F477118

General Info

Members Datasets Scaffolds Average Seq Length
717 317 717 150

Family's Representative Sequence

Representative Sequence 3300046684|Ga0495669_0000076|Ga0495669_0000076_36273_36764
Length 163
Sequence VSVAAKRRNEIKSHTAYMTFNTERRRELIRITEEVQAAVDEAGIEEGMVLVSAMHITAGVWVNDDEPGLHEDTLEWLDKVAPPSWKPAANGVAAELSPDGGDYRHHRGGEDNGDAHLKNLLVHHQAIVPVTAGRLDLGPWQQVFYCEFDGGRPKRLVIKAMGE

Samples

Sample ID Description Type Environment
1 3300000531 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
77 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
78 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
79 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
80 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
81 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
82 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
83 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
84 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
86 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
87 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
88 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
89 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
90 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
91 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
94 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
96 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
97 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
98 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
99 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
101 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
102 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
104 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
105 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
106 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
107 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
108 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
109 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
110 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
111 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
112 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
113 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
114 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
115 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
116 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
117 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
118 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
119 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
120 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
121 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
122 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
123 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
124 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
125 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
126 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
127 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
128 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
129 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
178 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
181 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
182 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
183 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
184 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
185 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
186 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
187 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
188 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
189 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
190 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
191 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
192 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
193 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
194 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
195 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
196 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
197 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
198 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
199 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
200 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
201 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
202 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
203 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
204 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
205 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
206 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
207 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
208 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
209 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
210 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
211 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
212 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
213 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
214 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
215 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
216 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
217 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
218 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
219 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
220 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
221 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
222 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
223 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
224 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
225 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
226 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
227 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
228 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
229 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
230 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
231 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
232 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
233 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
234 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
235 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
236 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
237 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
238 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
239 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
240 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
241 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
242 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
243 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
244 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
245 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
246 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
247 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
248 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
249 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
250 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
251 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
252 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
253 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
254 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
255 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
256 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
257 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
258 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
259 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
260 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
