteria | 6858 |
| 367 | Ga0157375_10059940 | 3300013308 | Bacteria | 3772 |
| 368 | Ga0157375_10301273 | 3300013308 | Unclassified | 1766 |
| 369 | Ga0157375_10591421 | 3300013308 | Bacteria | 1269 |
| 370 | Ga0157375_11075140 | 3300013308 | Bacteria | 941 |
| 371 | Ga0163163_10091411 | 3300014325 | Bacteria | 3058 |
| 372 | Ga0163163_10175620 | 3300014325 | Bacteria | 2189 |
| 373 | Ga0157380_10022328 | 3300014326 | Bacteria | 4761 |
| 374 | Ga0157380_10038130 | 3300014326 | Bacteria | 3729 |
| 375 | Ga0157380_10502783 | 3300014326 | Bacteria | 1178 |
| 376 | Ga0157380_10808228 | 3300014326 | Unclassified | 955 |
| 377 | Ga0157377_10006554 | 3300014745 | Bacteria | 5561 |
| 378 | Ga0157377_10060916 | 3300014745 | Unclassified | 2155 |
| 379 | Ga0157377_10361371 | 3300014745 | Bacteria | 977 |
| 380 | Ga0157379_10002058 | 3300014968 | Bacteria | 16705 |
| 381 | Ga0157379_10008193 | 3300014968 | Bacteria | 9076 |
| 382 | Ga0157379_10011155 | 3300014968 | Bacteria | 7832 |
| 383 | Ga0157379_10379494 | 3300014968 | Bacteria | 1297 |
| 384 | Ga0157376_10190070 | 3300014969 | Bacteria | 1882 |
| 385 | Ga0182007_10031396 | 3300015262 | Bacteria | 1809 |
| 386 | Ga0182007_10050444 | 3300015262 | Unclassified | 1374 |
| 387 | Ga0163161_10141770 | 3300017792 | Bacteria | 1820 |
| 388 | Ga0213876_10468401 | 3300021384 | Bacteria | 670 |
| 389 | Ga0213875_10000092 | 3300021388 | Bacteria | 104416 |
| 390 | Ga0207682_10000155 | 3300025893 | Bacteria | 31180 |
| 391 | Ga0207692_10039942 | 3300025898 | Bacteria | 2312 |
| 392 | Ga0207692_10304844 | 3300025898 | Bacteria | 970 |
| 393 | Ga0207688_10001463 | 3300025901 | Bacteria | 12379 |
| 394 | Ga0207688_10032737 | 3300025901 | Bacteria | 2874 |
| 395 | Ga0207647_10408923 | 3300025904 | Bacteria | 764 |
| 396 | Ga0207685_10028047 | 3300025905 | Bacteria | 1978 |
| 397 | Ga0207699_10086951 | 3300025906 | Bacteria | 1953 |
| 398 | Ga0207699_10654453 | 3300025906 | Bacteria | 767 |
| 399 | Ga0207645_10299443 | 3300025907 | Unclassified | 1071 |
| 400 | Ga0207654_10049139 | 3300025911 | Bacteria | 2417 |
| 401 | Ga0207707_10033886 | 3300025912 | Bacteria | 4469 |
| 402 | Ga0207707_10088907 | 3300025912 | Unclassified | 2699 |
| 403 | Ga0207693_10004163 | 3300025915 | Bacteria | 12273 |
| 404 | Ga0207693_10103732 | 3300025915 | Bacteria | 2230 |
| 405 | Ga0207663_10178801 | 3300025916 | Bacteria | 1513 |
| 406 | Ga0207660_10051661 | 3300025917 | Bacteria | 2923 |
| 407 | Ga0207657_10486435 | 3300025919 | Bacteria | 967 |
| 408 | Ga0207657_10984520 | 3300025919 | Bacteria | 647 |
| 409 | Ga0207649_10006670 | 3300025920 | Bacteria | 6273 |
| 410 | Ga0207652_10003179 | 3300025921 | Bacteria | 13657 |
| 411 | Ga0207681_10235176 | 3300025923 | Bacteria | 1424 |
| 412 | Ga0207687_10000085 | 3300025927 | Bacteria | 68919 |
| 413 | Ga0207687_10040757 | 3300025927 | Bacteria | 3185 |
| 414 | Ga0207700_10105546 | 3300025928 | Bacteria | 2256 |
| 415 | Ga0207700_10191297 | 3300025928 | Bacteria | 1720 |
| 416 | Ga0207700_10216653 | 3300025928 | Bacteria | 1621 |
| 417 | Ga0207700_10744706 | 3300025928 | Bacteria | 876 |
| 418 | Ga0207700_11166138 | 3300025928 | Bacteria | 688 |
| 419 | Ga0207664_10006572 | 3300025929 | Bacteria | 8005 |
| 420 | Ga0207664_10119433 | 3300025929 | Bacteria | 2204 |
| 421 | Ga0207664_10977120 | 3300025929 | Bacteria | 759 |
| 422 | Ga0207644_10905327 | 3300025931 | Bacteria | 739 |
| 423 | Ga0207690_10006710 | 3300025932 | Bacteria | 6820 |
| 424 | Ga0207709_10014822 | 3300025935 | Bacteria | 4310 |
| 425 | Ga0207670_10774233 | 3300025936 | Bacteria | 798 |
| 426 | Ga0207704_11396538 | 3300025938 | Bacteria | 600 |
| 427 | Ga0207691_10041776 | 3300025940 | Bacteria | 4231 |
| 428 | Ga0207711_10284537 | 3300025941 | Bacteria | 1523 |
| 429 | Ga0207689_10018894 | 3300025942 | Bacteria | 5813 |
| 430 | Ga0207689_10196142 | 3300025942 | Bacteria | 1666 |
| 431 | Ga0207661_10005670 | 3300025944 | Bacteria | 8809 |
| 432 | Ga0207661_10022461 | 3300025944 | Bacteria | 4753 |
| 433 | Ga0207661_10045458 | 3300025944 | Bacteria | 3476 |
| 434 | Ga0207661_10825994 | 3300025944 | Unclassified | 853 |
| 435 | Ga0207679_10017271 | 3300025945 | Bacteria | 4810 |
| 436 | Ga0207679_10166573 | 3300025945 | Bacteria | 1810 |
| 437 | Ga0207651_10362453 | 3300025960 | Bacteria | 1224 |
| 438 | Ga0207712_10000118 | 3300025961 | Bacteria | 85518 |
| 439 | Ga0207712_10011490 | 3300025961 | Bacteria | 5642 |
| 440 | Ga0207712_10172949 | 3300025961 | Bacteria | 1690 |
| 441 | Ga0207712_10717794 | 3300025961 | Bacteria | 873 |
| 442 | Ga0207668_10003764 | 3300025972 | Bacteria | 8932 |
| 443 | Ga0207668_10031903 | 3300025972 | Bacteria | 3475 |
| 444 | Ga0207668_10205640 | 3300025972 | Bacteria | 1571 |
| 445 | Ga0207640_10004771 | 3300025981 | Bacteria | 7361 |
| 446 | Ga0207658_10003877 | 3300025986 | Bacteria | 10532 |
| 447 | Ga0207677_10027216 | 3300026023 | Bacteria | 3597 |
| 448 | Ga0207677_12113950 | 3300026023 | Bacteria | 524 |
| 449 | Ga0207703_10000061 | 3300026035 | Bacteria | 132671 |
| 450 | Ga0207703_10321273 | 3300026035 | Unclassified | 1418 |
| 451 | Ga0207639_10008945 | 3300026041 | Bacteria | 6892 |
| 452 | Ga0207678_10196352 | 3300026067 | Bacteria | 1725 |
| 453 | Ga0207708_10002521 | 3300026075 | Bacteria | 13466 |
| 454 | Ga0207708_10022177 | 3300026075 | Bacteria | 4795 |
| 455 | Ga0207708_10487982 | 3300026075 | Unclassified | 1031 |
| 456 | Ga0207702_10064452 | 3300026078 | Bacteria | 3136 |
| 457 | Ga0207702_10069870 | 3300026078 | Bacteria | 3019 |
| 458 | Ga0207676_10000018 | 3300026095 | Bacteria | 306375 |
| 459 | Ga0207676_10045515 | 3300026095 | Bacteria | 3391 |
| 460 | Ga0207675_100190001 | 3300026118 | Bacteria | 1970 |
| 461 | Ga0207675_100229136 | 3300026118 | Bacteria | 1792 |
| 462 | Ga0207675_101330844 | 3300026118 | Bacteria | 739 |
| 463 | Ga0207683_10039762 | 3300026121 | Bacteria | 4103 |
| 464 | Ga0209984_1019660 | 3300027424 | Unclassified | 919 |
| 465 | Ga0209995_1008004 | 3300027471 | Bacteria | 1704 |
| 466 | Ga0209179_1022874 | 3300027512 | Unclassified | 1230 |
| 467 | Ga0209982_1026936 | 3300027552 | Unclassified | 897 |
| 468 | Ga0209998_10000320 | 3300027717 | Bacteria | 14382 |
| 469 | Ga0207428_10040292 | 3300027907 | Bacteria | 3790 |
| 470 | Ga0207428_10238666 | 3300027907 | Bacteria | 1359 |
| 471 | Ga0268266_10000056 | 3300028379 | Bacteria | 289176 |
| 472 | Ga0268266_10026262 | 3300028379 | Bacteria | 4956 |
| 473 | Ga0268266_10585279 | 3300028379 | Bacteria | 1071 |
| 474 | Ga0268266_11341145 | 3300028379 | Bacteria | 691 |
| 475 | Ga0268265_10001477 | 3300028380 | Bacteria | 19727 |
| 476 | Ga0268265_10189223 | 3300028380 | Bacteria | 1776 |
| 477 | Ga0268265_10535504 | 3300028380 | Bacteria | 1109 |
| 478 | Ga0307408_100444973 | 3300031548 | Bacteria | 1123 |
| 479 | Ga0307405_12104759 | 3300031731 | Bacteria | 506 |
| 480 | Ga0307413_10090794 | 3300031824 | Unclassified | 1988 |
| 481 | Ga0307406_10332294 | 3300031901 | Bacteria | 1180 |
| 482 | Ga0307406_10931181 | 3300031901 | Bacteria | 741 |
| 483 | Ga0307407_10351094 | 3300031903 | Bacteria | 1044 |
| 484 | Ga0307407_10441894 | 3300031903 | Bacteria | 942 |
| 485 | Ga0307412_10135813 | 3300031911 | Bacteria | 1794 |
| 486 | Ga0307409_100171002 | 3300031995 | Bacteria | 1912 |
| 487 | Ga0307409_100203821 | 3300031995 | Bacteria | 1772 |
| 488 | Ga0307409_100467354 | 3300031995 | Bacteria | 1221 |
| 489 | Ga0307409_101085030 | 3300031995 | Bacteria | 821 |
| 490 | Ga0307416_100181068 | 3300032002 | Bacteria | 1975 |
| 491 | Ga0307416_100264505 | 3300032002 | Bacteria | 1684 |
| 492 | Ga0307416_100288071 | 3300032002 | Bacteria | 1624 |
| 493 | Ga0307416_100426506 | 3300032002 | Bacteria | 1372 |
| 494 | Ga0307416_100426966 | 3300032002 | Bacteria | 1371 |
| 495 | Ga0307416_101572998 | 3300032002 | Unclassified | 763 |
| 496 | Ga0307414_10157643 | 3300032004 | Bacteria | 1799 |
| 497 | Ga0307414_11171869 | 3300032004 | Bacteria | 711 |
| 498 | Ga0307411_10414930 | 3300032005 | Bacteria | 1117 |
| 499 | Ga0307415_100779586 | 3300032126 | Bacteria | 871 |
| 500 | Ga0373923_0084751 | 3300035111 | Bacteria | 1379 |
| 501 | Ga0373932_0124646 | 3300035112 | Bacteria | 862 |
| 502 | Ga0373946_0174613 | 3300035171 | Unclassified | 1016 |
| 503 | Ga0373942_0005002 | 3300035207 | Bacteria | 3073 |
| 504 | Ga0373961_0038447 | 3300035241 | Bacteria | 1371 |
| 505 | Ga0373961_0140984 | 3300035241 | Bacteria | 814 |
| 506 | Ga0373962_0061522 | 3300035242 | Bacteria | 1104 |
| 507 | Ga0373935_0997933 | 3300035692 | Bacteria | 622 |
| 508 | Ga0373933_0215486 | 3300035724 | Bacteria | 1231 |
| 509 | Ga0373937_0023832 | 3300036401 | Bacteria | 5517 |
| 510 | Ga0373937_0505888 | 3300036401 | Bacteria | 1148 |
| 511 | Ga0373937_0900362 | 3300036401 | Bacteria | 833 |
| 512 | Ga0395900_1344206 | 3300037418 | Bacteria | 628 |
| 513 | Ga0395898_0281982 | 3300037466 | Bacteria | 1585 |
| 514 | Ga0395898_0311782 | 3300037466 | Bacteria | 1501 |
| 515 | Ga0395898_0396264 | 3300037466 | Bacteria | 1316 |
| 516 | Ga0436364_0101821 | 3300037853 | Bacteria | 691 |
| 517 | Ga0436364_0527355 | 3300037853 | Bacteria | 148076 |
| 518 | Ga0436364_0871836 | 3300037853 | Bacteria | 535 |
| 519 | Ga0436364_1212621 | 3300037853 | Bacteria | 3725 |
| 520 | Ga0395901_0047569 | 3300038443 | Bacteria | 4454 |
| 521 | Ga0395901_0235963 | 3300038443 | Bacteria | 1909 |
| 522 | Ga0395901_0450187 | 3300038443 | Bacteria | 1317 |
| 523 | Ga0395901_1409479 | 3300038443 | Bacteria | 655 |
| 524 | Ga0436365_0584781 | 3300039437 | Bacteria | 2593 |
| 525 | Ga0436363_1072591 | 3300039450 | Bacteria | 1059 |
| 526 | Ga0451853_0066269 | 3300041512 | Bacteria | 5213 |
| 527 | Ga0439455_0141456 | 3300042012 | Bacteria | 682 |
| 528 | Ga0439444_0026038 | 3300042437 | Bacteria | 1068 |
| 529 | Ga0439460_0032601 | 3300042461 | Bacteria | 1493 |
| 530 | Ga0439440_0084737 | 3300042993 | Bacteria | 843 |
| 531 | Ga0466969_0047859 | 3300044656 | Bacteria | 2116 |
| 532 | Ga0466966_0050150 | 3300044684 | Bacteria | 2656 |
| 533 | Ga0466966_0215976 | 3300044684 | Bacteria | 1158 |
| 534 | Ga0466966_0788448 | 3300044684 | Bacteria | 573 |
| 535 | Ga0466961_0033653 | 3300044693 | Bacteria | 3292 |
| 536 | Ga0466961_0632880 | 3300044693 | Bacteria | 642 |
| 537 | Ga0466963_0000004 | 3300044694 | Bacteria | 102526 |
| 538 | Ga0466963_0194549 | 3300044694 | Bacteria | 1417 |
| 539 | Ga0466964_0032811 | 3300044706 | Bacteria | 2065 |
| 540 | Ga0466957_1035931 | 3300044842 | Bacteria | 590 |
| 541 | Ga0466957_1240084 | 3300044842 | Bacteria | 540 |
| 542 | Ga0466960_0239216 | 3300044901 | Bacteria | 1005 |
| 543 | Ga0466959_0143418 | 3300045049 | Bacteria | 1687 |
| 544 | Ga0466959_0308002 | 3300045049 | Bacteria | 1084 |
| 545 | Ga0466959_0784177 | 3300045049 | Bacteria | 637 |
| 546 | Ga0466958_0024372 | 3300045836 | Bacteria | 3560 |
| 547 | Ga0466958_0360228 | 3300045836 | Bacteria | 937 |
| 548 | Ga0466958_0839676 | 3300045836 | Bacteria | 599 |
| 549 | Ga0495629_0162383 | 3300046459 | Bacteria | 1552 |
| 550 | Ga0495629_0225157 | 3300046459 | Bacteria | 1293 |
| 551 | Ga0495641_0000005 | 3300046461 | Bacteria | 206626 |
| 552 | Ga0495641_0039116 | 3300046461 | Bacteria | 2213 |
| 553 | Ga0495641_0120749 | 3300046461 | Bacteria | 1169 |
| 554 | Ga0495651_0011617 | 3300046462 | Bacteria | 6768 |
| 555 | Ga0495653_0128610 | 3300046463 | Bacteria | 1796 |
| 556 | Ga0495653_0221127 | 3300046463 | Bacteria | 1273 |
| 557 | Ga0495653_0466412 | 3300046463 | Bacteria | 792 |
| 558 | Ga0495662_0054000 | 3300046476 | Bacteria | 1941 |
| 559 | Ga0495596_0025129 | 3300046500 | Bacteria | 2409 |
| 560 | Ga0495608_0053756 | 3300046511 | Bacteria | 2664 |
| 561 | Ga0495608_0093867 | 3300046511 | Bacteria | 1938 |
| 562 | Ga0495620_0000972 | 3300046515 | Bacteria | 17645 |
| 563 | Ga0495620_0209224 | 3300046515 | Bacteria | 749 |
| 564 | Ga0495628_0323122 | 3300046516 | Bacteria | 1138 |
| 565 | Ga0495628_0454158 | 3300046516 | Bacteria | 930 |
| 566 | Ga0495628_0947914 | 3300046516 | Bacteria | 595 |
| 567 | Ga0495630_0045063 | 3300046517 | Bacteria | 3295 |
| 568 | Ga0495631_0375151 | 3300046518 | Bacteria | 605 |
| 569 | Ga0495644_0078707 | 3300046523 | Bacteria | 1242 |
| 570 | Ga0495663_0166487 | 3300046525 | Bacteria | 758 |
| 571 | Ga0495652_0003765 | 3300046529 | Bacteria | 14828 |
| 572 | Ga0495652_0263669 | 3300046529 | Bacteria | 1270 |
| 573 | Ga0495587_0019289 | 3300046536 | Bacteria | 4223 |
| 574 | Ga0495598_0126442 | 3300046537 | Bacteria | 872 |
| 575 | Ga0495597_0341472 | 3300046542 | Bacteria | 576 |
| 576 | Ga0495645_0142490 | 3300046543 | Bacteria | 1671 |
| 577 | Ga0495667_0026645 | 3300046559 | Bacteria | 3896 |
| 578 | Ga0495667_0182188 | 3300046559 | Bacteria | 1347 |
| 579 | Ga0495656_0000876 | 3300046615 | Bacteria | 9730 |
| 580 | Ga0495625_0000688 | 3300046660 | Bacteria | 48233 |
| 581 | Ga0495635_0938879 | 3300046663 | Bacteria | 553 |
| 582 | Ga0495588_0538625 | 3300046674 | Unclassified | 612 |
| 583 | Ga0495657_0426170 | 3300046675 | Bacteria | 778 |
| 584 | Ga0495599_0028373 | 3300046678 | Bacteria | 3508 |
| 585 | Ga0495647_0000001 | 3300046681 | Bacteria | 222371 |
| 586 | Ga0495669_0000076 | 3300046684 | Bacteria | 65203 |
| 587 | Ga0495649_0003116 | 3300046694 | Bacteria | 11358 |
| 588 | Ga0495600_0033198 | 3300046809 | Bacteria | 3350 |
| 589 | Ga0495600_0075765 | 3300046809 | Bacteria | 2197 |
| 590 | Ga0495600_0419674 | 3300046809 | Bacteria | 830 |
| 591 | Ga0495660_0319139 | 3300046810 | Bacteria | 699 |
| 592 | Ga0495581_0278135 | 3300047315 | Bacteria | 979 |
| 593 | Ga0495604_0109898 | 3300047317 | Bacteria | 2012 |
| 594 | Ga0495674_0154770 | 3300047319 | Bacteria | 1921 |
| 595 | Ga0495674_0272861 | 3300047319 | Bacteria | 1387 |
| 596 | Ga0495674_0550544 | 3300047319 | Bacteria | 918 |
| 597 | Ga0495676_0000238 | 3300047321 | Bacteria | 44160 |
| 598 | Ga0495680_0000488 | 3300047322 | Bacteria | 44631 |
| 599 | Ga0495680_0014912 | 3300047322 | Bacteria | 6717 |
| 600 | Ga0495680_0495093 | 3300047322 | Bacteria | 830 |
| 601 | Ga0495684_0221941 | 3300047471 | Bacteria | 1385 |
| 602 | Ga0495593_0117786 | 3300047673 | Bacteria | 1353 |
| 603 | Ga0495593_0155920 | 3300047673 | Bacteria | 1154 |
| 604 | Ga0495602_0296301 | 3300048088 | Bacteria | 1185 |
| 605 | Ga0495614_0198967 | 3300048089 | Bacteria | 906 |
| 606 | Ga0495615_0165603 | 3300048090 | Bacteria | 666 |
| 607 | Ga0496100_0000059 | 3300048903 | Bacteria | 65518 |
| 608 | Ga0496100_0071390 | 3300048903 | Bacteria | 2318 |
| 609 | Ga0496101_0000135 | 3300048904 | Bacteria | 65518 |
| 610 | Ga0496102_0010453 | 3300048905 | Bacteria | 7987 |
| 611 | Ga0496103_0007100 | 3300048906 | Bacteria | 6688 |
| 612 | Ga0496104_0000025 | 3300048907 | Bacteria | 228519 |
| 613 | Ga0496104_0036817 | 3300048907 | Bacteria | 4575 |
| 614 | Ga0496104_0172010 | 3300048907 | Bacteria | 2077 |
| 615 | Ga0496104_1398966 | 3300048907 | Bacteria | 603 |
| 616 | Ga0496105_0000023 | 3300048908 | Bacteria | 156126 |
| 617 | Ga0496105_0053603 | 3300048908 | Bacteria | 3330 |
| 618 | Ga0496105_0541865 | 3300048908 | Bacteria | 909 |
| 619 | Ga0496105_1029146 | 3300048908 | Bacteria | 614 |
| 620 | Ga0496106_0000252 | 3300048909 | Bacteria | 37666 |
| 621 | Ga0496106_0028208 | 3300048909 | Bacteria | 4181 |
| 622 | Ga0496107_0000054 | 3300048910 | Bacteria | 60902 |
| 623 | Ga0496107_0820495 | 3300048910 | Bacteria | 680 |
| 624 | Ga0496108_0000006 | 3300048911 | Bacteria | 469473 |
| 625 | Ga0496108_0072626 | 3300048911 | Bacteria | 2904 |
| 626 | Ga0496108_0176271 | 3300048911 | Bacteria | 1851 |
| 627 | Ga0496108_0500656 | 3300048911 | Bacteria | 1061 |
| 628 | Ga0496109_0000009 | 3300048912 | Bacteria | 236561 |
| 629 | Ga0496109_0013153 | 3300048912 | Bacteria | 7161 |
| 630 | Ga0496109_0323372 | 3300048912 | Bacteria | 1456 |
| 631 | Ga0496110_0017977 | 3300048913 | Bacteria | 5922 |
| 632 | Ga0496111_0011889 | 3300048914 | Bacteria | 5881 |
| 633 | Ga0496111_0013645 | 3300048914 | Bacteria | 5535 |
| 634 | Ga0496111_0419064 | 3300048914 | Bacteria | 989 |
| 635 | Ga0496112_0006893 | 3300048915 | Bacteria | 10021 |
| 636 | Ga0496112_0293721 | 3300048915 | Bacteria | 1571 |
| 637 | Ga0496112_0345347 | 3300048915 | Bacteria | 1431 |
| 638 | Ga0496112_0714082 | 3300048915 | Bacteria | 930 |
| 639 | Ga0496113_0003664 | 3300048916 | Bacteria | 9245 |
| 640 | Ga0496113_0009882 | 3300048916 | Bacteria | 6284 |
| 641 | Ga0496113_0027027 | 3300048916 | Bacteria | 4109 |
| 642 | Ga0496113_0161084 | 3300048916 | Bacteria | 1774 |
| 643 | Ga0496113_0960070 | 3300048916 | Bacteria | 674 |
| 644 | Ga0496114_0006763 | 3300048917 | Bacteria | 9033 |
| 645 | Ga0496114_0208921 | 3300048917 | Bacteria | 1712 |
| 646 | Ga0496114_0379134 | 3300048917 | Bacteria | 1252 |
| 647 | Ga0496114_0803710 | 3300048917 | Bacteria | 819 |
| 648 | Ga0496115_0302569 | 3300048918 | Bacteria | 1310 |
| 649 | Ga0496115_0620962 | 3300048918 | Bacteria | 857 |
| 650 | Ga0496125_0052439 | 3300048928 | Bacteria | 3354 |
| 651 | Ga0501031_0145127 | 3300049568 | Bacteria | 1551 |
| 652 | Ga0501036_0269376 | 3300049572 | Bacteria | 1426 |
| 653 | Ga0501036_0886598 | 3300049572 | Bacteria | 733 |
| 654 | Ga0501038_0581847 | 3300049574 | Bacteria | 849 |
| 655 | Ga0501039_0083616 | 3300049575 | Bacteria | 2486 |
| 656 | Ga0501039_1353687 | 3300049575 | Bacteria | 549 |
| 657 | Ga0501040_0068674 | 3300049576 | Bacteria | 2444 |
| 658 | Ga0501041_0831293 | 3300049577 | Bacteria | 593 |
| 659 | Ga0501042_0063320 | 3300049578 | Bacteria | 2643 |
| 660 | Ga0501042_0398993 | 3300049578 | Bacteria | 996 |
| 661 | Ga0501046_0253760 | 3300049580 | Bacteria | 1294 |
| 662 | Ga0501070_0125458 | 3300049586 | Bacteria | 2121 |
| 663 | Ga0501074_0246545 | 3300049590 | Bacteria | 1270 |
| 664 | Ga0501075_0729051 | 3300049591 | Bacteria | 755 |
| 665 | Ga0501076_0202845 | 3300049592 | Bacteria | 1620 |
| 666 | Ga0501076_0501048 | 3300049592 | Bacteria | 1001 |
| 667 | Ga0501233_174061 | 3300049668 | Unclassified | 613 |
| 668 | Ga0501235_136960 | 3300049669 | Bacteria | 624 |
| 669 | Ga0501079_0325836 | 3300049741 | Bacteria | 1203 |
| 670 | Ga0501079_0347697 | 3300049741 | Bacteria | 1162 |
| 671 | Ga0501080_1095936 | 3300049742 | Bacteria | 688 |
| 672 | Ga0501081_0092097 | 3300049743 | Bacteria | 2133 |
| 673 | Ga0501081_0148679 | 3300049743 | Bacteria | 1682 |
| 674 | Ga0501081_1465787 | 3300049743 | Bacteria | 518 |
| 675 | Ga0501266_043688 | 3300049763 | Bacteria | 674 |
| 676 | Ga0501268_006688 | 3300049765 | Bacteria | 1700 |
| 677 | Ga0501035_0831304 | 3300049822 | Bacteria | 736 |
| 678 | Ga0501045_0622160 | 3300049824 | Bacteria | 799 |
| 679 | nmdc:mga00v17_231045_c1 | 3300050491 | Bacteria | 1198 |
| 680 | nmdc:mga06z11_308852_c1 | 3300050494 | Bacteria | 941 |
| 681 | nmdc:mga05p37_16486_c1 | 3300050507 | Bacteria | 8900 |