261 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
262 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
263 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
264 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
265 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
266 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
267 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
268 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
269 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
270 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
271 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
272 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
273 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
274 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
275 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
276 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
277 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
286 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
287 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
288 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
289 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
290 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
291 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
292 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
293 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
294 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
295 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
296 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
298 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
299 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
300 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
301 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
302 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
303 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
304 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
305 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
306 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
307 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
308 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
309 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
310 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
311 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
312 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
313 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
314 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
315 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
316 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
317 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.56
Nodule 0
Rhizoplane 6
Rhizosphere 92.05
Stem 0
Stem Tuber 0
Unclassified 1.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNBas_1002498 3300000531 Bacteria 1014
2 JGI25407J50210_10057872 3300003373 Bacteria 976
3 Ga0065704_10186197 3300005289 Bacteria 1212
4 Ga0065712_10120808 3300005290 Unclassified 1674
5 Ga0065712_10307204 3300005290 Bacteria 850
6 Ga0065715_10089219 3300005293 Bacteria 12358
7 Ga0065715_10164629 3300005293 Bacteria 1597
8 Ga0070658_10094939 3300005327 Bacteria 2461
9 Ga0070658_10408452 3300005327 Unclassified 1167
10 Ga0070658_10941978 3300005327 Bacteria 751
11 Ga0070676_10008896 3300005328 Bacteria 5426
12 Ga0070676_10427833 3300005328 Bacteria 926
13 Ga0070683_100007221 3300005329 Bacteria 9373
14 Ga0070683_100032094 3300005329 Bacteria 4780
15 Ga0070683_100056215 3300005329 Unclassified 3654
16 Ga0070683_100088896 3300005329 Bacteria 2899
17 Ga0070670_100048916 3300005331 Bacteria 3638
18 Ga0070670_100333071 3300005331 Bacteria 1331
19 Ga0070670_100336399 3300005331 Bacteria 1325
20 Ga0070670_101469079 3300005331 Bacteria 626
21 Ga0070677_10000015 3300005333 Bacteria 52793
22 Ga0068869_100017547 3300005334 Bacteria 4853
23 Ga0068869_100018855 3300005334 Bacteria 4704
24 Ga0068869_100187384 3300005334 Bacteria 1625
25 Ga0070666_10038088 3300005335 Bacteria 3199
26 Ga0070666_10416615 3300005335 Bacteria 967
27 Ga0070680_100001000 3300005336 Bacteria 20117
28 Ga0070680_100004158 3300005336 Bacteria 10844
29 Ga0070680_100098331 3300005336 Unclassified 2427
30 Ga0070682_100002611 3300005337 Bacteria 9950
31 Ga0070682_100005034 3300005337 Bacteria 7344
32 Ga0070682_100022910 3300005337 Bacteria 3705
33 Ga0070682_100035137 3300005337 Bacteria 3057
34 Ga0070682_100072785 3300005337 Bacteria 2203
35 Ga0070682_100299938 3300005337 Bacteria 1179
36 Ga0068868_100008846 3300005338 Bacteria 7214
37 Ga0068868_100043808 3300005338 Bacteria 3496
38 Ga0068868_100131979 3300005338 Bacteria 2044
39 Ga0070660_100039302 3300005339 Bacteria 3596
40 Ga0070660_100047557 3300005339 Bacteria 3293
41 Ga0070660_100107638 3300005339 Unclassified 2215
42 Ga0070660_100572524 3300005339 Bacteria 943
43 Ga0070660_100728691 3300005339 Unclassified 832
44 Ga0070660_101076415 3300005339 Unclassified 680
45 Ga0070689_100048812 3300005340 Bacteria 3266
46 Ga0070691_10091063 3300005341 Bacteria 1504
47 Ga0070687_100000591 3300005343 Bacteria 12045
48 Ga0070687_100999341 3300005343 Unclassified 606
49 Ga0070661_100010002 3300005344 Bacteria 6583
50 Ga0070661_100016393 3300005344 Bacteria 5237
51 Ga0070661_100037902 3300005344 Bacteria 3508
52 Ga0070661_100055181 3300005344 Unclassified 2910
53 Ga0070661_100473180 3300005344 Bacteria 999
54 Ga0070661_100964084 3300005344 Unclassified 706
55 Ga0070692_10007544 3300005345 Bacteria 4796
56 Ga0070692_10060475 3300005345 Bacteria 1994
57 Ga0070692_10088121 3300005345 Bacteria 1683
58 Ga0070692_10174083 3300005345 Bacteria 1243
59 Ga0070668_100003850 3300005347 Bacteria 11077
60 Ga0070668_100007138 3300005347 Bacteria 8280
61 Ga0070668_100047269 3300005347 Bacteria 3308
62 Ga0070668_100251306 3300005347 Bacteria 1468
63 Ga0070668_100274659 3300005347 Bacteria 1406
64 Ga0070669_100001600 3300005353 Bacteria 16366
65 Ga0070669_100006094 3300005353 Bacteria 8701
66 Ga0070669_100118683 3300005353 Bacteria 2015
67 Ga0070669_100176485 3300005353 Bacteria 1669
68 Ga0070675_100039320 3300005354 Bacteria 3860
69 Ga0070675_100077057 3300005354 Bacteria 2774
70 Ga0070675_100165595 3300005354 Unclassified 1904
71 Ga0070671_100050443 3300005355 Bacteria 3461
72 Ga0070671_100101987 3300005355 Bacteria 2408
73 Ga0070671_101036606 3300005355 Bacteria 719
74 Ga0070674_100019485 3300005356 Bacteria 4310
75 Ga0070673_100058428 3300005364 Bacteria 3049
76 Ga0070673_100083889 3300005364 Bacteria 2589
77 Ga0070673_100403274 3300005364 Bacteria 1223
78 Ga0070688_100012935 3300005365 Bacteria 4691
79 Ga0070659_100013862 3300005366 Bacteria 6013
80 Ga0070659_100035381 3300005366 Bacteria 3889
81 Ga0070659_100110145 3300005366 Bacteria 2223
82 Ga0070659_100788323 3300005366 Bacteria 826
83 Ga0070667_100001076 3300005367 Bacteria 24988
84 Ga0070667_100031163 3300005367 Bacteria 4445
85 Ga0070667_101153971 3300005367 Unclassified 725
86 Ga0070667_101423527 3300005367 Unclassified 650
87 Ga0070703_10284665 3300005406 Bacteria 683
88 Ga0070709_10001518 3300005434 Bacteria 12545
89 Ga0070709_10198710 3300005434 Bacteria 1419
90 Ga0070714_100008647 3300005435 Bacteria 7962
91 Ga0070714_100063920 3300005435 Bacteria 3166
92 Ga0070714_100487223 3300005435 Bacteria 1174
93 Ga0070713_100257901 3300005436 Bacteria 1592
94 Ga0070713_100268753 3300005436 Bacteria 1561
95 Ga0070713_100286600 3300005436 Bacteria 1512
96 Ga0070713_100542561 3300005436 Bacteria 1100
97 Ga0070710_10030600 3300005437 Bacteria 2898
98 Ga0070710_10052550 3300005437 Bacteria 2292
99 Ga0070710_10159492 3300005437 Bacteria 1398
100 Ga0070701_10014736 3300005438 Bacteria 3591
101 Ga0070701_10168672 3300005438 Bacteria 1273
102 Ga0070711_100022896 3300005439 Bacteria 4056
103 Ga0070711_100154693 3300005439 Bacteria 1732