| 682 | nmdc:mga05p37_27288_c1 | 3300050507 | Bacteria | 6952 |
| 683 | nmdc:mga05p37_286433_c1 | 3300050507 | Bacteria | 1962 |
| 684 | nmdc:mga05p37_705547_c1 | 3300050507 | Bacteria | 1120 |
| 685 | nmdc:mga09592_226034_c1 | 3300050508 | Bacteria | 1621 |
| 686 | nmdc:mga09592_631670_c1 | 3300050508 | Bacteria | 915 |
| 687 | nmdc:mga0qj67_40911_c1 | 3300050509 | Bacteria | 3644 |
| 688 | nmdc:mga0qj67_9991_c1 | 3300050509 | Bacteria | 7077 |
| 689 | nmdc:mga06r32_140791_c1 | 3300050510 | Bacteria | 2388 |
| 690 | nmdc:mga06r32_238861_c1 | 3300050510 | Bacteria | 1805 |
| 691 | nmdc:mga06r32_308068_c1 | 3300050510 | Bacteria | 1569 |
| 692 | nmdc:mga06r32_9888_c1 | 3300050510 | Bacteria | 8609 |
| 693 | nmdc:mga08y16_211564_c1 | 3300050511 | Bacteria | 2008 |
| 694 | nmdc:mga08y16_403990_c1 | 3300050511 | Bacteria | 1398 |
| 695 | nmdc:mga08y16_59057_c1 | 3300050511 | Bacteria | 4007 |
| 696 | nmdc:mga0n895_77920_c1 | 3300050512 | Bacteria | 3298 |
| 697 | nmdc:mga0rr50_1126973_c1 | 3300050513 | Bacteria | 667 |
| 698 | nmdc:mga0rr50_71823_c1 | 3300050513 | Bacteria | 2642 |
| 699 | nmdc:mga0rr50_73255_c1 | 3300050513 | Bacteria | 2618 |
| 700 | nmdc:mga08x19_234686_c1 | 3300050514 | Bacteria | 1263 |
| 701 | nmdc:mga0a205_286653_c1 | 3300050515 | Bacteria | 1522 |
| 702 | nmdc:mga0a205_296625_c1 | 3300050515 | Bacteria | 1490 |
| 703 | nmdc:mga0a205_43_c1 | 3300050515 | Bacteria | 51209 |
| 704 | Ga0495612_0000067 | 3300053078 | Bacteria | 47307 |
| 705 | Ga0495612_0014801 | 3300053078 | Bacteria | 3130 |
| 706 | Ga0495655_0078586 | 3300053083 | Bacteria | 938 |
| 707 | Ga0495595_0128113 | 3300053084 | Bacteria | 1239 |
| 708 | Ga0495595_0281587 | 3300053084 | Bacteria | 835 |
| 709 | Ga0495619_0007731 | 3300053085 | Bacteria | 6803 |
| 710 | Ga0495619_0148072 | 3300053085 | Bacteria | 1619 |
| 711 | Ga0500614_000427 | 3300053123 | Bacteria | 10952 |
| 712 | Ga0501084_0186064 | 3300054114 | Bacteria | 1753 |
| 713 | Ga0501082_0371763 | 3300060353 | Bacteria | 1247 |
| 714 | Ga0501082_0786262 | 3300060353 | Bacteria | 833 |
| 715 | Ga0466962_0022394 | 3300061719 | Bacteria | 3036 |
| 716 | Ga0530510_0037571 | 3300061734 | Bacteria | 3494 |
| 717 | Ga0530510_0282536 | 3300061734 | Bacteria | 1240 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005985 | Ga0081539_10006318 | Ga0081539_1000631810 | 135 |
| 2 | 3300005289 | Ga0065704_10186197 | Ga0065704_101861972 | 138 |
| 3 | 3300005290 | Ga0065712_10120808 | Ga0065712_101208082 | 138 |
| 4 | 3300005290 | Ga0065712_10307204 | Ga0065712_103072042 | 138 |
| 5 | 3300005293 | Ga0065715_10089219 | Ga0065715_100892194 | 138 |
| 6 | 3300005293 | Ga0065715_10164629 | Ga0065715_101646292 | 138 |
| 7 | 3300005327 | Ga0070658_10094939 | Ga0070658_100949394 | 138 |
| 8 | 3300005327 | Ga0070658_10408452 | Ga0070658_104084522 | 138 |
| 9 | 3300005328 | Ga0070676_10008896 | Ga0070676_100088963 | 138 |
| 10 | 3300005328 | Ga0070676_10427833 | Ga0070676_104278331 | 138 |
| 11 | 3300005329 | Ga0070683_100032094 | Ga0070683_1000320943 | 138 |
| 12 | 3300005329 | Ga0070683_100056215 | Ga0070683_1000562154 | 138 |
| 13 | 3300005331 | Ga0070670_100048916 | Ga0070670_1000489162 | 138 |
| 14 | 3300005331 | Ga0070670_100333071 | Ga0070670_1003330712 | 138 |
| 15 | 3300005331 | Ga0070670_100336399 | Ga0070670_1003363993 | 138 |
| 16 | 3300005331 | Ga0070670_101469079 | Ga0070670_1014690791 | 138 |
| 17 | 3300005334 | Ga0068869_100017547 | Ga0068869_1000175474 | 138 |
| 18 | 3300005335 | Ga0070666_10038088 | Ga0070666_100380882 | 138 |
| 19 | 3300005335 | Ga0070666_10416615 | Ga0070666_104166151 | 138 |
| 20 | 3300005336 | Ga0070680_100001000 | Ga0070680_10000100014 | 138 |
| 21 | 3300005336 | Ga0070680_100004158 | Ga0070680_1000041589 | 138 |
| 22 | 3300005336 | Ga0070680_100098331 | Ga0070680_1000983313 | 138 |
| 23 | 3300005337 | Ga0070682_100005034 | Ga0070682_1000050347 | 138 |
| 24 | 3300005337 | Ga0070682_100022910 | Ga0070682_1000229105 | 138 |
| 25 | 3300005337 | Ga0070682_100035137 | Ga0070682_1000351374 | 138 |
| 26 | 3300005337 | Ga0070682_100072785 | Ga0070682_1000727853 | 138 |
| 27 | 3300005337 | Ga0070682_100299938 | Ga0070682_1002999382 | 138 |
| 28 | 3300005338 | Ga0068868_100043808 | Ga0068868_1000438082 | 138 |
| 29 | 3300005338 | Ga0068868_100131979 | Ga0068868_1001319793 | 138 |
| 30 | 3300005339 | Ga0070660_100047557 | Ga0070660_1000475573 | 138 |
| 31 | 3300005339 | Ga0070660_100107638 | Ga0070660_1001076382 | 138 |
| 32 | 3300005339 | Ga0070660_100728691 | Ga0070660_1007286911 | 138 |
| 33 | 3300005339 | Ga0070660_101076415 | Ga0070660_1010764152 | 138 |
| 34 | 3300005343 | Ga0070687_100000591 | Ga0070687_1000005919 | 138 |
| 35 | 3300005343 | Ga0070687_100999341 | Ga0070687_1009993411 | 138 |
| 36 | 3300005344 | Ga0070661_100010002 | Ga0070661_1000100024 | 138 |
| 37 | 3300005344 | Ga0070661_100016393 | Ga0070661_1000163932 | 138 |
| 38 | 3300005344 | Ga0070661_100055181 | Ga0070661_1000551811 | 138 |
| 39 | 3300005344 | Ga0070661_100473180 | Ga0070661_1004731802 | 138 |
| 40 | 3300005344 | Ga0070661_100964084 | Ga0070661_1009640842 | 138 |
| 41 | 3300005345 | Ga0070692_10007544 | Ga0070692_100075444 | 138 |
| 42 | 3300005345 | Ga0070692_10060475 | Ga0070692_100604754 | 138 |
| 43 | 3300005345 | Ga0070692_10088121 | Ga0070692_100881212 | 138 |
| 44 | 3300005347 | Ga0070668_100003850 | Ga0070668_1000038507 | 138 |
| 45 | 3300005347 | Ga0070668_100007138 | Ga0070668_1000071385 | 138 |
| 46 | 3300005353 | Ga0070669_100001600 | Ga0070669_10000160014 | 138 |
| 47 | 3300005353 | Ga0070669_100006094 | Ga0070669_1000060948 | 138 |
| 48 | 3300005353 | Ga0070669_100118683 | Ga0070669_1001186832 | 138 |
| 49 | 3300005353 | Ga0070669_100176485 | Ga0070669_1001764852 | 138 |
| 50 | 3300005354 | Ga0070675_100039320 | Ga0070675_1000393203 | 138 |
| 51 | 3300005354 | Ga0070675_100077057 | Ga0070675_1000770571 | 138 |
| 52 | 3300005354 | Ga0070675_100165595 | Ga0070675_1001655951 | 138 |
| 53 | 3300005355 | Ga0070671_100050443 | Ga0070671_1000504432 | 138 |
| 54 | 3300005355 | Ga0070671_100101987 | Ga0070671_1001019873 | 138 |
| 55 | 3300005356 | Ga0070674_100019485 | Ga0070674_1000194855 | 138 |
| 56 | 3300005364 | Ga0070673_100058428 | Ga0070673_1000584285 | 138 |
| 57 | 3300005364 | Ga0070673_100083889 | Ga0070673_1000838892 | 138 |
| 58 | 3300005364 | Ga0070673_100403274 | Ga0070673_1004032742 | 138 |
| 59 | 3300005365 | Ga0070688_100012935 | Ga0070688_1000129354 | 138 |
| 60 | 3300005366 | Ga0070659_100035381 | Ga0070659_1000353815 | 138 |
| 61 | 3300005366 | Ga0070659_100110145 | Ga0070659_1001101453 | 138 |
| 62 | 3300005366 | Ga0070659_100788323 | Ga0070659_1007883232 | 138 |
| 63 | 3300005367 | Ga0070667_100031163 | Ga0070667_1000311633 | 138 |
| 64 | 3300005367 | Ga0070667_101153971 | Ga0070667_1011539712 | 138 |
| 65 | 3300005367 | Ga0070667_101423527 | Ga0070667_1014235271 | 138 |
| 66 | 3300005406 | Ga0070703_10284665 | Ga0070703_102846652 | 138 |
| 67 | 3300005434 | Ga0070709_10001518 | Ga0070709_100015186 | 138 |
| 68 | 3300005438 | Ga0070701_10014736 | Ga0070701_100147363 | 138 |
| 69 | 3300005438 | Ga0070701_10168672 | Ga0070701_101686722 | 138 |
| 70 | 3300005439 | Ga0070711_100022896 | Ga0070711_1000228963 | 138 |
| 71 | 3300005440 | Ga0070705_100693042 | Ga0070705_1006930422 | 138 |
| 72 | 3300005440 | Ga0070705_100921558 | Ga0070705_1009215581 | 138 |
| 73 | 3300005444 | Ga0070694_100142495 | Ga0070694_1001424952 | 138 |
| 74 | 3300005455 | Ga0070663_100009811 | Ga0070663_1000098117 | 138 |
| 75 | 3300005455 | Ga0070663_101272667 | Ga0070663_1012726671 | 138 |
| 76 | 3300005457 | Ga0070662_100000676 | Ga0070662_1000006762 | 138 |
| 77 | 3300005457 | Ga0070662_100200299 | Ga0070662_1002002992 | 138 |
| 78 | 3300005458 | Ga0070681_10000554 | Ga0070681_1000055418 | 138 |
| 79 | 3300005458 | Ga0070681_10006906 | Ga0070681_1000690612 | 138 |
| 80 | 3300005458 | Ga0070681_10011203 | Ga0070681_100112035 | 138 |
| 81 | 3300005458 | Ga0070681_10460822 | Ga0070681_104608222 | 138 |
| 82 | 3300005459 | Ga0068867_100097053 | Ga0068867_1000970532 | 138 |
| 83 | 3300005459 | Ga0068867_100491234 | Ga0068867_1004912342 | 138 |
| 84 | 3300005459 | Ga0068867_100519253 | Ga0068867_1005192532 | 138 |
| 85 | 3300005459 | Ga0068867_100913298 | Ga0068867_1009132982 | 138 |
| 86 | 3300005466 | Ga0070685_10097302 | Ga0070685_100973023 | 138 |
| 87 | 3300005468 | Ga0070707_100029570 | Ga0070707_1000295707 | 138 |
| 88 | 3300005471 | Ga0070698_100000181 | Ga0070698_10000018142 | 138 |
| 89 | 3300005518 | Ga0070699_100068841 | Ga0070699_1000688413 | 138 |
| 90 | 3300005518 | Ga0070699_100091673 | Ga0070699_1000916734 | 138 |
| 91 | 3300005518 | Ga0070699_100319450 | Ga0070699_1003194501 | 138 |
| 92 | 3300005530 | Ga0070679_100001151 | Ga0070679_1000011519 | 138 |
| 93 | 3300005530 | Ga0070679_100024888 | Ga0070679_1000248887 | 138 |
| 94 | 3300005530 | Ga0070679_100038355 | Ga0070679_1000383556 | 138 |
| 95 | 3300005530 | Ga0070679_100206251 | Ga0070679_1002062513 | 138 |
| 96 | 3300005535 | Ga0070684_100014938 | Ga0070684_1000149384 | 138 |
| 97 | 3300005535 | Ga0070684_100122424 | Ga0070684_1001224242 | 138 |
| 98 | 3300005535 | Ga0070684_100220425 | Ga0070684_1002204253 | 138 |
| 99 | 3300005535 | Ga0070684_100550508 | Ga0070684_1005505081 | 138 |
| 100 | 3300005539 | Ga0068853_101129578 | Ga0068853_1011295782 | 138 |
| 101 | 3300005543 | Ga0070672_100044304 | Ga0070672_1000443042 | 138 |
| 102 | 3300005543 | Ga0070672_100053208 | Ga0070672_1000532082 | 138 |
| 103 | 3300005543 | Ga0070672_100372343 | Ga0070672_1003723431 | 138 |
| 104 | 3300005543 | Ga0070672_100755194 | Ga0070672_1007551942 | 138 |
| 105 | 3300005544 | Ga0070686_101223968 | Ga0070686_1012239681 | 138 |
| 106 | 3300005545 | Ga0070695_100005050 | Ga0070695_1000050503 | 138 |
| 107 | 3300005546 | Ga0070696_100556086 | Ga0070696_1005560862 | 138 |
| 108 | 3300005547 | Ga0070693_100572296 | Ga0070693_1005722962 | 138 |
| 109 | 3300005548 | Ga0070665_100011876 | Ga0070665_1000118765 | 138 |
| 110 | 3300005549 | Ga0070704_100056539 | Ga0070704_1000565394 | 138 |
| 111 | 3300005549 | Ga0070704_100618818 | Ga0070704_1006188181 | 138 |
| 112 | 3300005563 | Ga0068855_100077943 | Ga0068855_1000779433 | 138 |
| 113 | 3300005563 | Ga0068855_100135428 | Ga0068855_1001354285 | 138 |
| 114 | 3300005563 | Ga0068855_100476014 | Ga0068855_1004760143 | 138 |
| 115 | 3300005564 | Ga0070664_100007495 | Ga0070664_1000074953 | 138 |
| 116 | 3300005564 | Ga0070664_100007931 | Ga0070664_1000079317 | 138 |
| 117 | 3300005564 | Ga0070664_100045589 | Ga0070664_1000455895 | 138 |
| 118 | 3300005564 | Ga0070664_100916220 | Ga0070664_1009162201 | 138 |
| 119 | 3300005564 | Ga0070664_101941682 | Ga0070664_1019416821 | 138 |
| 120 | 3300005577 | Ga0068857_100005823 | Ga0068857_1000058235 | 138 |
| 121 | 3300005577 | Ga0068857_100060125 | Ga0068857_1000601252 | 138 |
| 122 | 3300005577 | Ga0068857_100061539 | Ga0068857_1000615392 | 138 |
| 123 | 3300005578 | Ga0068854_100081160 | Ga0068854_1000811604 | 138 |
| 124 | 3300005614 | Ga0068856_100165712 | Ga0068856_1001657123 | 138 |
| 125 | 3300005615 | Ga0070702_101613597 | Ga0070702_1016135971 | 138 |
| 126 | 3300005616 | Ga0068852_100005517 | Ga0068852_1000055177 | 138 |
| 127 | 3300005616 | Ga0068852_101632956 | Ga0068852_1016329561 | 138 |
| 128 | 3300005617 | Ga0068859_100256946 | Ga0068859_1002569462 | 138 |
| 129 | 3300005618 | Ga0068864_100267203 | Ga0068864_1002672032 | 138 |
| 130 | 3300005618 | Ga0068864_101309178 | Ga0068864_1013091781 | 138 |
| 131 | 3300005719 | Ga0068861_100008729 | Ga0068861_1000087296 | 138 |
| 132 | 3300005719 | Ga0068861_100049676 | Ga0068861_1000496761 | 138 |
| 133 | 3300005834 | Ga0068851_10011400 | Ga0068851_100114003 | 138 |
| 134 | 3300005834 | Ga0068851_10036814 | Ga0068851_100368142 | 138 |
| 135 | 3300005840 | Ga0068870_10038721 | Ga0068870_100387212 | 138 |
| 136 | 3300005840 | Ga0068870_10148011 | Ga0068870_101480112 | 138 |
| 137 | 3300005840 | Ga0068870_10211698 | Ga0068870_102116982 | 138 |
| 138 | 3300005841 | Ga0068863_100006324 | Ga0068863_1000063248 | 138 |
| 139 | 3300005841 | Ga0068863_100488496 | Ga0068863_1004884962 | 138 |
| 140 | 3300005841 | Ga0068863_100618811 | Ga0068863_1006188112 | 138 |
| 141 | 3300005842 | Ga0068858_100014761 | Ga0068858_1000147614 | 138 |
| 142 | 3300005842 | Ga0068858_100314685 | Ga0068858_1003146853 | 138 |
| 143 | 3300005843 | Ga0068860_100013620 | Ga0068860_1000136207 | 138 |
| 144 | 3300005843 | Ga0068860_100275466 | Ga0068860_1002754662 | 138 |
| 145 | 3300005844 | Ga0068862_100000266 | Ga0068862_10000026619 | 138 |
| 146 | 3300005844 | Ga0068862_100076020 | Ga0068862_1000760202 | 138 |
| 147 | 3300005844 | Ga0068862_100478540 | Ga0068862_1004785401 | 138 |
| 148 | 3300006173 | Ga0070716_100001196 | Ga0070716_10000119616 | 138 |
| 149 | 3300006237 | Ga0097621_100563917 | Ga0097621_1005639172 | 138 |
| 150 | 3300006358 | Ga0068871_100370167 | Ga0068871_1003701672 | 138 |
| 151 | 3300006844 | Ga0075428_100376070 | Ga0075428_1003760701 | 138 |
| 152 | 3300006844 | Ga0075428_100448401 | Ga0075428_1004484012 | 138 |
| 153 | 3300006846 | Ga0075430_100005965 | Ga0075430_1000059652 | 138 |
| 154 | 3300006846 | Ga0075430_100040239 | Ga0075430_1000402392 | 138 |
| 155 | 3300006846 | Ga0075430_100146085 | Ga0075430_1001460853 | 138 |
| 156 | 3300006846 | Ga0075430_100228309 | Ga0075430_1002283092 | 138 |
| 157 | 3300006846 | Ga0075430_100831671 | Ga0075430_1008316713 | 138 |
| 158 | 3300006847 | Ga0075431_100061098 | Ga0075431_1000610982 | 138 |
| 159 | 3300006847 | Ga0075431_100085595 | Ga0075431_1000855954 | 138 |
| 160 | 3300006847 | Ga0075431_100140800 | Ga0075431_1001408002 | 138 |
| 161 | 3300006847 | Ga0075431_100316761 | Ga0075431_1003167612 | 138 |
| 162 | 3300006847 | Ga0075431_100627596 | Ga0075431_1006275963 | 138 |
| 163 | 3300006852 | Ga0075433_10014812 | Ga0075433_100148125 | 138 |
| 164 | 3300006852 | Ga0075433_10049608 | Ga0075433_100496083 | 138 |
| 165 | 3300006852 | Ga0075433_10394248 | Ga0075433_103942482 | 138 |
| 166 | 3300006871 | Ga0075434_100003789 | Ga0075434_10000378911 | 138 |
| 167 | 3300006871 | Ga0075434_100028929 | Ga0075434_1000289292 | 138 |
| 168 | 3300006871 | Ga0075434_100586871 | Ga0075434_1005868712 | 138 |
| 169 | 3300006880 | Ga0075429_100011262 | Ga0075429_1000112628 | 138 |
| 170 | 3300006880 | Ga0075429_100029286 | Ga0075429_1000292862 | 138 |
| 171 | 3300006880 | Ga0075429_100047715 | Ga0075429_1000477153 | 138 |
| 172 | 3300006880 | Ga0075429_101042475 | Ga0075429_1010424752 | 138 |
| 173 | 3300006881 | Ga0068865_100074035 | Ga0068865_1000740352 | 138 |
| 174 | 3300006881 | Ga0068865_100074186 | Ga0068865_1000741863 | 138 |
| 175 | 3300006914 | Ga0075436_100010365 | Ga0075436_10001036512 | 138 |
| 176 | 3300006914 | Ga0075436_100253750 | Ga0075436_1002537501 | 138 |
| 177 | 3300006931 | Ga0097620_100256959 | Ga0097620_1002569592 | 138 |
| 178 | 3300007076 | Ga0075435_100289660 | Ga0075435_1002896603 | 138 |
| 179 | 3300007076 | Ga0075435_100924352 | Ga0075435_1009243522 | 138 |
| 180 | 3300007788 | Ga0099795_10031030 | Ga0099795_100310304 | 138 |
| 181 | 3300009036 | Ga0105244_10112939 | Ga0105244_101129392 | 138 |
| 182 | 3300009094 | Ga0111539_10016514 | Ga0111539_100165148 | 138 |
| 183 | 3300009094 | Ga0111539_10881003 | Ga0111539_108810031 | 138 |
| 184 | 3300009094 | Ga0111539_11165816 | Ga0111539_111658162 | 138 |
| 185 | 3300009098 | Ga0105245_10008594 | Ga0105245_100085945 | 138 |
| 186 | 3300009098 | Ga0105245_10260723 | Ga0105245_102607234 | 138 |
| 187 | 3300009098 | Ga0105245_10572386 | Ga0105245_105723861 | 138 |
| 188 | 3300009101 | Ga0105247_10475716 | Ga0105247_104757162 | 138 |
| 189 | 3300009147 | Ga0114129_10009856 | Ga0114129_1000985612 | 138 |
| 190 | 3300009147 | Ga0114129_10034392 | Ga0114129_100343922 | 138 |
| 191 | 3300009147 | Ga0114129_10070947 | Ga0114129_100709472 | 138 |
| 192 | 3300009147 | Ga0114129_10126508 | Ga0114129_101265083 | 138 |
| 193 | 3300009147 | Ga0114129_10337836 | Ga0114129_103378362 | 138 |
| 194 | 3300009147 | Ga0114129_12708544 | Ga0114129_127085441 | 138 |
| 195 | 3300009174 | Ga0105241_10588904 | Ga0105241_105889041 | 138 |
| 196 | 3300009176 | Ga0105242_10058363 | Ga0105242_100583635 | 138 |
| 197 | 3300009176 | Ga0105242_11230428 | Ga0105242_112304282 | 138 |
| 198 | 3300009177 | Ga0105248_10112123 | Ga0105248_101121232 | 138 |
| 199 | 3300009177 | Ga0105248_10167255 | Ga0105248_101672554 | 138 |
| 200 | 3300009545 | Ga0105237_11088948 | Ga0105237_110889482 | 138 |
| 201 | 3300009553 | Ga0105249_10000199 | Ga0105249_1000019947 | 138 |
| 202 | 3300009553 | Ga0105249_10013016 | Ga0105249_100130168 | 138 |
| 203 | 3300010159 | Ga0099796_10204813 | Ga0099796_102048131 | 138 |
| 204 | 3300010375 | Ga0105239_10181598 | Ga0105239_101815982 | 138 |
| 205 | 3300011119 | Ga0105246_10107963 | Ga0105246_101079632 | 138 |
| 206 | 3300011119 | Ga0105246_10753625 | Ga0105246_107536251 | 138 |
| 207 | 3300013100 | Ga0157373_10121074 | Ga0157373_101210742 | 138 |
| 208 | 3300013100 | Ga0157373_10142020 | Ga0157373_101420202 | 138 |
| 209 | 3300013100 | Ga0157373_10308900 | Ga0157373_103089002 | 138 |
| 210 | 3300013102 | Ga0157371_10017614 | Ga0157371_100176144 | 138 |
| 211 | 3300013105 | Ga0157369_10128039 | Ga0157369_101280392 | 138 |
| 212 | 3300013296 | Ga0157374_10206077 | Ga0157374_102060772 | 138 |
| 213 | 3300013296 | Ga0157374_10390192 | Ga0157374_103901923 | 138 |
| 214 | 3300013297 | Ga0157378_10067243 | Ga0157378_100672431 | 138 |
| 215 | 3300013297 | Ga0157378_10618737 | Ga0157378_106187371 | 138 |
| 216 | 3300013306 | Ga0163162_10006653 | Ga0163162_100066535 | 138 |
| 217 | 3300013306 | Ga0163162_10072923 | Ga0163162_100729232 | 138 |
| 218 | 3300013307 | Ga0157372_10006253 | Ga0157372_1000625310 | 138 |
| 219 | 3300013307 | Ga0157372_10119700 | Ga0157372_101197003 | 138 |
| 220 | 3300013307 | Ga0157372_10295055 | Ga0157372_102950553 | 138 |
| 221 | 3300013308 | Ga0157375_10015328 | Ga0157375_100153285 | 138 |
| 222 | 3300013308 | Ga0157375_10301273 | Ga0157375_103012732 | 138 |
| 223 | 3300013308 | Ga0157375_10591421 | Ga0157375_105914212 | 138 |
| 224 | 3300013308 | Ga0157375_11075140 | Ga0157375_110751401 | 138 |
| 225 | 3300014325 | Ga0163163_10175620 | Ga0163163_101756202 | 138 |
| 226 | 3300014326 | Ga0157380_10022328 | Ga0157380_100223283 | 138 |
| 227 | 3300014326 | Ga0157380_10808228 | Ga0157380_108082282 | 138 |
| 228 | 3300014745 | Ga0157377_10060916 | Ga0157377_100609162 | 138 |
| 229 | 3300014745 | Ga0157377_10361371 | Ga0157377_103613712 | 138 |
| 230 | 3300014968 | Ga0157379_10008193 | Ga0157379_100081937 | 138 |
| 231 | 3300014969 | Ga0157376_10190070 | Ga0157376_101900704 | 138 |
| 232 | 3300015262 | Ga0182007_10031396 | Ga0182007_100313963 | 138 |