104 Ga0070705_100031635 3300005440 Bacteria 2932
105 Ga0070705_100693042 3300005440 Bacteria 799
106 Ga0070705_100921558 3300005440 Bacteria 704
107 Ga0070700_100030817 3300005441 Bacteria 3209
108 Ga0070694_100142495 3300005444 Bacteria 1742
109 Ga0070663_100009811 3300005455 Bacteria 5948
110 Ga0070663_100083146 3300005455 Bacteria 2357
111 Ga0070663_101272667 3300005455 Bacteria 648
112 Ga0070678_100456361 3300005456 Bacteria 1120
113 Ga0070662_100000676 3300005457 Bacteria 20794
114 Ga0070662_100200299 3300005457 Unclassified 1584
115 Ga0070681_10000554 3300005458 Bacteria 30814
116 Ga0070681_10006906 3300005458 Bacteria 11050
117 Ga0070681_10011203 3300005458 Bacteria 8872
118 Ga0070681_10033452 3300005458 Bacteria 5161
119 Ga0070681_10460822 3300005458 Unclassified 1183
120 Ga0068867_100097053 3300005459 Bacteria 2245
121 Ga0068867_100491234 3300005459 Bacteria 1053
122 Ga0068867_100519253 3300005459 Bacteria 1027
123 Ga0068867_100913298 3300005459 Bacteria 791
124 Ga0070685_10097302 3300005466 Bacteria 1791
125 Ga0070685_10128988 3300005466 Bacteria 1579
126 Ga0070707_100029570 3300005468 Bacteria 5216
127 Ga0070698_100000181 3300005471 Bacteria 59362
128 Ga0070699_100068841 3300005518 Bacteria 3075
129 Ga0070699_100091673 3300005518 Bacteria 2657
130 Ga0070699_100319450 3300005518 Bacteria 1395
131 Ga0070679_100000913 3300005530 Bacteria 25634
132 Ga0070679_100001151 3300005530 Bacteria 23151
133 Ga0070679_100024888 3300005530 Bacteria 5868
134 Ga0070679_100038355 3300005530 Bacteria 4763
135 Ga0070679_100206251 3300005530 Bacteria 1930
136 Ga0070679_101569044 3300005530 Bacteria 606
137 Ga0070684_100014938 3300005535 Bacteria 6303
138 Ga0070684_100036110 3300005535 Bacteria 4234
139 Ga0070684_100122424 3300005535 Bacteria 2341
140 Ga0070684_100220425 3300005535 Bacteria 1731
141 Ga0070684_100235410 3300005535 Bacteria 1673
142 Ga0070684_100550508 3300005535 Bacteria 1071
143 Ga0068853_100014672 3300005539 Bacteria 6426
144 Ga0068853_101129578 3300005539 Unclassified 756
145 Ga0070672_100044304 3300005543 Bacteria 3435
146 Ga0070672_100053208 3300005543 Bacteria 3164
147 Ga0070672_100372343 3300005543 Bacteria 1221
148 Ga0070672_100755194 3300005543 Unclassified 854
149 Ga0070672_100801550 3300005543 Bacteria 829
150 Ga0070686_100078179 3300005544 Bacteria 2184
151 Ga0070686_101223968 3300005544 Unclassified 624
152 Ga0070695_100005050 3300005545 Bacteria 7777
153 Ga0070695_100169338 3300005545 Bacteria 1540
154 Ga0070695_100365579 3300005545 Bacteria 1085
155 Ga0070696_100556086 3300005546 Unclassified 920
156 Ga0070693_100572296 3300005547 Bacteria 812
157 Ga0070665_100000141 3300005548 Bacteria 135473
158 Ga0070665_100011876 3300005548 Bacteria 8796
159 Ga0070665_100071712 3300005548 Bacteria 3471
160 Ga0070665_100940423 3300005548 Bacteria 877
161 Ga0070704_100056539 3300005549 Bacteria 2786
162 Ga0070704_100618818 3300005549 Bacteria 953
163 Ga0068855_100077943 3300005563 Bacteria 3845
164 Ga0068855_100135428 3300005563 Bacteria 2811
165 Ga0068855_100476014 3300005563 Bacteria 1360
166 Ga0068855_100887862 3300005563 Bacteria 942
167 Ga0070664_100007495 3300005564 Bacteria 8809
168 Ga0070664_100007931 3300005564 Bacteria 8577
169 Ga0070664_100044347 3300005564 Bacteria 3755
170 Ga0070664_100045589 3300005564 Unclassified 3703
171 Ga0070664_100163606 3300005564 Bacteria 1970
172 Ga0070664_100916220 3300005564 Bacteria 822
173 Ga0070664_101941682 3300005564 Bacteria 558
174 Ga0068857_100005823 3300005577 Bacteria 10526
175 Ga0068857_100060125 3300005577 Bacteria 3376
176 Ga0068857_100061539 3300005577 Bacteria 3335
177 Ga0068854_100006720 3300005578 Bacteria 7332
178 Ga0068854_100081160 3300005578 Bacteria 2395
179 Ga0068854_101312474 3300005578 Bacteria 652
180 Ga0068856_100011418 3300005614 Bacteria 8616
181 Ga0068856_100015710 3300005614 Bacteria 7318
182 Ga0068856_100165712 3300005614 Bacteria 2221
183 Ga0068856_100571679 3300005614 Bacteria 1151
184 Ga0068856_102126307 3300005614 Bacteria 571
185 Ga0070702_100011078 3300005615 Bacteria 4474
186 Ga0070702_101613597 3300005615 Bacteria 537
187 Ga0068852_100005517 3300005616 Bacteria 9067
188 Ga0068852_101632956 3300005616 Unclassified 667
189 Ga0068859_100256946 3300005617 Bacteria 1838
190 Ga0068864_100000015 3300005618 Bacteria 303368
191 Ga0068864_100267203 3300005618 Bacteria 1593
192 Ga0068864_100557033 3300005618 Bacteria 1109
193 Ga0068864_101309178 3300005618 Bacteria 725
194 Ga0068861_100008729 3300005719 Bacteria 6975
195 Ga0068861_100049676 3300005719 Bacteria 3177
196 Ga0068861_100084338 3300005719 Bacteria 2494
197 Ga0068861_100313583 3300005719 Bacteria 1364
198 Ga0068861_100987796 3300005719 Bacteria 803
199 Ga0068851_10011400 3300005834 Bacteria 4168
200 Ga0068851_10036814 3300005834 Bacteria 2451
201 Ga0068870_10038721 3300005840 Bacteria 2464
202 Ga0068870_10148011 3300005840 Bacteria 1380
203 Ga0068870_10211698 3300005840 Bacteria 1181
204 Ga0068863_100006324 3300005841 Bacteria 11614
205 Ga0068863_100131471 3300005841 Bacteria 2390
206 Ga0068863_100488496 3300005841 Bacteria 1211
207 Ga0068863_100618811 3300005841 Bacteria 1073
208 Ga0068858_100000118 3300005842 Bacteria 83359
209 Ga0068858_100014761 3300005842 Bacteria 7350
210 Ga0068858_100314685 3300005842 Unclassified 1495
211 Ga0068860_100013620 3300005843 Bacteria 7971
212 Ga0068860_100275466 3300005843 Bacteria 1643
213 Ga0068862_100000266 3300005844 Bacteria 58197
214 Ga0068862_100000943 3300005844 Bacteria 28026
215 Ga0068862_100076020 3300005844 Bacteria 2906
216 Ga0068862_100103960 3300005844 Bacteria 2488
217 Ga0068862_100478540 3300005844 Bacteria 1178
218 Ga0081455_10025195 3300005937 Bacteria 5495
219 Ga0081455_10414886 3300005937 Bacteria 930
220 Ga0081538_10000099 3300005981 Bacteria 83947
221 Ga0081538_10000318 3300005981 Bacteria 55086
222 Ga0081538_10000473 3300005981 Bacteria 45178
223 Ga0081538_10000623 3300005981 Bacteria 39341
224 Ga0081538_10001033 3300005981 Bacteria 29696
225 Ga0081538_10001060 3300005981 Bacteria 29322
226 Ga0081538_10003949 3300005981 Bacteria 13830
227 Ga0081538_10004775 3300005981 Bacteria 12388
228 Ga0081538_10005946 3300005981 Bacteria 10859
229 Ga0081538_10019166 3300005981 Bacteria 5100
230 Ga0081538_10026358 3300005981 Bacteria 4066
231 Ga0081538_10026976 3300005981 Bacteria 3997
232 Ga0081538_10135688 3300005981 Bacteria 1146
233 Ga0081539_10006318 3300005985 Bacteria 11443
234 Ga0081539_10179135 3300005985 Bacteria 996
235 Ga0070717_10012514 3300006028 Bacteria 6472
236 Ga0070717_10035953 3300006028 Bacteria 4014
237 Ga0070717_10037977 3300006028 Bacteria 3912
238 Ga0070717_10829022 3300006028 Bacteria 842
239 Ga0075364_10519368 3300006051 Bacteria 814
240 Ga0075432_10003469 3300006058 Bacteria 5336
241 Ga0070716_100001196 3300006173 Bacteria 11430
242 Ga0070712_100013357 3300006175 Bacteria 5247
243 Ga0097621_100051997 3300006237 Bacteria 3336
244 Ga0097621_100563917 3300006237 Unclassified 1038
245 Ga0068871_100370167 3300006358 Bacteria 1271
246 Ga0075428_100022990 3300006844 Bacteria 6900
247 Ga0075428_100319517 3300006844 Bacteria 1668
248 Ga0075428_100376070 3300006844 Bacteria 1523
249 Ga0075428_100448401 3300006844 Bacteria 1382
250 Ga0075428_100690460 3300006844 Bacteria 1087
251 Ga0075428_100831705 3300006844 Bacteria 981
252 Ga0075430_100005498 3300006846 Bacteria 10706
253 Ga0075430_100005965 3300006846 Bacteria 10286
254 Ga0075430_100040239 3300006846 Bacteria 3957
255 Ga0075430_100055547 3300006846 Bacteria 3330
256 Ga0075430_100146085 3300006846 Bacteria 1970
257 Ga0075430_100183035 3300006846 Bacteria 1742
258 Ga0075430_100228309 3300006846 Bacteria 1544
259 Ga0075430_100776631 3300006846 Bacteria 789
260 Ga0075430_100831671 3300006846 Unclassified 761
261 Ga0075431_100006641 3300006847 Bacteria 11488
262 Ga0075431_100061098 3300006847 Bacteria 3888
263 Ga0075431_100085595 3300006847 Bacteria 3254
264 Ga0075431_100140800 3300006847 Bacteria 2486
265 Ga0075431_100152295 3300006847 Bacteria 2381
266 Ga0075431_100166533 3300006847 Bacteria 2266
267 Ga0075431_100316761 3300006847 Bacteria 1574
268 Ga0075431_100627596 3300006847 Bacteria 1057
269 Ga0075431_101471849 3300006847 Bacteria 640
270 Ga0075433_10014812 3300006852 Bacteria 6382
271 Ga0075433_10016407 3300006852 Bacteria 6104
272 Ga0075433_10024484 3300006852 Bacteria 5096
273 Ga0075433_10028882 3300006852 Bacteria 4718
274 Ga0075433_10049608 3300006852 Bacteria 3652
275 Ga0075433_10241441 3300006852 Bacteria 1604
276 Ga0075433_10394248 3300006852 Bacteria 1222
277 Ga0075434_100003789 3300006871 Bacteria 13517
278 Ga0075434_100028929 3300006871 Bacteria 5449
279 Ga0075434_100042447 3300006871 Bacteria 4508
280 Ga0075434_100422865 3300006871 Bacteria 1353
281 Ga0075434_100586871 3300006871 Bacteria 1133
282 Ga0075429_100011262 3300006880 Bacteria 7741
283 Ga0075429_100029286 3300006880 Bacteria 4783
284 Ga0075429_100047715 3300006880 Bacteria 3725
285 Ga0075429_100692558 3300006880 Bacteria 893
286 Ga0075429_101042475 3300006880 Bacteria 715
287 Ga0068865_100074035 3300006881 Bacteria 2424
288 Ga0068865_100074186 3300006881 Bacteria 2422
289 Ga0075436_100010365 3300006914 Bacteria 6385
290 Ga0075436_100253750 3300006914 Unclassified 1253
291 Ga0097620_100256959 3300006931 Bacteria 1838
292 Ga0075435_100086662 3300007076 Bacteria 2579
293 Ga0075435_100164988 3300007076 Bacteria 1867
294 Ga0075435_100289660 3300007076 Bacteria 1399
295 Ga0075435_100654677 3300007076 Bacteria 912
296 Ga0075435_100924352 3300007076 Unclassified 761
297 Ga0099795_10031030 3300007788 Unclassified 1838
298 Ga0105244_10112939 3300009036 Bacteria 1320
299 Ga0105240_11230602 3300009093 Bacteria 792
300 Ga0111539_10015589 3300009094 Bacteria 9449
301 Ga0111539_10016514 3300009094 Bacteria 9153
302 Ga0111539_10061276 3300009094 Bacteria 4458
303 Ga0111539_10099199 3300009094 Bacteria 3421
304 Ga0111539_10881003 3300009094 Bacteria 1041
305 Ga0111539_11165816 3300009094 Unclassified 895
306 Ga0105245_10000517 3300009098 Bacteria 35353
307 Ga0105245_10002315 3300009098 Bacteria 17235
308 Ga0105245_10008594 3300009098 Bacteria 8906
309 Ga0105245_10027258 3300009098 Bacteria 5034
310 Ga0105245_10260723 3300009098 Bacteria 1687
311 Ga0105245_10572386 3300009098 Bacteria 1153
312 Ga0105247_10059316 3300009101 Bacteria 2369
313 Ga0105247_10475716 3300009101 Unclassified 906
314 Ga0105247_10793586 3300009101 Bacteria 722
315 Ga0114129_10009856 3300009147 Bacteria 13625
316 Ga0114129_10028714 3300009147 Bacteria 7882
317 Ga0114129_10034392 3300009147 Bacteria 7158
318 Ga0114129_10070947 3300009147 Bacteria 4857
319 Ga0114129_10071219 3300009147 Bacteria 4848
320 Ga0114129_10126508 3300009147 Bacteria 3513
321 Ga0114129_10299267 3300009147 Bacteria 2145
322 Ga0114129_10337836 3300009147 Bacteria 1998
323 Ga0114129_12708544 3300009147 Bacteria 591
324 Ga0105243_10010712 3300009148 Bacteria 6947
325 Ga0105241_10087270 3300009174 Bacteria 2455
326 Ga0105241_10588904 3300009174 Bacteria 1003
327 Ga0105242_10058363 3300009176 Bacteria 3163
328 Ga0105242_10332659 3300009176 Bacteria 1397
329 Ga0105242_10750350 3300009176 Unclassified 961
330 Ga0105242_11230428 3300009176 Unclassified 769
331 Ga0105248_10112123 3300009177 Bacteria 3076
332 Ga0105248_10167255 3300009177 Bacteria 2478
333 Ga0105248_10411253 3300009177 Bacteria 1523
334 Ga0105237_11088948 3300009545 Unclassified 806
335 Ga0105249_10000178 3300009553 Bacteria 74768
336 Ga0105249_10000199 3300009553 Bacteria 68792
337 Ga0105249_10003509 3300009553 Bacteria 13564
338 Ga0105249_10013016 3300009553 Bacteria 7341
339 Ga0105249_10027036 3300009553 Bacteria 5175
340 Ga0105249_10523139 3300009553 Bacteria 1234
341 Ga0099796_10204813 3300010159 Unclassified 802
342 Ga0105239_10028036 3300010375 Bacteria 6197
343 Ga0105239_10181598 3300010375 Bacteria 2354
344 Ga0105246_10019647 3300011119 Bacteria 4322
345 Ga0105246_10107963 3300011119 Bacteria 2039
346 Ga0105246_10753625 3300011119 Bacteria 859
347 Ga0157373_10121074 3300013100 Bacteria 1839
348 Ga0157373_10142020 3300013100 Bacteria 1689
349 Ga0157373_10308900 3300013100 Bacteria 1123
350 Ga0157371_10017614 3300013102 Bacteria 5300
351 Ga0157369_10128039 3300013105 Bacteria 2691
352 Ga0157369_10257524 3300013105 Bacteria 1820
353 Ga0157374_10036246 3300013296 Bacteria 4517
354 Ga0157374_10206077 3300013296 Bacteria 1927
355 Ga0157374_10390192 3300013296 Unclassified 1388
356 Ga0157378_10067243 3300013297 Bacteria 3211
357 Ga0157378_10618737 3300013297 Bacteria 1096
358 Ga0163162_10006653 3300013306 Bacteria 11208
359 Ga0163162_10011116 3300013306 Bacteria 8769
360 Ga0163162_10072923 3300013306 Bacteria 3488
361 Ga0163162_10350011 3300013306 Bacteria 1610
362 Ga0157372_10006253 3300013307 Bacteria 12664
363 Ga0157372_10030500 3300013307 Bacteria 5899
364 Ga0157372_10119700 3300013307 Bacteria 3023
365 Ga0157372_10295055 3300013307 Bacteria 1885
366 Ga0157375_10015328 3300013308 Bacteria 6858
367 Ga0157375_10059940 3300013308 Bacteria 3772
368 Ga0157375_10301273 3300013308 Unclassified 1766
369 Ga0157375_10591421 3300013308 Bacteria 1269
370 Ga0157375_11075140 3300013308 Bacteria 941
371 Ga0163163_10091411 3300014325 Bacteria 3058
372 Ga0163163_10175620 3300014325 Bacteria 2189
373 Ga0157380_10022328 3300014326 Bacteria 4761
374 Ga0157380_10038130 3300014326 Bacteria 3729
375 Ga0157380_10502783 3300014326 Bacteria 1178
376 Ga0157380_10808228 3300014326 Unclassified 955
377 Ga0157377_10006554 3300014745 Bacteria 5561
378 Ga0157377_10060916 3300014745 Unclassified 2155
379 Ga0157377_10361371 3300014745 Bacteria 977
380 Ga0157379_10002058 3300014968 Bacteria 16705
381 Ga0157379_10008193 3300014968 Bacteria 9076
382 Ga0157379_10011155 3300014968 Bacteria 7832
383 Ga0157379_10379494 3300014968 Bacteria 1297
384 Ga0157376_10190070 3300014969 Bacteria 1882
385 Ga0182007_10031396 3300015262 Bacteria 1809
386 Ga0182007_10050444 3300015262 Unclassified 1374
387 Ga0163161_10141770 3300017792 Bacteria 1820
388 Ga0213876_10468401 3300021384 Bacteria 670
389 Ga0213875_10000092 3300021388 Bacteria 104416
390 Ga0207682_10000155 3300025893 Bacteria 31180
391 Ga0207692_10039942 3300025898 Bacteria 2312
392 Ga0207692_10304844 3300025898 Bacteria 970
393 Ga0207688_10001463 3300025901 Bacteria 12379
394 Ga0207688_10032737 3300025901 Bacteria 2874
395 Ga0207647_10408923 3300025904 Bacteria 764
396 Ga0207685_10028047 3300025905 Bacteria 1978
397 Ga0207699_10086951 3300025906 Bacteria 1953
398 Ga0207699_10654453 3300025906 Bacteria 767
399 Ga0207645_10299443 3300025907 Unclassified 1071
400 Ga0207654_10049139 3300025911 Bacteria 2417
401 Ga0207707_10033886 3300025912 Bacteria 4469
402 Ga0207707_10088907 3300025912 Unclassified 2699
403 Ga0207693_10004163 3300025915 Bacteria 12273
404 Ga0207693_10103732 3300025915 Bacteria 2230
405 Ga0207663_10178801 3300025916 Bacteria 1513
406 Ga0207660_10051661 3300025917 Bacteria 2923
407 Ga0207657_10486435 3300025919 Bacteria 967
408 Ga0207657_10984520 3300025919 Bacteria 647
409 Ga0207649_10006670 3300025920 Bacteria 6273
410 Ga0207652_10003179 3300025921 Bacteria 13657
411 Ga0207681_10235176 3300025923 Bacteria 1424
412 Ga0207687_10000085 3300025927 Bacteria 68919
413 Ga0207687_10040757 3300025927 Bacteria 3185
414 Ga0207700_10105546 3300025928 Bacteria 2256
415 Ga0207700_10191297 3300025928 Bacteria 1720
416 Ga0207700_10216653 3300025928 Bacteria 1621
417 Ga0207700_10744706 3300025928 Bacteria 876
418 Ga0207700_11166138 3300025928 Bacteria 688
419 Ga0207664_10006572 3300025929 Bacteria 8005
420 Ga0207664_10119433 3300025929 Bacteria 2204
421 Ga0207664_10977120 3300025929 Bacteria 759
422 Ga0207644_10905327 3300025931 Bacteria 739
423 Ga0207690_10006710 3300025932 Bacteria 6820
424 Ga0207709_10014822 3300025935 Bacteria 4310
425 Ga0207670_10774233 3300025936 Bacteria 798
426 Ga0207704_11396538 3300025938 Bacteria 600