| 233 | 3300015262 | Ga0182007_10050444 | Ga0182007_100504442 | 138 |
| 234 | 3300025907 | Ga0207645_10299443 | Ga0207645_102994432 | 138 |
| 235 | 3300025912 | Ga0207707_10088907 | Ga0207707_100889074 | 138 |
| 236 | 3300025917 | Ga0207660_10051661 | Ga0207660_100516613 | 138 |
| 237 | 3300025940 | Ga0207691_10041776 | Ga0207691_100417763 | 138 |
| 238 | 3300025944 | Ga0207661_10825994 | Ga0207661_108259942 | 138 |
| 239 | 3300025945 | Ga0207679_10166573 | Ga0207679_101665733 | 138 |
| 240 | 3300025960 | Ga0207651_10362453 | Ga0207651_103624532 | 138 |
| 241 | 3300026035 | Ga0207703_10321273 | Ga0207703_103212732 | 138 |
| 242 | 3300026075 | Ga0207708_10487982 | Ga0207708_104879821 | 138 |
| 243 | 3300027424 | Ga0209984_1019660 | Ga0209984_10196602 | 138 |
| 244 | 3300027471 | Ga0209995_1008004 | Ga0209995_10080043 | 138 |
| 245 | 3300027512 | Ga0209179_1022874 | Ga0209179_10228741 | 138 |
| 246 | 3300027552 | Ga0209982_1026936 | Ga0209982_10269362 | 138 |
| 247 | 3300027717 | Ga0209998_10000320 | Ga0209998_1000032010 | 138 |
| 248 | 3300028380 | Ga0268265_10535504 | Ga0268265_105355041 | 138 |
| 249 | 3300031731 | Ga0307405_12104759 | Ga0307405_121047591 | 138 |
| 250 | 3300031824 | Ga0307413_10090794 | Ga0307413_100907942 | 138 |
| 251 | 3300031901 | Ga0307406_10931181 | Ga0307406_109311811 | 138 |
| 252 | 3300031903 | Ga0307407_10351094 | Ga0307407_103510942 | 138 |
| 253 | 3300031911 | Ga0307412_10135813 | Ga0307412_101358132 | 138 |
| 254 | 3300031995 | Ga0307409_100171002 | Ga0307409_1001710023 | 138 |
| 255 | 3300032002 | Ga0307416_100181068 | Ga0307416_1001810683 | 138 |
| 256 | 3300032002 | Ga0307416_101572998 | Ga0307416_1015729982 | 138 |
| 257 | 3300032004 | Ga0307414_10157643 | Ga0307414_101576433 | 138 |
| 258 | 3300032005 | Ga0307411_10414930 | Ga0307411_104149302 | 138 |
| 259 | 3300035171 | Ga0373946_0174613 | Ga0373946_0174613_294_752 | 138 |
| 260 | 3300035207 | Ga0373942_0005002 | Ga0373942_0005002_1711_2169 | 138 |
| 261 | 3300035241 | Ga0373961_0038447 | Ga0373961_0038447_301_759 | 138 |
| 262 | 3300038443 | Ga0395901_1409479 | Ga0395901_1409479_16_540 | 138 |
| 263 | 3300042012 | Ga0439455_0141456 | Ga0439455_0141456_195_632 | 138 |
| 264 | 3300048915 | Ga0496112_0714082 | Ga0496112_0714082_304_762 | 138 |
| 265 | 3300049668 | Ga0501233_174061 | Ga0501233_174061_127_558 | 138 |
| 266 | 3300049669 | Ga0501235_136960 | Ga0501235_136960_139_600 | 138 |
| 267 | 3300049763 | Ga0501266_043688 | Ga0501266_043688_199_660 | 138 |
| 268 | 3300049765 | Ga0501268_006688 | Ga0501268_006688_931_1392 | 138 |
| 269 | 3300050507 | nmdc:mga05p37_16486_c1 | nmdc:mga05p37_16486_c1_5229_5723 | 138 |
| 270 | 3300005333 | Ga0070677_10000015 | Ga0070677_1000001543 | 146 |
| 271 | 3300009098 | Ga0105245_10000517 | Ga0105245_1000051718 | 146 |
| 272 | 3300009553 | Ga0105249_10523139 | Ga0105249_105231392 | 146 |
| 273 | 3300044684 | Ga0466966_0788448 | Ga0466966_0788448_35_475 | 146 |
| 274 | 3300044694 | Ga0466963_0000004 | Ga0466963_0000004_88602_89042 | 146 |
| 275 | 3300046459 | Ga0495629_0225157 | Ga0495629_0225157_768_1208 | 146 |
| 276 | 3300046516 | Ga0495628_0323122 | Ga0495628_0323122_55_495 | 146 |
| 277 | 3300046523 | Ga0495644_0078707 | Ga0495644_0078707_114_554 | 146 |
| 278 | 3300046529 | Ga0495652_0003765 | Ga0495652_0003765_4463_4903 | 146 |
| 279 | 3300046663 | Ga0495635_0938879 | Ga0495635_0938879_21_461 | 146 |
| 280 | 3300046674 | Ga0495588_0538625 | Ga0495588_0538625_25_465 | 146 |
| 281 | 3300046681 | Ga0495647_0000001 | Ga0495647_0000001_35858_36301 | 146 |
| 282 | 3300047673 | Ga0495593_0155920 | Ga0495593_0155920_304_744 | 146 |
| 283 | 3300048908 | Ga0496105_1029146 | Ga0496105_1029146_152_592 | 146 |
| 284 | 3300048912 | Ga0496109_0323372 | Ga0496109_0323372_540_980 | 146 |
| 285 | 3300048914 | Ga0496111_0013645 | Ga0496111_0013645_1626_2066 | 146 |
| 286 | 3300048914 | Ga0496111_0419064 | Ga0496111_0419064_394_834 | 146 |
| 287 | 3300048916 | Ga0496113_0027027 | Ga0496113_0027027_1158_1598 | 146 |
| 288 | 3300048917 | Ga0496114_0006763 | Ga0496114_0006763_431_871 | 146 |
| 289 | 3300049578 | Ga0501042_0398993 | Ga0501042_0398993_144_584 | 146 |
| 290 | 3300049824 | Ga0501045_0622160 | Ga0501045_0622160_61_501 | 146 |
| 291 | 3300050515 | nmdc:mga0a205_43_c1 | nmdc:mga0a205_43_c1_21822_22262 | 146 |
| 292 | 3300000531 | CNBas_1002498 | CNBas_10024982 | 153 |
| 293 | 3300003373 | JGI25407J50210_10057872 | JGI25407J50210_100578722 | 153 |
| 294 | 3300005327 | Ga0070658_10941978 | Ga0070658_109419782 | 153 |
| 295 | 3300005329 | Ga0070683_100007221 | Ga0070683_10000722113 | 153 |
| 296 | 3300005329 | Ga0070683_100088896 | Ga0070683_1000888964 | 153 |
| 297 | 3300005334 | Ga0068869_100018855 | Ga0068869_1000188553 | 153 |
| 298 | 3300005334 | Ga0068869_100187384 | Ga0068869_1001873842 | 153 |
| 299 | 3300005337 | Ga0070682_100002611 | Ga0070682_1000026119 | 153 |
| 300 | 3300005338 | Ga0068868_100008846 | Ga0068868_1000088467 | 153 |
| 301 | 3300005339 | Ga0070660_100039302 | Ga0070660_1000393023 | 153 |
| 302 | 3300005339 | Ga0070660_100572524 | Ga0070660_1005725242 | 153 |
| 303 | 3300005340 | Ga0070689_100048812 | Ga0070689_1000488125 | 153 |
| 304 | 3300005341 | Ga0070691_10091063 | Ga0070691_100910632 | 153 |
| 305 | 3300005344 | Ga0070661_100037902 | Ga0070661_1000379022 | 153 |
| 306 | 3300005345 | Ga0070692_10174083 | Ga0070692_101740831 | 153 |
| 307 | 3300005347 | Ga0070668_100047269 | Ga0070668_1000472692 | 153 |
| 308 | 3300005347 | Ga0070668_100251306 | Ga0070668_1002513063 | 153 |
| 309 | 3300005347 | Ga0070668_100274659 | Ga0070668_1002746592 | 153 |
| 310 | 3300005355 | Ga0070671_101036606 | Ga0070671_1010366061 | 153 |
| 311 | 3300005366 | Ga0070659_100013862 | Ga0070659_1000138623 | 153 |
| 312 | 3300005367 | Ga0070667_100001076 | Ga0070667_10000107618 | 153 |
| 313 | 3300005434 | Ga0070709_10198710 | Ga0070709_101987102 | 153 |
| 314 | 3300005435 | Ga0070714_100008647 | Ga0070714_1000086476 | 153 |
| 315 | 3300005435 | Ga0070714_100063920 | Ga0070714_1000639204 | 153 |
| 316 | 3300005435 | Ga0070714_100487223 | Ga0070714_1004872232 | 153 |
| 317 | 3300005436 | Ga0070713_100257901 | Ga0070713_1002579012 | 153 |
| 318 | 3300005436 | Ga0070713_100268753 | Ga0070713_1002687532 | 153 |
| 319 | 3300005436 | Ga0070713_100286600 | Ga0070713_1002866002 | 153 |
| 320 | 3300005436 | Ga0070713_100542561 | Ga0070713_1005425612 | 153 |
| 321 | 3300005437 | Ga0070710_10030600 | Ga0070710_100306004 | 153 |
| 322 | 3300005437 | Ga0070710_10052550 | Ga0070710_100525503 | 153 |
| 323 | 3300005437 | Ga0070710_10159492 | Ga0070710_101594923 | 153 |
| 324 | 3300005439 | Ga0070711_100154693 | Ga0070711_1001546933 | 153 |
| 325 | 3300005440 | Ga0070705_100031635 | Ga0070705_1000316352 | 153 |
| 326 | 3300005441 | Ga0070700_100030817 | Ga0070700_1000308173 | 153 |
| 327 | 3300005455 | Ga0070663_100083146 | Ga0070663_1000831464 | 153 |
| 328 | 3300005456 | Ga0070678_100456361 | Ga0070678_1004563612 | 153 |
| 329 | 3300005458 | Ga0070681_10033452 | Ga0070681_100334522 | 153 |
| 330 | 3300005466 | Ga0070685_10128988 | Ga0070685_101289881 | 153 |
| 331 | 3300005530 | Ga0070679_100000913 | Ga0070679_10000091318 | 153 |
| 332 | 3300005530 | Ga0070679_101569044 | Ga0070679_1015690441 | 153 |
| 333 | 3300005535 | Ga0070684_100036110 | Ga0070684_1000361103 | 153 |
| 334 | 3300005535 | Ga0070684_100235410 | Ga0070684_1002354103 | 153 |
| 335 | 3300005539 | Ga0068853_100014672 | Ga0068853_1000146724 | 153 |
| 336 | 3300005543 | Ga0070672_100801550 | Ga0070672_1008015501 | 153 |
| 337 | 3300005544 | Ga0070686_100078179 | Ga0070686_1000781792 | 153 |
| 338 | 3300005545 | Ga0070695_100169338 | Ga0070695_1001693382 | 153 |
| 339 | 3300005545 | Ga0070695_100365579 | Ga0070695_1003655791 | 153 |
| 340 | 3300005548 | Ga0070665_100000141 | Ga0070665_100000141104 | 153 |
| 341 | 3300005548 | Ga0070665_100071712 | Ga0070665_1000717125 | 153 |
| 342 | 3300005548 | Ga0070665_100940423 | Ga0070665_1009404232 | 153 |
| 343 | 3300005563 | Ga0068855_100887862 | Ga0068855_1008878621 | 153 |
| 344 | 3300005564 | Ga0070664_100044347 | Ga0070664_1000443472 | 153 |
| 345 | 3300005564 | Ga0070664_100163606 | Ga0070664_1001636062 | 153 |
| 346 | 3300005578 | Ga0068854_100006720 | Ga0068854_1000067202 | 153 |
| 347 | 3300005578 | Ga0068854_101312474 | Ga0068854_1013124741 | 153 |
| 348 | 3300005614 | Ga0068856_100011418 | Ga0068856_1000114186 | 153 |
| 349 | 3300005614 | Ga0068856_100015710 | Ga0068856_1000157105 | 153 |
| 350 | 3300005614 | Ga0068856_100571679 | Ga0068856_1005716792 | 153 |
| 351 | 3300005614 | Ga0068856_102126307 | Ga0068856_1021263071 | 153 |
| 352 | 3300005615 | Ga0070702_100011078 | Ga0070702_1000110782 | 153 |
| 353 | 3300005618 | Ga0068864_100000015 | Ga0068864_100000015169 | 153 |
| 354 | 3300005618 | Ga0068864_100557033 | Ga0068864_1005570332 | 153 |
| 355 | 3300005719 | Ga0068861_100084338 | Ga0068861_1000843383 | 153 |
| 356 | 3300005719 | Ga0068861_100313583 | Ga0068861_1003135832 | 153 |
| 357 | 3300005719 | Ga0068861_100987796 | Ga0068861_1009877961 | 153 |
| 358 | 3300005841 | Ga0068863_100131471 | Ga0068863_1001314714 | 153 |
| 359 | 3300005842 | Ga0068858_100000118 | Ga0068858_10000011855 | 153 |
| 360 | 3300005844 | Ga0068862_100000943 | Ga0068862_10000094324 | 153 |
| 361 | 3300005844 | Ga0068862_100103960 | Ga0068862_1001039602 | 153 |
| 362 | 3300005937 | Ga0081455_10025195 | Ga0081455_100251958 | 153 |