427 Ga0207691_10041776 3300025940 Bacteria 4231
428 Ga0207711_10284537 3300025941 Bacteria 1523
429 Ga0207689_10018894 3300025942 Bacteria 5813
430 Ga0207689_10196142 3300025942 Bacteria 1666
431 Ga0207661_10005670 3300025944 Bacteria 8809
432 Ga0207661_10022461 3300025944 Bacteria 4753
433 Ga0207661_10045458 3300025944 Bacteria 3476
434 Ga0207661_10825994 3300025944 Unclassified 853
435 Ga0207679_10017271 3300025945 Bacteria 4810
436 Ga0207679_10166573 3300025945 Bacteria 1810
437 Ga0207651_10362453 3300025960 Bacteria 1224
438 Ga0207712_10000118 3300025961 Bacteria 85518
439 Ga0207712_10011490 3300025961 Bacteria 5642
440 Ga0207712_10172949 3300025961 Bacteria 1690
441 Ga0207712_10717794 3300025961 Bacteria 873
442 Ga0207668_10003764 3300025972 Bacteria 8932
443 Ga0207668_10031903 3300025972 Bacteria 3475
444 Ga0207668_10205640 3300025972 Bacteria 1571
445 Ga0207640_10004771 3300025981 Bacteria 7361
446 Ga0207658_10003877 3300025986 Bacteria 10532
447 Ga0207677_10027216 3300026023 Bacteria 3597
448 Ga0207677_12113950 3300026023 Bacteria 524
449 Ga0207703_10000061 3300026035 Bacteria 132671
450 Ga0207703_10321273 3300026035 Unclassified 1418
451 Ga0207639_10008945 3300026041 Bacteria 6892
452 Ga0207678_10196352 3300026067 Bacteria 1725
453 Ga0207708_10002521 3300026075 Bacteria 13466
454 Ga0207708_10022177 3300026075 Bacteria 4795
455 Ga0207708_10487982 3300026075 Unclassified 1031
456 Ga0207702_10064452 3300026078 Bacteria 3136
457 Ga0207702_10069870 3300026078 Bacteria 3019
458 Ga0207676_10000018 3300026095 Bacteria 306375
459 Ga0207676_10045515 3300026095 Bacteria 3391
460 Ga0207675_100190001 3300026118 Bacteria 1970
461 Ga0207675_100229136 3300026118 Bacteria 1792
462 Ga0207675_101330844 3300026118 Bacteria 739
463 Ga0207683_10039762 3300026121 Bacteria 4103
464 Ga0209984_1019660 3300027424 Unclassified 919
465 Ga0209995_1008004 3300027471 Bacteria 1704
466 Ga0209179_1022874 3300027512 Unclassified 1230
467 Ga0209982_1026936 3300027552 Unclassified 897
468 Ga0209998_10000320 3300027717 Bacteria 14382
469 Ga0207428_10040292 3300027907 Bacteria 3790
470 Ga0207428_10238666 3300027907 Bacteria 1359
471 Ga0268266_10000056 3300028379 Bacteria 289176
472 Ga0268266_10026262 3300028379 Bacteria 4956
473 Ga0268266_10585279 3300028379 Bacteria 1071
474 Ga0268266_11341145 3300028379 Bacteria 691
475 Ga0268265_10001477 3300028380 Bacteria 19727
476 Ga0268265_10189223 3300028380 Bacteria 1776
477 Ga0268265_10535504 3300028380 Bacteria 1109
478 Ga0307408_100444973 3300031548 Bacteria 1123
479 Ga0307405_12104759 3300031731 Bacteria 506
480 Ga0307413_10090794 3300031824 Unclassified 1988
481 Ga0307406_10332294 3300031901 Bacteria 1180
482 Ga0307406_10931181 3300031901 Bacteria 741
483 Ga0307407_10351094 3300031903 Bacteria 1044
484 Ga0307407_10441894 3300031903 Bacteria 942
485 Ga0307412_10135813 3300031911 Bacteria 1794
486 Ga0307409_100171002 3300031995 Bacteria 1912
487 Ga0307409_100203821 3300031995 Bacteria 1772
488 Ga0307409_100467354 3300031995 Bacteria 1221
489 Ga0307409_101085030 3300031995 Bacteria 821
490 Ga0307416_100181068 3300032002 Bacteria 1975
491 Ga0307416_100264505 3300032002 Bacteria 1684
492 Ga0307416_100288071 3300032002 Bacteria 1624
493 Ga0307416_100426506 3300032002 Bacteria 1372
494 Ga0307416_100426966 3300032002 Bacteria 1371
495 Ga0307416_101572998 3300032002 Unclassified 763
496 Ga0307414_10157643 3300032004 Bacteria 1799
497 Ga0307414_11171869 3300032004 Bacteria 711
498 Ga0307411_10414930 3300032005 Bacteria 1117
499 Ga0307415_100779586 3300032126 Bacteria 871
500 Ga0373923_0084751 3300035111 Bacteria 1379
501 Ga0373932_0124646 3300035112 Bacteria 862
502 Ga0373946_0174613 3300035171 Unclassified 1016
503 Ga0373942_0005002 3300035207 Bacteria 3073
504 Ga0373961_0038447 3300035241 Bacteria 1371
505 Ga0373961_0140984 3300035241 Bacteria 814
506 Ga0373962_0061522 3300035242 Bacteria 1104
507 Ga0373935_0997933 3300035692 Bacteria 622
508 Ga0373933_0215486 3300035724 Bacteria 1231
509 Ga0373937_0023832 3300036401 Bacteria 5517
510 Ga0373937_0505888 3300036401 Bacteria 1148
511 Ga0373937_0900362 3300036401 Bacteria 833
512 Ga0395900_1344206 3300037418 Bacteria 628
513 Ga0395898_0281982 3300037466 Bacteria 1585
514 Ga0395898_0311782 3300037466 Bacteria 1501
515 Ga0395898_0396264 3300037466 Bacteria 1316
516 Ga0436364_0101821 3300037853 Bacteria 691
517 Ga0436364_0527355 3300037853 Bacteria 148076
518 Ga0436364_0871836 3300037853 Bacteria 535
519 Ga0436364_1212621 3300037853 Bacteria 3725
520 Ga0395901_0047569 3300038443 Bacteria 4454
521 Ga0395901_0235963 3300038443 Bacteria 1909
522 Ga0395901_0450187 3300038443 Bacteria 1317
523 Ga0395901_1409479 3300038443 Bacteria 655
524 Ga0436365_0584781 3300039437 Bacteria 2593
525 Ga0436363_1072591 3300039450 Bacteria 1059
526 Ga0451853_0066269 3300041512 Bacteria 5213
527 Ga0439455_0141456 3300042012 Bacteria 682
528 Ga0439444_0026038 3300042437 Bacteria 1068
529 Ga0439460_0032601 3300042461 Bacteria 1493
530 Ga0439440_0084737 3300042993 Bacteria 843
531 Ga0466969_0047859 3300044656 Bacteria 2116
532 Ga0466966_0050150 3300044684 Bacteria 2656
533 Ga0466966_0215976 3300044684 Bacteria 1158
534 Ga0466966_0788448 3300044684 Bacteria 573
535 Ga0466961_0033653 3300044693 Bacteria 3292
536 Ga0466961_0632880 3300044693 Bacteria 642
537 Ga0466963_0000004 3300044694 Bacteria 102526
538 Ga0466963_0194549 3300044694 Bacteria 1417
539 Ga0466964_0032811 3300044706 Bacteria 2065
540 Ga0466957_1035931 3300044842 Bacteria 590
541 Ga0466957_1240084 3300044842 Bacteria 540
542 Ga0466960_0239216 3300044901 Bacteria 1005
543 Ga0466959_0143418 3300045049 Bacteria 1687
544 Ga0466959_0308002 3300045049 Bacteria 1084
545 Ga0466959_0784177 3300045049 Bacteria 637
546 Ga0466958_0024372 3300045836 Bacteria 3560
547 Ga0466958_0360228 3300045836 Bacteria 937
548 Ga0466958_0839676 3300045836 Bacteria 599
549 Ga0495629_0162383 3300046459 Bacteria 1552
550 Ga0495629_0225157 3300046459 Bacteria 1293
551 Ga0495641_0000005 3300046461 Bacteria 206626
552 Ga0495641_0039116 3300046461 Bacteria 2213
553 Ga0495641_0120749 3300046461 Bacteria 1169
554 Ga0495651_0011617 3300046462 Bacteria 6768
555 Ga0495653_0128610 3300046463 Bacteria 1796
556 Ga0495653_0221127 3300046463 Bacteria 1273
557 Ga0495653_0466412 3300046463 Bacteria 792
558 Ga0495662_0054000 3300046476 Bacteria 1941
559 Ga0495596_0025129 3300046500 Bacteria 2409
560 Ga0495608_0053756 3300046511 Bacteria 2664
561 Ga0495608_0093867 3300046511 Bacteria 1938
562 Ga0495620_0000972 3300046515 Bacteria 17645
563 Ga0495620_0209224 3300046515 Bacteria 749
564 Ga0495628_0323122 3300046516 Bacteria 1138
565 Ga0495628_0454158 3300046516 Bacteria 930
566 Ga0495628_0947914 3300046516 Bacteria 595
567 Ga0495630_0045063 3300046517 Bacteria 3295
568 Ga0495631_0375151 3300046518 Bacteria 605
569 Ga0495644_0078707 3300046523 Bacteria 1242
570 Ga0495663_0166487 3300046525 Bacteria 758
571 Ga0495652_0003765 3300046529 Bacteria 14828
572 Ga0495652_0263669 3300046529 Bacteria 1270
573 Ga0495587_0019289 3300046536 Bacteria 4223
574 Ga0495598_0126442 3300046537 Bacteria 872
575 Ga0495597_0341472 3300046542 Bacteria 576
576 Ga0495645_0142490 3300046543 Bacteria 1671
577 Ga0495667_0026645 3300046559 Bacteria 3896
578 Ga0495667_0182188 3300046559 Bacteria 1347
579 Ga0495656_0000876 3300046615 Bacteria 9730
580 Ga0495625_0000688 3300046660 Bacteria 48233
581 Ga0495635_0938879 3300046663 Bacteria 553
582 Ga0495588_0538625 3300046674 Unclassified 612
583 Ga0495657_0426170 3300046675 Bacteria 778
584 Ga0495599_0028373 3300046678 Bacteria 3508
585 Ga0495647_0000001 3300046681 Bacteria 222371
586 Ga0495669_0000076 3300046684 Bacteria 65203
587 Ga0495649_0003116 3300046694 Bacteria 11358
588 Ga0495600_0033198 3300046809 Bacteria 3350
589 Ga0495600_0075765 3300046809 Bacteria 2197
590 Ga0495600_0419674 3300046809 Bacteria 830
591 Ga0495660_0319139 3300046810 Bacteria 699
592 Ga0495581_0278135 3300047315 Bacteria 979