| 363 | 3300005937 | Ga0081455_10414886 | Ga0081455_104148862 | 153 |
| 364 | 3300005981 | Ga0081538_10000099 | Ga0081538_1000009932 | 153 |
| 365 | 3300005981 | Ga0081538_10000318 | Ga0081538_1000031820 | 153 |
| 366 | 3300005981 | Ga0081538_10000473 | Ga0081538_1000047351 | 153 |
| 367 | 3300005981 | Ga0081538_10000623 | Ga0081538_1000062310 | 153 |
| 368 | 3300005981 | Ga0081538_10001033 | Ga0081538_1000103334 | 153 |
| 369 | 3300005981 | Ga0081538_10001060 | Ga0081538_1000106010 | 153 |
| 370 | 3300005981 | Ga0081538_10003949 | Ga0081538_100039498 | 153 |
| 371 | 3300005981 | Ga0081538_10004775 | Ga0081538_1000477514 | 153 |
| 372 | 3300005981 | Ga0081538_10005946 | Ga0081538_100059463 | 153 |
| 373 | 3300005981 | Ga0081538_10019166 | Ga0081538_100191663 | 153 |
| 374 | 3300005981 | Ga0081538_10026358 | Ga0081538_100263584 | 153 |
| 375 | 3300005981 | Ga0081538_10026976 | Ga0081538_100269766 | 153 |
| 376 | 3300005981 | Ga0081538_10135688 | Ga0081538_101356881 | 153 |
| 377 | 3300005985 | Ga0081539_10179135 | Ga0081539_101791352 | 153 |
| 378 | 3300006028 | Ga0070717_10012514 | Ga0070717_100125145 | 153 |
| 379 | 3300006028 | Ga0070717_10035953 | Ga0070717_100359536 | 153 |
| 380 | 3300006028 | Ga0070717_10037977 | Ga0070717_100379778 | 153 |
| 381 | 3300006028 | Ga0070717_10829022 | Ga0070717_108290222 | 153 |
| 382 | 3300006051 | Ga0075364_10519368 | Ga0075364_105193682 | 153 |
| 383 | 3300006058 | Ga0075432_10003469 | Ga0075432_100034695 | 153 |
| 384 | 3300006175 | Ga0070712_100013357 | Ga0070712_1000133573 | 153 |
| 385 | 3300006237 | Ga0097621_100051997 | Ga0097621_1000519972 | 153 |
| 386 | 3300006844 | Ga0075428_100022990 | Ga0075428_1000229903 | 153 |
| 387 | 3300006844 | Ga0075428_100319517 | Ga0075428_1003195172 | 153 |
| 388 | 3300006844 | Ga0075428_100690460 | Ga0075428_1006904602 | 153 |
| 389 | 3300006844 | Ga0075428_100831705 | Ga0075428_1008317052 | 153 |
| 390 | 3300006846 | Ga0075430_100005498 | Ga0075430_1000054982 | 153 |
| 391 | 3300006846 | Ga0075430_100055547 | Ga0075430_1000555472 | 153 |
| 392 | 3300006846 | Ga0075430_100183035 | Ga0075430_1001830352 | 153 |
| 393 | 3300006846 | Ga0075430_100776631 | Ga0075430_1007766312 | 153 |
| 394 | 3300006847 | Ga0075431_100006641 | Ga0075431_10000664110 | 153 |
| 395 | 3300006847 | Ga0075431_100152295 | Ga0075431_1001522953 | 153 |
| 396 | 3300006847 | Ga0075431_100166533 | Ga0075431_1001665332 | 153 |
| 397 | 3300006847 | Ga0075431_101471849 | Ga0075431_1014718492 | 153 |
| 398 | 3300006852 | Ga0075433_10016407 | Ga0075433_100164077 | 153 |
| 399 | 3300006852 | Ga0075433_10024484 | Ga0075433_100244844 | 153 |
| 400 | 3300006852 | Ga0075433_10028882 | Ga0075433_100288826 | 153 |
| 401 | 3300006852 | Ga0075433_10241441 | Ga0075433_102414412 | 153 |
| 402 | 3300006871 | Ga0075434_100042447 | Ga0075434_1000424473 | 153 |
| 403 | 3300006871 | Ga0075434_100422865 | Ga0075434_1004228652 | 153 |
| 404 | 3300006880 | Ga0075429_100692558 | Ga0075429_1006925582 | 153 |
| 405 | 3300007076 | Ga0075435_100086662 | Ga0075435_1000866624 | 153 |
| 406 | 3300007076 | Ga0075435_100164988 | Ga0075435_1001649883 | 153 |
| 407 | 3300007076 | Ga0075435_100654677 | Ga0075435_1006546771 | 153 |
| 408 | 3300009093 | Ga0105240_11230602 | Ga0105240_112306022 | 153 |
| 409 | 3300009094 | Ga0111539_10015589 | Ga0111539_100155898 | 153 |
| 410 | 3300009094 | Ga0111539_10061276 | Ga0111539_100612763 | 153 |
| 411 | 3300009094 | Ga0111539_10099199 | Ga0111539_100991993 | 153 |
| 412 | 3300009098 | Ga0105245_10002315 | Ga0105245_1000231516 | 153 |
| 413 | 3300009098 | Ga0105245_10027258 | Ga0105245_100272582 | 153 |
| 414 | 3300009101 | Ga0105247_10059316 | Ga0105247_100593163 | 153 |
| 415 | 3300009101 | Ga0105247_10793586 | Ga0105247_107935862 | 153 |
| 416 | 3300009147 | Ga0114129_10028714 | Ga0114129_100287147 | 153 |
| 417 | 3300009147 | Ga0114129_10071219 | Ga0114129_100712196 | 153 |
| 418 | 3300009147 | Ga0114129_10299267 | Ga0114129_102992672 | 153 |
| 419 | 3300009148 | Ga0105243_10010712 | Ga0105243_100107123 | 153 |
| 420 | 3300009174 | Ga0105241_10087270 | Ga0105241_100872702 | 153 |
| 421 | 3300009176 | Ga0105242_10332659 | Ga0105242_103326591 | 153 |
| 422 | 3300009176 | Ga0105242_10750350 | Ga0105242_107503501 | 153 |
| 423 | 3300009177 | Ga0105248_10411253 | Ga0105248_104112531 | 153 |
| 424 | 3300009553 | Ga0105249_10000178 | Ga0105249_1000017838 | 153 |
| 425 | 3300009553 | Ga0105249_10003509 | Ga0105249_1000350917 | 153 |
| 426 | 3300009553 | Ga0105249_10027036 | Ga0105249_100270363 | 153 |
| 427 | 3300010375 | Ga0105239_10028036 | Ga0105239_100280366 | 153 |
| 428 | 3300011119 | Ga0105246_10019647 | Ga0105246_100196474 | 153 |
| 429 | 3300013105 | Ga0157369_10257524 | Ga0157369_102575243 | 153 |
| 430 | 3300013296 | Ga0157374_10036246 | Ga0157374_100362463 | 153 |
| 431 | 3300013306 | Ga0163162_10011116 | Ga0163162_100111162 | 153 |
| 432 | 3300013306 | Ga0163162_10350011 | Ga0163162_103500113 | 153 |
| 433 | 3300013307 | Ga0157372_10030500 | Ga0157372_100305003 | 153 |
| 434 | 3300013308 | Ga0157375_10059940 | Ga0157375_100599403 | 153 |
| 435 | 3300014325 | Ga0163163_10091411 | Ga0163163_100914114 | 153 |
| 436 | 3300014326 | Ga0157380_10038130 | Ga0157380_100381303 | 153 |
| 437 | 3300014326 | Ga0157380_10502783 | Ga0157380_105027832 | 153 |
| 438 | 3300014745 | Ga0157377_10006554 | Ga0157377_100065543 | 153 |
| 439 | 3300014968 | Ga0157379_10002058 | Ga0157379_100020589 | 153 |
| 440 | 3300014968 | Ga0157379_10011155 | Ga0157379_100111557 | 153 |
| 441 | 3300014968 | Ga0157379_10379494 | Ga0157379_103794941 | 153 |
| 442 | 3300017792 | Ga0163161_10141770 | Ga0163161_101417702 | 153 |
| 443 | 3300021384 | Ga0213876_10468401 | Ga0213876_104684011 | 153 |
| 444 | 3300021388 | Ga0213875_10000092 | Ga0213875_1000009255 | 153 |
| 445 | 3300025893 | Ga0207682_10000155 | Ga0207682_1000015517 | 153 |
| 446 | 3300025898 | Ga0207692_10039942 | Ga0207692_100399424 | 153 |
| 447 | 3300025898 | Ga0207692_10304844 | Ga0207692_103048442 | 153 |
| 448 | 3300025901 | Ga0207688_10001463 | Ga0207688_1000146312 | 153 |
| 449 | 3300025901 | Ga0207688_10032737 | Ga0207688_100327373 | 153 |
| 450 | 3300025904 | Ga0207647_10408923 | Ga0207647_104089231 | 153 |
| 451 | 3300025905 | Ga0207685_10028047 | Ga0207685_100280474 | 153 |
| 452 | 3300025906 | Ga0207699_10086951 | Ga0207699_100869514 | 153 |
| 453 | 3300025906 | Ga0207699_10654453 | Ga0207699_106544532 | 153 |
| 454 | 3300025911 | Ga0207654_10049139 | Ga0207654_100491392 | 153 |
| 455 | 3300025912 | Ga0207707_10033886 | Ga0207707_100338863 | 153 |
| 456 | 3300025915 | Ga0207693_10004163 | Ga0207693_100041638 | 153 |
| 457 | 3300025915 | Ga0207693_10103732 | Ga0207693_101037323 | 153 |
| 458 | 3300025916 | Ga0207663_10178801 | Ga0207663_101788012 | 153 |
| 459 | 3300025919 | Ga0207657_10486435 | Ga0207657_104864352 | 153 |
| 460 | 3300025919 | Ga0207657_10984520 | Ga0207657_109845202 | 153 |
| 461 | 3300025920 | Ga0207649_10006670 | Ga0207649_100066708 | 153 |
| 462 | 3300025921 | Ga0207652_10003179 | Ga0207652_1000317918 | 153 |
| 463 | 3300025923 | Ga0207681_10235176 | Ga0207681_102351762 | 153 |
| 464 | 3300025927 | Ga0207687_10000085 | Ga0207687_1000008551 | 153 |
| 465 | 3300025927 | Ga0207687_10040757 | Ga0207687_100407573 | 153 |
| 466 | 3300025928 | Ga0207700_10105546 | Ga0207700_101055462 | 153 |
| 467 | 3300025928 | Ga0207700_10191297 | Ga0207700_101912974 | 153 |
| 468 | 3300025928 | Ga0207700_10216653 | Ga0207700_102166532 | 153 |
| 469 | 3300025928 | Ga0207700_10744706 | Ga0207700_107447061 | 153 |
| 470 | 3300025928 | Ga0207700_11166138 | Ga0207700_111661381 | 153 |
| 471 | 3300025929 | Ga0207664_10006572 | Ga0207664_100065726 | 153 |
| 472 | 3300025929 | Ga0207664_10119433 | Ga0207664_101194334 | 153 |
| 473 | 3300025929 | Ga0207664_10977120 | Ga0207664_109771201 | 153 |
| 474 | 3300025931 | Ga0207644_10905327 | Ga0207644_109053272 | 153 |
| 475 | 3300025932 | Ga0207690_10006710 | Ga0207690_100067107 | 153 |
| 476 | 3300025935 | Ga0207709_10014822 | Ga0207709_100148224 | 153 |
| 477 | 3300025936 | Ga0207670_10774233 | Ga0207670_107742332 | 153 |
| 478 | 3300025938 | Ga0207704_11396538 | Ga0207704_113965382 | 153 |
| 479 | 3300025941 | Ga0207711_10284537 | Ga0207711_102845371 | 153 |
| 480 | 3300025942 | Ga0207689_10018894 | Ga0207689_100188945 | 153 |
| 481 | 3300025942 | Ga0207689_10196142 | Ga0207689_101961422 | 153 |
| 482 | 3300025944 | Ga0207661_10005670 | Ga0207661_100056705 | 153 |
| 483 | 3300025944 | Ga0207661_10022461 | Ga0207661_100224613 | 153 |
| 484 | 3300025944 | Ga0207661_10045458 | Ga0207661_100454583 | 153 |
| 485 | 3300025945 | Ga0207679_10017271 | Ga0207679_100172712 | 153 |
| 486 | 3300025961 | Ga0207712_10000118 | Ga0207712_1000011840 | 153 |
| 487 | 3300025961 | Ga0207712_10011490 | Ga0207712_100114905 | 153 |
| 488 | 3300025961 | Ga0207712_10172949 | Ga0207712_101729492 | 153 |
| 489 | 3300025961 | Ga0207712_10717794 | Ga0207712_107177942 | 153 |
| 490 | 3300025972 | Ga0207668_10003764 | Ga0207668_100037644 | 153 |
| 491 | 3300025972 | Ga0207668_10031903 | Ga0207668_100319036 | 153 |
| 492 | 3300025972 | Ga0207668_10205640 | Ga0207668_102056401 | 153 |
| 493 | 3300025981 | Ga0207640_10004771 | Ga0207640_100047718 | 153 |
| 494 | 3300025986 | Ga0207658_10003877 | Ga0207658_100038773 | 153 |
| 495 | 3300026023 | Ga0207677_10027216 | Ga0207677_100272162 | 153 |