593 Ga0495604_0109898 3300047317 Bacteria 2012
594 Ga0495674_0154770 3300047319 Bacteria 1921
595 Ga0495674_0272861 3300047319 Bacteria 1387
596 Ga0495674_0550544 3300047319 Bacteria 918
597 Ga0495676_0000238 3300047321 Bacteria 44160
598 Ga0495680_0000488 3300047322 Bacteria 44631
599 Ga0495680_0014912 3300047322 Bacteria 6717
600 Ga0495680_0495093 3300047322 Bacteria 830
601 Ga0495684_0221941 3300047471 Bacteria 1385
602 Ga0495593_0117786 3300047673 Bacteria 1353
603 Ga0495593_0155920 3300047673 Bacteria 1154
604 Ga0495602_0296301 3300048088 Bacteria 1185
605 Ga0495614_0198967 3300048089 Bacteria 906
606 Ga0495615_0165603 3300048090 Bacteria 666
607 Ga0496100_0000059 3300048903 Bacteria 65518
608 Ga0496100_0071390 3300048903 Bacteria 2318
609 Ga0496101_0000135 3300048904 Bacteria 65518
610 Ga0496102_0010453 3300048905 Bacteria 7987
611 Ga0496103_0007100 3300048906 Bacteria 6688
612 Ga0496104_0000025 3300048907 Bacteria 228519
613 Ga0496104_0036817 3300048907 Bacteria 4575
614 Ga0496104_0172010 3300048907 Bacteria 2077
615 Ga0496104_1398966 3300048907 Bacteria 603
616 Ga0496105_0000023 3300048908 Bacteria 156126
617 Ga0496105_0053603 3300048908 Bacteria 3330
618 Ga0496105_0541865 3300048908 Bacteria 909
619 Ga0496105_1029146 3300048908 Bacteria 614
620 Ga0496106_0000252 3300048909 Bacteria 37666
621 Ga0496106_0028208 3300048909 Bacteria 4181
622 Ga0496107_0000054 3300048910 Bacteria 60902
623 Ga0496107_0820495 3300048910 Bacteria 680
624 Ga0496108_0000006 3300048911 Bacteria 469473
625 Ga0496108_0072626 3300048911 Bacteria 2904
626 Ga0496108_0176271 3300048911 Bacteria 1851
627 Ga0496108_0500656 3300048911 Bacteria 1061
628 Ga0496109_0000009 3300048912 Bacteria 236561
629 Ga0496109_0013153 3300048912 Bacteria 7161
630 Ga0496109_0323372 3300048912 Bacteria 1456
631 Ga0496110_0017977 3300048913 Bacteria 5922
632 Ga0496111_0011889 3300048914 Bacteria 5881
633 Ga0496111_0013645 3300048914 Bacteria 5535
634 Ga0496111_0419064 3300048914 Bacteria 989
635 Ga0496112_0006893 3300048915 Bacteria 10021
636 Ga0496112_0293721 3300048915 Bacteria 1571
637 Ga0496112_0345347 3300048915 Bacteria 1431
638 Ga0496112_0714082 3300048915 Bacteria 930
639 Ga0496113_0003664 3300048916 Bacteria 9245
640 Ga0496113_0009882 3300048916 Bacteria 6284
641 Ga0496113_0027027 3300048916 Bacteria 4109
642 Ga0496113_0161084 3300048916 Bacteria 1774
643 Ga0496113_0960070 3300048916 Bacteria 674
644 Ga0496114_0006763 3300048917 Bacteria 9033
645 Ga0496114_0208921 3300048917 Bacteria 1712
646 Ga0496114_0379134 3300048917 Bacteria 1252
647 Ga0496114_0803710 3300048917 Bacteria 819
648 Ga0496115_0302569 3300048918 Bacteria 1310
649 Ga0496115_0620962 3300048918 Bacteria 857
650 Ga0496125_0052439 3300048928 Bacteria 3354
651 Ga0501031_0145127 3300049568 Bacteria 1551
652 Ga0501036_0269376 3300049572 Bacteria 1426
653 Ga0501036_0886598 3300049572 Bacteria 733
654 Ga0501038_0581847 3300049574 Bacteria 849
655 Ga0501039_0083616 3300049575 Bacteria 2486
656 Ga0501039_1353687 3300049575 Bacteria 549
657 Ga0501040_0068674 3300049576 Bacteria 2444
658 Ga0501041_0831293 3300049577 Bacteria 593
659 Ga0501042_0063320 3300049578 Bacteria 2643
660 Ga0501042_0398993 3300049578 Bacteria 996
661 Ga0501046_0253760 3300049580 Bacteria 1294
662 Ga0501070_0125458 3300049586 Bacteria 2121
663 Ga0501074_0246545 3300049590 Bacteria 1270
664 Ga0501075_0729051 3300049591 Bacteria 755
665 Ga0501076_0202845 3300049592 Bacteria 1620
666 Ga0501076_0501048 3300049592 Bacteria 1001
667 Ga0501233_174061 3300049668 Unclassified 613
668 Ga0501235_136960 3300049669 Bacteria 624
669 Ga0501079_0325836 3300049741 Bacteria 1203
670 Ga0501079_0347697 3300049741 Bacteria 1162
671 Ga0501080_1095936 3300049742 Bacteria 688
672 Ga0501081_0092097 3300049743 Bacteria 2133
673 Ga0501081_0148679 3300049743 Bacteria 1682
674 Ga0501081_1465787 3300049743 Bacteria 518
675 Ga0501266_043688 3300049763 Bacteria 674
676 Ga0501268_006688 3300049765 Bacteria 1700
677 Ga0501035_0831304 3300049822 Bacteria 736
678 Ga0501045_0622160 3300049824 Bacteria 799
679 nmdc:mga00v17_231045_c1 3300050491 Bacteria 1198
680 nmdc:mga06z11_308852_c1 3300050494 Bacteria 941
681 nmdc:mga05p37_16486_c1 3300050507 Bacteria 8900
682 nmdc:mga05p37_27288_c1 3300050507 Bacteria 6952
683 nmdc:mga05p37_286433_c1 3300050507 Bacteria 1962
684 nmdc:mga05p37_705547_c1 3300050507 Bacteria 1120
685 nmdc:mga09592_226034_c1 3300050508 Bacteria 1621
686 nmdc:mga09592_631670_c1 3300050508 Bacteria 915
687 nmdc:mga0qj67_40911_c1 3300050509 Bacteria 3644
688 nmdc:mga0qj67_9991_c1 3300050509 Bacteria 7077
689 nmdc:mga06r32_140791_c1 3300050510 Bacteria 2388
690 nmdc:mga06r32_238861_c1 3300050510 Bacteria 1805
691 nmdc:mga06r32_308068_c1 3300050510 Bacteria 1569
692 nmdc:mga06r32_9888_c1 3300050510 Bacteria 8609
693 nmdc:mga08y16_211564_c1 3300050511 Bacteria 2008
694 nmdc:mga08y16_403990_c1 3300050511 Bacteria 1398
695 nmdc:mga08y16_59057_c1 3300050511 Bacteria 4007
696 nmdc:mga0n895_77920_c1 3300050512 Bacteria 3298
697 nmdc:mga0rr50_1126973_c1 3300050513 Bacteria 667
698 nmdc:mga0rr50_71823_c1 3300050513 Bacteria 2642
699 nmdc:mga0rr50_73255_c1 3300050513 Bacteria 2618
700 nmdc:mga08x19_234686_c1 3300050514 Bacteria 1263
701 nmdc:mga0a205_286653_c1 3300050515 Bacteria 1522
702 nmdc:mga0a205_296625_c1 3300050515 Bacteria 1490
703 nmdc:mga0a205_43_c1 3300050515 Bacteria 51209
704 Ga0495612_0000067 3300053078 Bacteria 47307
705 Ga0495612_0014801 3300053078 Bacteria 3130
706 Ga0495655_0078586 3300053083 Bacteria 938
707 Ga0495595_0128113 3300053084 Bacteria 1239
708 Ga0495595_0281587 3300053084 Bacteria 835
709 Ga0495619_0007731 3300053085 Bacteria 6803
710 Ga0495619_0148072 3300053085 Bacteria 1619
711 Ga0500614_000427 3300053123 Bacteria 10952
712 Ga0501084_0186064 3300054114 Bacteria 1753
713 Ga0501082_0371763 3300060353 Bacteria 1247
714 Ga0501082_0786262 3300060353 Bacteria 833
715 Ga0466962_0022394 3300061719 Bacteria 3036
716 Ga0530510_0037571 3300061734 Bacteria 3494
717 Ga0530510_0282536 3300061734 Bacteria 1240

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005985 Ga0081539_10006318 Ga0081539_1000631810 135
2 3300005289 Ga0065704_10186197 Ga0065704_101861972 138
3 3300005290 Ga0065712_10120808 Ga0065712_101208082 138
4 3300005290 Ga0065712_10307204 Ga0065712_103072042 138
5 3300005293 Ga0065715_10089219 Ga0065715_100892194 138
6 3300005293 Ga0065715_10164629 Ga0065715_101646292 138
7 3300005327 Ga0070658_10094939 Ga0070658_100949394 138
8 3300005327 Ga0070658_10408452 Ga0070658_104084522 138
9 3300005328 Ga0070676_10008896 Ga0070676_100088963 138
10 3300005328 Ga0070676_10427833 Ga0070676_104278331 138
11 3300005329 Ga0070683_100032094 Ga0070683_1000320943 138
12 3300005329 Ga0070683_100056215 Ga0070683_1000562154 138
13 3300005331 Ga0070670_100048916 Ga0070670_1000489162 138
14 3300005331 Ga0070670_100333071 Ga0070670_1003330712 138
15 3300005331 Ga0070670_100336399 Ga0070670_1003363993 138
16 3300005331 Ga0070670_101469079 Ga0070670_1014690791 138
17 3300005334 Ga0068869_100017547 Ga0068869_1000175474 138
18 3300005335 Ga0070666_10038088 Ga0070666_100380882 138
19 3300005335 Ga0070666_10416615 Ga0070666_104166151 138
20 3300005336 Ga0070680_100001000 Ga0070680_10000100014 138
21 3300005336 Ga0070680_100004158 Ga0070680_1000041589 138
22 3300005336 Ga0070680_100098331 Ga0070680_1000983313 138
23 3300005337 Ga0070682_100005034 Ga0070682_1000050347 138
24 3300005337 Ga0070682_100022910 Ga0070682_1000229105 138
25 3300005337 Ga0070682_100035137 Ga0070682_1000351374 138
26 3300005337 Ga0070682_100072785 Ga0070682_1000727853 138
27 3300005337 Ga0070682_100299938 Ga0070682_1002999382 138
28 3300005338 Ga0068868_100043808 Ga0068868_1000438082 138
29 3300005338 Ga0068868_100131979 Ga0068868_1001319793 138
30 3300005339 Ga0070660_100047557 Ga0070660_1000475573 138
31 3300005339 Ga0070660_100107638 Ga0070660_1001076382 138
32 3300005339 Ga0070660_100728691 Ga0070660_1007286911 138
33 3300005339 Ga0070660_101076415 Ga0070660_1010764152 138
34 3300005343 Ga0070687_100000591 Ga0070687_1000005919 138
35 3300005343 Ga0070687_100999341 Ga0070687_1009993411 138
36 3300005344 Ga0070661_100010002 Ga0070661_1000100024 138
37 3300005344 Ga0070661_100016393 Ga0070661_1000163932 138
38 3300005344 Ga0070661_100055181 Ga0070661_1000551811 138
39 3300005344 Ga0070661_100473180 Ga0070661_1004731802 138
40 3300005344 Ga0070661_100964084 Ga0070661_1009640842 138
41 3300005345 Ga0070692_10007544 Ga0070692_100075444 138
42 3300005345 Ga0070692_10060475 Ga0070692_100604754 138
43 3300005345 Ga0070692_10088121 Ga0070692_100881212 138
44 3300005347 Ga0070668_100003850 Ga0070668_1000038507 138
45 3300005347 Ga0070668_100007138 Ga0070668_1000071385 138
46 3300005353 Ga0070669_100001600 Ga0070669_10000160014 138
47 3300005353 Ga0070669_100006094 Ga0070669_1000060948 138
48 3300005353 Ga0070669_100118683 Ga0070669_1001186832 138
49 3300005353 Ga0070669_100176485 Ga0070669_1001764852 138
50 3300005354 Ga0070675_100039320 Ga0070675_1000393203 138
51 3300005354 Ga0070675_100077057 Ga0070675_1000770571 138
52 3300005354 Ga0070675_100165595 Ga0070675_1001655951 138
53 3300005355 Ga0070671_100050443 Ga0070671_1000504432 138
54 3300005355 Ga0070671_100101987 Ga0070671_1001019873 138
55 3300005356 Ga0070674_100019485 Ga0070674_1000194855 138
56 3300005364 Ga0070673_100058428 Ga0070673_1000584285 138
57 3300005364 Ga0070673_100083889 Ga0070673_1000838892 138
58 3300005364 Ga0070673_100403274 Ga0070673_1004032742 138
59 3300005365 Ga0070688_100012935 Ga0070688_1000129354 138
60 3300005366 Ga0070659_100035381 Ga0070659_1000353815 138
61 3300005366 Ga0070659_100110145 Ga0070659_1001101453 138
62 3300005366 Ga0070659_100788323 Ga0070659_1007883232 138
63 3300005367 Ga0070667_100031163 Ga0070667_1000311633 138
64 3300005367 Ga0070667_101153971 Ga0070667_1011539712 138
65 3300005367 Ga0070667_101423527 Ga0070667_1014235271 138
66 3300005406 Ga0070703_10284665 Ga0070703_102846652 138
67 3300005434 Ga0070709_10001518 Ga0070709_100015186 138
68 3300005438 Ga0070701_10014736 Ga0070701_100147363 138
69 3300005438 Ga0070701_10168672 Ga0070701_101686722 138
70 3300005439 Ga0070711_100022896 Ga0070711_1000228963 138
71 3300005440 Ga0070705_100693042 Ga0070705_1006930422 138
72 3300005440 Ga0070705_100921558 Ga0070705_1009215581 138
73 3300005444 Ga0070694_100142495 Ga0070694_1001424952 138
74 3300005455 Ga0070663_100009811 Ga0070663_1000098117 138
75 3300005455 Ga0070663_101272667 Ga0070663_1012726671 138
76 3300005457 Ga0070662_100000676 Ga0070662_1000006762 138
77 3300005457 Ga0070662_100200299 Ga0070662_1002002992 138
78 3300005458 Ga0070681_10000554 Ga0070681_1000055418 138
79 3300005458 Ga0070681_10006906 Ga0070681_1000690612 138
80 3300005458 Ga0070681_10011203 Ga0070681_100112035 138
81 3300005458 Ga0070681_10460822 Ga0070681_104608222 138
82 3300005459 Ga0068867_100097053 Ga0068867_1000970532 138
83 3300005459 Ga0068867_100491234 Ga0068867_1004912342 138
84 3300005459 Ga0068867_100519253 Ga0068867_1005192532 138
85 3300005459 Ga0068867_100913298 Ga0068867_1009132982 138
86 3300005466 Ga0070685_10097302 Ga0070685_100973023 138
87 3300005468 Ga0070707_100029570 Ga0070707_1000295707 138
88 3300005471 Ga0070698_100000181 Ga0070698_10000018142 138
89 3300005518 Ga0070699_100068841 Ga0070699_1000688413 138
90 3300005518 Ga0070699_100091673 Ga0070699_1000916734 138
91 3300005518 Ga0070699_100319450 Ga0070699_1003194501 138
92 3300005530 Ga0070679_100001151 Ga0070679_1000011519 138
93 3300005530 Ga0070679_100024888 Ga0070679_1000248887 138
94 3300005530 Ga0070679_100038355 Ga0070679_1000383556 138
95 3300005530 Ga0070679_100206251 Ga0070679_1002062513 138
96 3300005535 Ga0070684_100014938 Ga0070684_1000149384 138
97 3300005535 Ga0070684_100122424 Ga0070684_1001224242 138
98 3300005535 Ga0070684_100220425 Ga0070684_1002204253 138
99 3300005535 Ga0070684_100550508 Ga0070684_1005505081 138
100 3300005539 Ga0068853_101129578 Ga0068853_1011295782 138
101 3300005543 Ga0070672_100044304 Ga0070672_1000443042 138
102 3300005543 Ga0070672_100053208 Ga0070672_1000532082 138
103 3300005543 Ga0070672_100372343 Ga0070672_1003723431 138
104 3300005543 Ga0070672_100755194 Ga0070672_1007551942 138
105 3300005544 Ga0070686_101223968 Ga0070686_1012239681 138
106 3300005545 Ga0070695_100005050 Ga0070695_1000050503 138
107 3300005546 Ga0070696_100556086 Ga0070696_1005560862 138
108 3300005547 Ga0070693_100572296 Ga0070693_1005722962 138
109 3300005548 Ga0070665_100011876 Ga0070665_1000118765 138
110 3300005549 Ga0070704_100056539 Ga0070704_1000565394 138
111 3300005549 Ga0070704_100618818 Ga0070704_1006188181 138
112 3300005563 Ga0068855_100077943 Ga0068855_1000779433 138
113 3300005563 Ga0068855_100135428 Ga0068855_1001354285 138
114 3300005563 Ga0068855_100476014 Ga0068855_1004760143 138
115 3300005564 Ga0070664_100007495 Ga0070664_1000074953 138
116 3300005564 Ga0070664_100007931 Ga0070664_1000079317 138
117 3300005564 Ga0070664_100045589 Ga0070664_1000455895 138
118 3300005564 Ga0070664_100916220 Ga0070664_1009162201 138
119 3300005564 Ga0070664_101941682 Ga0070664_1019416821 138
120 3300005577 Ga0068857_100005823 Ga0068857_1000058235 138
121 3300005577 Ga0068857_100060125 Ga0068857_1000601252 138
122 3300005577 Ga0068857_100061539 Ga0068857_1000615392 138
123 3300005578 Ga0068854_100081160 Ga0068854_1000811604 138
124 3300005614 Ga0068856_100165712 Ga0068856_1001657123 138
125 3300005615 Ga0070702_101613597 Ga0070702_1016135971 138
126 3300005616 Ga0068852_100005517 Ga0068852_1000055177 138
127 3300005616 Ga0068852_101632956 Ga0068852_1016329561 138
128 3300005617 Ga0068859_100256946 Ga0068859_1002569462 138
129 3300005618 Ga0068864_100267203 Ga0068864_1002672032 138
130 3300005618 Ga0068864_101309178 Ga0068864_1013091781 138
131 3300005719 Ga0068861_100008729 Ga0068861_1000087296 138
132 3300005719 Ga0068861_100049676 Ga0068861_1000496761 138
133 3300005834 Ga0068851_10011400 Ga0068851_100114003 138
134 3300005834 Ga0068851_10036814 Ga0068851_100368142 138
135 3300005840 Ga0068870_10038721 Ga0068870_100387212 138
136 3300005840 Ga0068870_10148011 Ga0068870_101480112 138
137 3300005840 Ga0068870_10211698 Ga0068870_102116982 138
138 3300005841 Ga0068863_100006324 Ga0068863_1000063248 138
139 3300005841 Ga0068863_100488496 Ga0068863_1004884962 138
140 3300005841 Ga0068863_100618811 Ga0068863_1006188112 138
141 3300005842 Ga0068858_100014761 Ga0068858_1000147614 138
142 3300005842 Ga0068858_100314685 Ga0068858_1003146853 138
143 3300005843 Ga0068860_100013620 Ga0068860_1000136207 138
144 3300005843 Ga0068860_100275466 Ga0068860_1002754662 138
145 3300005844 Ga0068862_100000266 Ga0068862_10000026619 138
146 3300005844 Ga0068862_100076020 Ga0068862_1000760202 138
147 3300005844 Ga0068862_100478540 Ga0068862_1004785401 138
148 3300006173 Ga0070716_100001196 Ga0070716_10000119616 138
149 3300006237 Ga0097621_100563917 Ga0097621_1005639172 138
150 3300006358 Ga0068871_100370167 Ga0068871_1003701672 138
151 3300006844 Ga0075428_100376070 Ga0075428_1003760701 138
152 3300006844 Ga0075428_100448401 Ga0075428_1004484012 138
153 3300006846 Ga0075430_100005965 Ga0075430_1000059652 138
154 3300006846 Ga0075430_100040239 Ga0075430_1000402392 138
155 3300006846 Ga0075430_100146085 Ga0075430_1001460853 138
156 3300006846 Ga0075430_100228309 Ga0075430_1002283092 138
157 3300006846 Ga0075430_100831671 Ga0075430_1008316713 138
158 3300006847 Ga0075431_100061098 Ga0075431_1000610982 138
159 3300006847 Ga0075431_100085595 Ga0075431_1000855954 138
160 3300006847 Ga0075431_100140800 Ga0075431_1001408002 138
161 3300006847 Ga0075431_100316761 Ga0075431_1003167612 138
162 3300006847 Ga0075431_100627596 Ga0075431_1006275963 138
163 3300006852 Ga0075433_10014812 Ga0075433_100148125 138
164 3300006852 Ga0075433_10049608 Ga0075433_100496083 138
165 3300006852 Ga0075433_10394248 Ga0075433_103942482 138