| 496 | 3300026023 | Ga0207677_12113950 | Ga0207677_121139501 | 153 |
| 497 | 3300026035 | Ga0207703_10000061 | Ga0207703_1000006172 | 153 |
| 498 | 3300026041 | Ga0207639_10008945 | Ga0207639_100089454 | 153 |
| 499 | 3300026067 | Ga0207678_10196352 | Ga0207678_101963521 | 153 |
| 500 | 3300026075 | Ga0207708_10002521 | Ga0207708_100025215 | 153 |
| 501 | 3300026075 | Ga0207708_10022177 | Ga0207708_100221774 | 153 |
| 502 | 3300026078 | Ga0207702_10064452 | Ga0207702_100644527 | 153 |
| 503 | 3300026078 | Ga0207702_10069870 | Ga0207702_100698703 | 153 |
| 504 | 3300026095 | Ga0207676_10000018 | Ga0207676_10000018131 | 153 |
| 505 | 3300026095 | Ga0207676_10045515 | Ga0207676_100455156 | 153 |
| 506 | 3300026118 | Ga0207675_100190001 | Ga0207675_1001900013 | 153 |
| 507 | 3300026118 | Ga0207675_100229136 | Ga0207675_1002291362 | 153 |
| 508 | 3300026118 | Ga0207675_101330844 | Ga0207675_1013308441 | 153 |
| 509 | 3300026121 | Ga0207683_10039762 | Ga0207683_100397622 | 153 |
| 510 | 3300027907 | Ga0207428_10040292 | Ga0207428_100402923 | 153 |
| 511 | 3300027907 | Ga0207428_10238666 | Ga0207428_102386662 | 153 |
| 512 | 3300028379 | Ga0268266_10000056 | Ga0268266_10000056111 | 153 |
| 513 | 3300028379 | Ga0268266_10026262 | Ga0268266_100262622 | 153 |
| 514 | 3300028379 | Ga0268266_10585279 | Ga0268266_105852792 | 153 |
| 515 | 3300028379 | Ga0268266_11341145 | Ga0268266_113411451 | 153 |
| 516 | 3300028380 | Ga0268265_10001477 | Ga0268265_100014773 | 153 |
| 517 | 3300028380 | Ga0268265_10189223 | Ga0268265_101892233 | 153 |
| 518 | 3300031548 | Ga0307408_100444973 | Ga0307408_1004449732 | 153 |
| 519 | 3300031901 | Ga0307406_10332294 | Ga0307406_103322942 | 153 |
| 520 | 3300031903 | Ga0307407_10441894 | Ga0307407_104418942 | 153 |
| 521 | 3300031995 | Ga0307409_100203821 | Ga0307409_1002038212 | 153 |
| 522 | 3300031995 | Ga0307409_100467354 | Ga0307409_1004673542 | 153 |
| 523 | 3300031995 | Ga0307409_101085030 | Ga0307409_1010850301 | 153 |
| 524 | 3300032002 | Ga0307416_100264505 | Ga0307416_1002645052 | 153 |
| 525 | 3300032002 | Ga0307416_100288071 | Ga0307416_1002880712 | 153 |
| 526 | 3300032002 | Ga0307416_100426506 | Ga0307416_1004265062 | 153 |
| 527 | 3300032002 | Ga0307416_100426966 | Ga0307416_1004269662 | 153 |
| 528 | 3300032004 | Ga0307414_11171869 | Ga0307414_111718692 | 153 |
| 529 | 3300032126 | Ga0307415_100779586 | Ga0307415_1007795862 | 153 |
| 530 | 3300035111 | Ga0373923_0084751 | Ga0373923_0084751_382_843 | 153 |
| 531 | 3300035112 | Ga0373932_0124646 | Ga0373932_0124646_296_757 | 153 |
| 532 | 3300035241 | Ga0373961_0140984 | Ga0373961_0140984_184_645 | 153 |
| 533 | 3300035242 | Ga0373962_0061522 | Ga0373962_0061522_201_662 | 153 |
| 534 | 3300035692 | Ga0373935_0997933 | Ga0373935_0997933_118_591 | 153 |
| 535 | 3300035724 | Ga0373933_0215486 | Ga0373933_0215486_633_1094 | 153 |
| 536 | 3300036401 | Ga0373937_0023832 | Ga0373937_0023832_3380_3841 | 153 |
| 537 | 3300036401 | Ga0373937_0505888 | Ga0373937_0505888_117_578 | 153 |
| 538 | 3300036401 | Ga0373937_0900362 | Ga0373937_0900362_235_696 | 153 |
| 539 | 3300037418 | Ga0395900_1344206 | Ga0395900_1344206_132_596 | 153 |
| 540 | 3300037466 | Ga0395898_0281982 | Ga0395898_0281982_447_908 | 153 |
| 541 | 3300037466 | Ga0395898_0311782 | Ga0395898_0311782_282_755 | 153 |
| 542 | 3300037466 | Ga0395898_0396264 | Ga0395898_0396264_567_1028 | 153 |
| 543 | 3300037853 | Ga0436364_0101821 | Ga0436364_0101821_198_659 | 153 |
| 544 | 3300037853 | Ga0436364_0527355 | Ga0436364_0527355_100217_100678 | 153 |
| 545 | 3300037853 | Ga0436364_0871836 | Ga0436364_0871836_42_503 | 153 |
| 546 | 3300037853 | Ga0436364_1212621 | Ga0436364_1212621_1547_2008 | 153 |
| 547 | 3300038443 | Ga0395901_0047569 | Ga0395901_0047569_3535_3996 | 153 |
| 548 | 3300038443 | Ga0395901_0235963 | Ga0395901_0235963_471_932 | 153 |
| 549 | 3300038443 | Ga0395901_0450187 | Ga0395901_0450187_59_520 | 153 |
| 550 | 3300039437 | Ga0436365_0584781 | Ga0436365_0584781_281_742 | 153 |
| 551 | 3300039450 | Ga0436363_1072591 | Ga0436363_1072591_191_652 | 153 |
| 552 | 3300041512 | Ga0451853_0066269 | Ga0451853_0066269_4105_4566 | 153 |
| 553 | 3300042437 | Ga0439444_0026038 | Ga0439444_0026038_135_596 | 153 |
| 554 | 3300042461 | Ga0439460_0032601 | Ga0439460_0032601_629_1090 | 153 |
| 555 | 3300042993 | Ga0439440_0084737 | Ga0439440_0084737_252_713 | 153 |
| 556 | 3300044656 | Ga0466969_0047859 | Ga0466969_0047859_1274_1735 | 153 |
| 557 | 3300044684 | Ga0466966_0050150 | Ga0466966_0050150_1134_1595 | 153 |
| 558 | 3300044684 | Ga0466966_0215976 | Ga0466966_0215976_228_689 | 153 |
| 559 | 3300044693 | Ga0466961_0033653 | Ga0466961_0033653_1697_2158 | 153 |
| 560 | 3300044693 | Ga0466961_0632880 | Ga0466961_0632880_162_623 | 153 |
| 561 | 3300044694 | Ga0466963_0194549 | Ga0466963_0194549_521_982 | 153 |
| 562 | 3300044706 | Ga0466964_0032811 | Ga0466964_0032811_1177_1638 | 153 |
| 563 | 3300044842 | Ga0466957_1035931 | Ga0466957_1035931_45_506 | 153 |
| 564 | 3300044842 | Ga0466957_1240084 | Ga0466957_1240084_14_475 | 153 |
| 565 | 3300044901 | Ga0466960_0239216 | Ga0466960_0239216_99_560 | 153 |
| 566 | 3300045049 | Ga0466959_0143418 | Ga0466959_0143418_849_1310 | 153 |
| 567 | 3300045049 | Ga0466959_0308002 | Ga0466959_0308002_550_1011 | 153 |
| 568 | 3300045049 | Ga0466959_0784177 | Ga0466959_0784177_78_539 | 153 |
| 569 | 3300045836 | Ga0466958_0024372 | Ga0466958_0024372_2445_2906 | 153 |
| 570 | 3300045836 | Ga0466958_0360228 | Ga0466958_0360228_88_549 | 153 |
| 571 | 3300045836 | Ga0466958_0839676 | Ga0466958_0839676_101_562 | 153 |
| 572 | 3300046459 | Ga0495629_0162383 | Ga0495629_0162383_957_1418 | 153 |
| 573 | 3300046461 | Ga0495641_0000005 | Ga0495641_0000005_117593_118054 | 153 |
| 574 | 3300046461 | Ga0495641_0039116 | Ga0495641_0039116_636_1097 | 153 |
| 575 | 3300046461 | Ga0495641_0120749 | Ga0495641_0120749_267_728 | 153 |
| 576 | 3300046462 | Ga0495651_0011617 | Ga0495651_0011617_459_920 | 153 |
| 577 | 3300046463 | Ga0495653_0128610 | Ga0495653_0128610_765_1226 | 153 |
| 578 | 3300046463 | Ga0495653_0221127 | Ga0495653_0221127_239_700 | 153 |
| 579 | 3300046463 | Ga0495653_0466412 | Ga0495653_0466412_199_660 | 153 |
| 580 | 3300046476 | Ga0495662_0054000 | Ga0495662_0054000_747_1208 | 153 |
| 581 | 3300046500 | Ga0495596_0025129 | Ga0495596_0025129_818_1279 | 153 |
| 582 | 3300046511 | Ga0495608_0053756 | Ga0495608_0053756_362_823 | 153 |
| 583 | 3300046511 | Ga0495608_0093867 | Ga0495608_0093867_518_979 | 153 |
| 584 | 3300046515 | Ga0495620_0000972 | Ga0495620_0000972_2905_3366 | 153 |
| 585 | 3300046515 | Ga0495620_0209224 | Ga0495620_0209224_161_622 | 153 |
| 586 | 3300046516 | Ga0495628_0454158 | Ga0495628_0454158_296_757 | 153 |
| 587 | 3300046516 | Ga0495628_0947914 | Ga0495628_0947914_85_546 | 153 |
| 588 | 3300046517 | Ga0495630_0045063 | Ga0495630_0045063_1942_2403 | 153 |
| 589 | 3300046518 | Ga0495631_0375151 | Ga0495631_0375151_68_529 | 153 |
| 590 | 3300046525 | Ga0495663_0166487 | Ga0495663_0166487_163_624 | 153 |
| 591 | 3300046529 | Ga0495652_0263669 | Ga0495652_0263669_530_991 | 153 |
| 592 | 3300046536 | Ga0495587_0019289 | Ga0495587_0019289_662_1123 | 153 |
| 593 | 3300046537 | Ga0495598_0126442 | Ga0495598_0126442_380_841 | 153 |
| 594 | 3300046542 | Ga0495597_0341472 | Ga0495597_0341472_29_490 | 153 |
| 595 | 3300046543 | Ga0495645_0142490 | Ga0495645_0142490_655_1116 | 153 |
| 596 | 3300046559 | Ga0495667_0026645 | Ga0495667_0026645_3267_3728 | 153 |
| 597 | 3300046559 | Ga0495667_0182188 | Ga0495667_0182188_504_965 | 153 |
| 598 | 3300046615 | Ga0495656_0000876 | Ga0495656_0000876_5617_6078 | 153 |
| 599 | 3300046660 | Ga0495625_0000688 | Ga0495625_0000688_14864_15325 | 153 |
| 600 | 3300046675 | Ga0495657_0426170 | Ga0495657_0426170_25_486 | 153 |
| 601 | 3300046678 | Ga0495599_0028373 | Ga0495599_0028373_2467_2928 | 153 |
| 602 | 3300046684 | Ga0495669_0000076 | Ga0495669_0000076_36273_36764 | 153 |
| 603 | 3300046694 | Ga0495649_0003116 | Ga0495649_0003116_5324_5785 | 153 |
| 604 | 3300046809 | Ga0495600_0033198 | Ga0495600_0033198_68_529 | 153 |
| 605 | 3300046809 | Ga0495600_0075765 | Ga0495600_0075765_1124_1585 | 153 |
| 606 | 3300046809 | Ga0495600_0419674 | Ga0495600_0419674_262_723 | 153 |
| 607 | 3300046810 | Ga0495660_0319139 | Ga0495660_0319139_31_492 | 153 |
| 608 | 3300047315 | Ga0495581_0278135 | Ga0495581_0278135_310_771 | 153 |
| 609 | 3300047317 | Ga0495604_0109898 | Ga0495604_0109898_859_1320 | 153 |
| 610 | 3300047319 | Ga0495674_0154770 | Ga0495674_0154770_43_504 | 153 |
| 611 | 3300047319 | Ga0495674_0272861 | Ga0495674_0272861_720_1181 | 153 |
| 612 | 3300047319 | Ga0495674_0550544 | Ga0495674_0550544_179_640 | 153 |
| 613 | 3300047321 | Ga0495676_0000238 | Ga0495676_0000238_15315_15776 | 153 |
| 614 | 3300047322 | Ga0495680_0000488 | Ga0495680_0000488_39328_39789 | 153 |
| 615 | 3300047322 | Ga0495680_0014912 | Ga0495680_0014912_4892_5353 | 153 |
| 616 | 3300047322 | Ga0495680_0495093 | Ga0495680_0495093_21_482 | 153 |
| 617 | 3300047471 | Ga0495684_0221941 | Ga0495684_0221941_17_478 | 153 |
| 618 | 3300047673 | Ga0495593_0117786 | Ga0495593_0117786_183_644 | 153 |
| 619 | 3300048088 | Ga0495602_0296301 | Ga0495602_0296301_68_529 | 153 |
| 620 | 3300048089 | Ga0495614_0198967 | Ga0495614_0198967_224_685 | 153 |
| 621 | 3300048090 | Ga0495615_0165603 | Ga0495615_0165603_166_627 | 153 |