166 3300006871 Ga0075434_100003789 Ga0075434_10000378911 138
167 3300006871 Ga0075434_100028929 Ga0075434_1000289292 138
168 3300006871 Ga0075434_100586871 Ga0075434_1005868712 138
169 3300006880 Ga0075429_100011262 Ga0075429_1000112628 138
170 3300006880 Ga0075429_100029286 Ga0075429_1000292862 138
171 3300006880 Ga0075429_100047715 Ga0075429_1000477153 138
172 3300006880 Ga0075429_101042475 Ga0075429_1010424752 138
173 3300006881 Ga0068865_100074035 Ga0068865_1000740352 138
174 3300006881 Ga0068865_100074186 Ga0068865_1000741863 138
175 3300006914 Ga0075436_100010365 Ga0075436_10001036512 138
176 3300006914 Ga0075436_100253750 Ga0075436_1002537501 138
177 3300006931 Ga0097620_100256959 Ga0097620_1002569592 138
178 3300007076 Ga0075435_100289660 Ga0075435_1002896603 138
179 3300007076 Ga0075435_100924352 Ga0075435_1009243522 138
180 3300007788 Ga0099795_10031030 Ga0099795_100310304 138
181 3300009036 Ga0105244_10112939 Ga0105244_101129392 138
182 3300009094 Ga0111539_10016514 Ga0111539_100165148 138
183 3300009094 Ga0111539_10881003 Ga0111539_108810031 138
184 3300009094 Ga0111539_11165816 Ga0111539_111658162 138
185 3300009098 Ga0105245_10008594 Ga0105245_100085945 138
186 3300009098 Ga0105245_10260723 Ga0105245_102607234 138
187 3300009098 Ga0105245_10572386 Ga0105245_105723861 138
188 3300009101 Ga0105247_10475716 Ga0105247_104757162 138
189 3300009147 Ga0114129_10009856 Ga0114129_1000985612 138
190 3300009147 Ga0114129_10034392 Ga0114129_100343922 138
191 3300009147 Ga0114129_10070947 Ga0114129_100709472 138
192 3300009147 Ga0114129_10126508 Ga0114129_101265083 138
193 3300009147 Ga0114129_10337836 Ga0114129_103378362 138
194 3300009147 Ga0114129_12708544 Ga0114129_127085441 138
195 3300009174 Ga0105241_10588904 Ga0105241_105889041 138
196 3300009176 Ga0105242_10058363 Ga0105242_100583635 138
197 3300009176 Ga0105242_11230428 Ga0105242_112304282 138
198 3300009177 Ga0105248_10112123 Ga0105248_101121232 138
199 3300009177 Ga0105248_10167255 Ga0105248_101672554 138
200 3300009545 Ga0105237_11088948 Ga0105237_110889482 138
201 3300009553 Ga0105249_10000199 Ga0105249_1000019947 138
202 3300009553 Ga0105249_10013016 Ga0105249_100130168 138
203 3300010159 Ga0099796_10204813 Ga0099796_102048131 138
204 3300010375 Ga0105239_10181598 Ga0105239_101815982 138
205 3300011119 Ga0105246_10107963 Ga0105246_101079632 138
206 3300011119 Ga0105246_10753625 Ga0105246_107536251 138
207 3300013100 Ga0157373_10121074 Ga0157373_101210742 138
208 3300013100 Ga0157373_10142020 Ga0157373_101420202 138
209 3300013100 Ga0157373_10308900 Ga0157373_103089002 138
210 3300013102 Ga0157371_10017614 Ga0157371_100176144 138
211 3300013105 Ga0157369_10128039 Ga0157369_101280392 138
212 3300013296 Ga0157374_10206077 Ga0157374_102060772 138
213 3300013296 Ga0157374_10390192 Ga0157374_103901923 138
214 3300013297 Ga0157378_10067243 Ga0157378_100672431 138
215 3300013297 Ga0157378_10618737 Ga0157378_106187371 138
216 3300013306 Ga0163162_10006653 Ga0163162_100066535 138
217 3300013306 Ga0163162_10072923 Ga0163162_100729232 138
218 3300013307 Ga0157372_10006253 Ga0157372_1000625310 138
219 3300013307 Ga0157372_10119700 Ga0157372_101197003 138
220 3300013307 Ga0157372_10295055 Ga0157372_102950553 138
221 3300013308 Ga0157375_10015328 Ga0157375_100153285 138
222 3300013308 Ga0157375_10301273 Ga0157375_103012732 138
223 3300013308 Ga0157375_10591421 Ga0157375_105914212 138
224 3300013308 Ga0157375_11075140 Ga0157375_110751401 138
225 3300014325 Ga0163163_10175620 Ga0163163_101756202 138
226 3300014326 Ga0157380_10022328 Ga0157380_100223283 138
227 3300014326 Ga0157380_10808228 Ga0157380_108082282 138
228 3300014745 Ga0157377_10060916 Ga0157377_100609162 138
229 3300014745 Ga0157377_10361371 Ga0157377_103613712 138
230 3300014968 Ga0157379_10008193 Ga0157379_100081937 138
231 3300014969 Ga0157376_10190070 Ga0157376_101900704 138
232 3300015262 Ga0182007_10031396 Ga0182007_100313963 138
233 3300015262 Ga0182007_10050444 Ga0182007_100504442 138
234 3300025907 Ga0207645_10299443 Ga0207645_102994432 138
235 3300025912 Ga0207707_10088907 Ga0207707_100889074 138
236 3300025917 Ga0207660_10051661 Ga0207660_100516613 138
237 3300025940 Ga0207691_10041776 Ga0207691_100417763 138
238 3300025944 Ga0207661_10825994 Ga0207661_108259942 138
239 3300025945 Ga0207679_10166573 Ga0207679_101665733 138
240 3300025960 Ga0207651_10362453 Ga0207651_103624532 138
241 3300026035 Ga0207703_10321273 Ga0207703_103212732 138
242 3300026075 Ga0207708_10487982 Ga0207708_104879821 138
243 3300027424 Ga0209984_1019660 Ga0209984_10196602 138
244 3300027471 Ga0209995_1008004 Ga0209995_10080043 138
245 3300027512 Ga0209179_1022874 Ga0209179_10228741 138
246 3300027552 Ga0209982_1026936 Ga0209982_10269362 138
247 3300027717 Ga0209998_10000320 Ga0209998_1000032010 138
248 3300028380 Ga0268265_10535504 Ga0268265_105355041 138
249 3300031731 Ga0307405_12104759 Ga0307405_121047591 138
250 3300031824 Ga0307413_10090794 Ga0307413_100907942 138
251 3300031901 Ga0307406_10931181 Ga0307406_109311811 138
252 3300031903 Ga0307407_10351094 Ga0307407_103510942 138
253 3300031911 Ga0307412_10135813 Ga0307412_101358132 138
254 3300031995 Ga0307409_100171002 Ga0307409_1001710023 138
255 3300032002 Ga0307416_100181068 Ga0307416_1001810683 138
256 3300032002 Ga0307416_101572998 Ga0307416_1015729982 138
257 3300032004 Ga0307414_10157643 Ga0307414_101576433 138
258 3300032005 Ga0307411_10414930 Ga0307411_104149302 138
259 3300035171 Ga0373946_0174613 Ga0373946_0174613_294_752 138
260 3300035207 Ga0373942_0005002 Ga0373942_0005002_1711_2169 138
261 3300035241 Ga0373961_0038447 Ga0373961_0038447_301_759 138
262 3300038443 Ga0395901_1409479 Ga0395901_1409479_16_540 138
263 3300042012 Ga0439455_0141456 Ga0439455_0141456_195_632 138
264 3300048915 Ga0496112_0714082 Ga0496112_0714082_304_762 138
265 3300049668 Ga0501233_174061 Ga0501233_174061_127_558 138
266 3300049669 Ga0501235_136960 Ga0501235_136960_139_600 138
267 3300049763 Ga0501266_043688 Ga0501266_043688_199_660 138
268 3300049765 Ga0501268_006688 Ga0501268_006688_931_1392 138
269 3300050507 nmdc:mga05p37_16486_c1 nmdc:mga05p37_16486_c1_5229_5723 138
270 3300005333 Ga0070677_10000015 Ga0070677_1000001543 146
271 3300009098 Ga0105245_10000517 Ga0105245_1000051718 146
272 3300009553 Ga0105249_10523139 Ga0105249_105231392 146
273 3300044684 Ga0466966_0788448 Ga0466966_0788448_35_475 146
274 3300044694 Ga0466963_0000004 Ga0466963_0000004_88602_89042 146
275 3300046459 Ga0495629_0225157 Ga0495629_0225157_768_1208 146
276 3300046516 Ga0495628_0323122 Ga0495628_0323122_55_495 146
277 3300046523 Ga0495644_0078707 Ga0495644_0078707_114_554 146
278 3300046529 Ga0495652_0003765 Ga0495652_0003765_4463_4903 146
279 3300046663 Ga0495635_0938879 Ga0495635_0938879_21_461 146
280 3300046674 Ga0495588_0538625 Ga0495588_0538625_25_465 146
281 3300046681 Ga0495647_0000001 Ga0495647_0000001_35858_36301 146
282 3300047673 Ga0495593_0155920 Ga0495593_0155920_304_744 146
283 3300048908 Ga0496105_1029146 Ga0496105_1029146_152_592 146
284 3300048912 Ga0496109_0323372 Ga0496109_0323372_540_980 146
285 3300048914 Ga0496111_0013645 Ga0496111_0013645_1626_2066 146
286 3300048914 Ga0496111_0419064 Ga0496111_0419064_394_834 146
287 3300048916 Ga0496113_0027027 Ga0496113_0027027_1158_1598 146
288 3300048917 Ga0496114_0006763 Ga0496114_0006763_431_871 146
289 3300049578 Ga0501042_0398993 Ga0501042_0398993_144_584 146
290 3300049824 Ga0501045_0622160 Ga0501045_0622160_61_501 146
291 3300050515 nmdc:mga0a205_43_c1 nmdc:mga0a205_43_c1_21822_22262 146
292 3300000531 CNBas_1002498 CNBas_10024982 153
293 3300003373 JGI25407J50210_10057872 JGI25407J50210_100578722 153
294 3300005327 Ga0070658_10941978 Ga0070658_109419782 153
295 3300005329 Ga0070683_100007221 Ga0070683_10000722113 153
296 3300005329 Ga0070683_100088896 Ga0070683_1000888964 153
297 3300005334 Ga0068869_100018855 Ga0068869_1000188553 153
298 3300005334