| 622 | 3300048903 | Ga0496100_0000059 | Ga0496100_0000059_21131_21592 | 153 |
| 623 | 3300048903 | Ga0496100_0071390 | Ga0496100_0071390_660_1133 | 153 |
| 624 | 3300048904 | Ga0496101_0000135 | Ga0496101_0000135_43927_44388 | 153 |
| 625 | 3300048905 | Ga0496102_0010453 | Ga0496102_0010453_4494_4967 | 153 |
| 626 | 3300048906 | Ga0496103_0007100 | Ga0496103_0007100_4778_5251 | 153 |
| 627 | 3300048907 | Ga0496104_0000025 | Ga0496104_0000025_35152_35613 | 153 |
| 628 | 3300048907 | Ga0496104_0036817 | Ga0496104_0036817_3852_4325 | 153 |
| 629 | 3300048907 | Ga0496104_0172010 | Ga0496104_0172010_371_832 | 153 |
| 630 | 3300048907 | Ga0496104_1398966 | Ga0496104_1398966_29_490 | 153 |
| 631 | 3300048908 | Ga0496105_0000023 | Ga0496105_0000023_35152_35613 | 153 |
| 632 | 3300048908 | Ga0496105_0053603 | Ga0496105_0053603_1146_1619 | 153 |
| 633 | 3300048908 | Ga0496105_0541865 | Ga0496105_0541865_366_827 | 153 |
| 634 | 3300048909 | Ga0496106_0000252 | Ga0496106_0000252_16469_16930 | 153 |
| 635 | 3300048909 | Ga0496106_0028208 | Ga0496106_0028208_266_739 | 153 |
| 636 | 3300048910 | Ga0496107_0000054 | Ga0496107_0000054_43927_44388 | 153 |
| 637 | 3300048910 | Ga0496107_0820495 | Ga0496107_0820495_129_602 | 153 |
| 638 | 3300048911 | Ga0496108_0000006 | Ga0496108_0000006_414864_415325 | 153 |
| 639 | 3300048911 | Ga0496108_0072626 | Ga0496108_0072626_621_1094 | 153 |
| 640 | 3300048911 | Ga0496108_0176271 | Ga0496108_0176271_1106_1567 | 153 |
| 641 | 3300048911 | Ga0496108_0500656 | Ga0496108_0500656_205_666 | 153 |
| 642 | 3300048912 | Ga0496109_0000009 | Ga0496109_0000009_181952_182413 | 153 |
| 643 | 3300048912 | Ga0496109_0013153 | Ga0496109_0013153_5402_5875 | 153 |
| 644 | 3300048913 | Ga0496110_0017977 | Ga0496110_0017977_3448_3921 | 153 |
| 645 | 3300048914 | Ga0496111_0011889 | Ga0496111_0011889_354_827 | 153 |
| 646 | 3300048915 | Ga0496112_0006893 | Ga0496112_0006893_7966_8439 | 153 |
| 647 | 3300048915 | Ga0496112_0293721 | Ga0496112_0293721_1090_1551 | 153 |
| 648 | 3300048915 | Ga0496112_0345347 | Ga0496112_0345347_561_1022 | 153 |
| 649 | 3300048916 | Ga0496113_0003664 | Ga0496113_0003664_3606_4067 | 153 |
| 650 | 3300048916 | Ga0496113_0009882 | Ga0496113_0009882_1650_2123 | 153 |
| 651 | 3300048916 | Ga0496113_0161084 | Ga0496113_0161084_1189_1650 | 153 |
| 652 | 3300048916 | Ga0496113_0960070 | Ga0496113_0960070_62_523 | 153 |
| 653 | 3300048917 | Ga0496114_0208921 | Ga0496114_0208921_1118_1579 | 153 |
| 654 | 3300048917 | Ga0496114_0379134 | Ga0496114_0379134_141_602 | 153 |
| 655 | 3300048917 | Ga0496114_0803710 | Ga0496114_0803710_249_722 | 153 |
| 656 | 3300048918 | Ga0496115_0302569 | Ga0496115_0302569_10_471 | 153 |
| 657 | 3300048918 | Ga0496115_0620962 | Ga0496115_0620962_50_523 | 153 |
| 658 | 3300048928 | Ga0496125_0052439 | Ga0496125_0052439_2829_3290 | 153 |
| 659 | 3300049568 | Ga0501031_0145127 | Ga0501031_0145127_912_1373 | 153 |
| 660 | 3300049572 | Ga0501036_0269376 | Ga0501036_0269376_937_1398 | 153 |
| 661 | 3300049572 | Ga0501036_0886598 | Ga0501036_0886598_111_572 | 153 |
| 662 | 3300049574 | Ga0501038_0581847 | Ga0501038_0581847_363_824 | 153 |
| 663 | 3300049575 | Ga0501039_0083616 | Ga0501039_0083616_1883_2344 | 153 |
| 664 | 3300049575 | Ga0501039_1353687 | Ga0501039_1353687_19_480 | 153 |
| 665 | 3300049576 | Ga0501040_0068674 | Ga0501040_0068674_1151_1612 | 153 |
| 666 | 3300049577 | Ga0501041_0831293 | Ga0501041_0831293_107_568 | 153 |
| 667 | 3300049578 | Ga0501042_0063320 | Ga0501042_0063320_1206_1667 | 153 |
| 668 | 3300049580 | Ga0501046_0253760 | Ga0501046_0253760_294_755 | 153 |
| 669 | 3300049586 | Ga0501070_0125458 | Ga0501070_0125458_714_1175 | 153 |
| 670 | 3300049590 | Ga0501074_0246545 | Ga0501074_0246545_400_861 | 153 |
| 671 | 3300049591 | Ga0501075_0729051 | Ga0501075_0729051_57_518 | 153 |
| 672 | 3300049592 | Ga0501076_0202845 | Ga0501076_0202845_168_629 | 153 |
| 673 | 3300049592 | Ga0501076_0501048 | Ga0501076_0501048_520_981 | 153 |
| 674 | 3300049741 | Ga0501079_0325836 | Ga0501079_0325836_185_646 | 153 |
| 675 | 3300049741 | Ga0501079_0347697 | Ga0501079_0347697_224_685 | 153 |
| 676 | 3300049742 | Ga0501080_1095936 | Ga0501080_1095936_44_505 | 153 |
| 677 | 3300049743 | Ga0501081_0092097 | Ga0501081_0092097_774_1235 | 153 |
| 678 | 3300049743 | Ga0501081_0148679 | Ga0501081_0148679_556_1017 | 153 |
| 679 | 3300049743 | Ga0501081_1465787 | Ga0501081_1465787_15_476 | 153 |
| 680 | 3300049822 | Ga0501035_0831304 | Ga0501035_0831304_122_583 | 153 |
| 681 | 3300050491 | nmdc:mga00v17_231045_c1 | nmdc:mga00v17_231045_c1_411_872 | 153 |
| 682 | 3300050494 | nmdc:mga06z11_308852_c1 | nmdc:mga06z11_308852_c1_104_565 | 153 |
| 683 | 3300050507 | nmdc:mga05p37_27288_c1 | nmdc:mga05p37_27288_c1_1414_1875 | 153 |
| 684 | 3300050507 | nmdc:mga05p37_286433_c1 | nmdc:mga05p37_286433_c1_849_1310 | 153 |
| 685 | 3300050507 | nmdc:mga05p37_705547_c1 | nmdc:mga05p37_705547_c1_125_586 | 153 |
| 686 | 3300050508 | nmdc:mga09592_226034_c1 | nmdc:mga09592_226034_c1_915_1376 | 153 |
| 687 | 3300050508 | nmdc:mga09592_631670_c1 | nmdc:mga09592_631670_c1_326_799 | 153 |
| 688 | 3300050509 | nmdc:mga0qj67_40911_c1 | nmdc:mga0qj67_40911_c1_1612_2073 | 153 |
| 689 | 3300050509 | nmdc:mga0qj67_9991_c1 | nmdc:mga0qj67_9991_c1_2255_2716 | 153 |
| 690 | 3300050510 | nmdc:mga06r32_140791_c1 | nmdc:mga06r32_140791_c1_1574_2035 | 153 |
| 691 | 3300050510 | nmdc:mga06r32_238861_c1 | nmdc:mga06r32_238861_c1_428_901 | 153 |
| 692 | 3300050510 | nmdc:mga06r32_308068_c1 | nmdc:mga06r32_308068_c1_479_940 | 153 |
| 693 | 3300050510 | nmdc:mga06r32_9888_c1 | nmdc:mga06r32_9888_c1_2688_3149 | 153 |
| 694 | 3300050511 | nmdc:mga08y16_211564_c1 | nmdc:mga08y16_211564_c1_825_1286 | 153 |
| 695 | 3300050511 | nmdc:mga08y16_403990_c1 | nmdc:mga08y16_403990_c1_224_685 | 153 |
| 696 | 3300050511 | nmdc:mga08y16_59057_c1 | nmdc:mga08y16_59057_c1_2835_3308 | 153 |
| 697 | 3300050512 | nmdc:mga0n895_77920_c1 | nmdc:mga0n895_77920_c1_701_1174 | 153 |
| 698 | 3300050513 | nmdc:mga0rr50_1126973_c1 | nmdc:mga0rr50_1126973_c1_15_485 | 153 |
| 699 | 3300050513 | nmdc:mga0rr50_71823_c1 | nmdc:mga0rr50_71823_c1_2152_2625 | 153 |
| 700 | 3300050513 | nmdc:mga0rr50_73255_c1 | nmdc:mga0rr50_73255_c1_649_1110 | 153 |
| 701 | 3300050514 | nmdc:mga08x19_234686_c1 | nmdc:mga08x19_234686_c1_18_491 | 153 |
| 702 | 3300050515 | nmdc:mga0a205_286653_c1 | nmdc:mga0a205_286653_c1_924_1385 | 153 |
| 703 | 3300050515 | nmdc:mga0a205_296625_c1 | nmdc:mga0a205_296625_c1_197_658 | 153 |
| 704 | 3300053078 | Ga0495612_0000067 | Ga0495612_0000067_21329_21790 | 153 |
| 705 | 3300053078 | Ga0495612_0014801 | Ga0495612_0014801_2106_2567 | 153 |
| 706 | 3300053083 | Ga0495655_0078586 | Ga0495655_0078586_345_806 | 153 |
| 707 | 3300053084 | Ga0495595_0128113 | Ga0495595_0128113_676_1137 | 153 |
| 708 | 3300053084 | Ga0495595_0281587 | Ga0495595_0281587_347_808 | 153 |
| 709 | 3300053085 | Ga0495619_0007731 | Ga0495619_0007731_4380_4841 | 153 |
| 710 | 3300053085 | Ga0495619_0148072 | Ga0495619_0148072_280_741 | 153 |
| 711 | 3300053123 | Ga0500614_000427 | Ga0500614_000427_2912_3373 | 153 |
| 712 | 3300054114 | Ga0501084_0186064 | Ga0501084_0186064_1170_1631 | 153 |
| 713 | 3300060353 | Ga0501082_0371763 | Ga0501082_0371763_77_538 | 153 |
| 714 | 3300060353 | Ga0501082_0786262 | Ga0501082_0786262_14_475 | 153 |
| 715 | 3300061719 | Ga0466962_0022394 | Ga0466962_0022394_244_705 | 153 |
| 716 | 3300061734 | Ga0530510_0037571 | Ga0530510_0037571_1883_2344 | 153 |
| 717 | 3300061734 | Ga0530510_0282536 | Ga0530510_0282536_756_1217 | 153 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1xbf-assembly1.cif.gz_C | x-ray structure northeast structural genomics consortium target car10 from c. acetobutylicum | 0.9582 | 4 | 151 |
| 2p6c-assembly1.cif.gz_A | crystal structure of hypothetical protein aq_2013 from aquifex aeolicus vf5. | 0.9461 | 1 | 153 |
| 1xbf-assembly1.cif.gz_C | x-ray structure northeast structural genomics consortium target car10 from c. acetobutylicum | 0.9429 | 4 | 151 |
| 1vmj-assembly1.cif.gz_A | crystal structure of a putative thiamin phosphate synthase (tm0723) from thermotoga maritima msb8 at 1.52 a resolution | 0.9407 | 1 | 153 |
| 2p6c-assembly1.cif.gz_A | crystal structure of hypothetical protein aq_2013 from aquifex aeolicus vf5. | 0.9395 | 1 | 153 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2p6cB00 | Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like | 0.9459 | 1 | 153 | 2.60.120.460 |
| 2p6cB00 | Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like | 0.9392 | 1 | 153 | 2.60.120.460 |
| 1xbfB00 | Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like | 0.9243 | 6 | 151 | 2.60.120.460 |
| 1xbfB00 | Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like | 0.9035 | 6 | 151 | 2.60.120.460 |
| 1vphC00 | Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like | 0.8802 | 2 | 153 | 2.60.120.460 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V8WEF2-F1-model_v4 | YjbQ family protein | 0.9584 | 3 | 153 |
|
| AF-A0A1L6L9R6-F1-model_v4 | deleted | 0.9572 | 2 | 153 |
|
| AF-A0A1G3AQ06-F1-model_v4 | Secondary thiamine-phosphate synthase enzyme | 0.9542 | 1 | 139 |
|
| AF-A0A2V8CDQ4-F1-model_v4 | Secondary thiamine-phosphate synthase enzyme | 0.9526 | 1 | 140 |
|
| AF-A0A2V8HHR8-F1-model_v4 | Secondary thiamine-phosphate synthase enzyme | 0.9515 | 10 | 138 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar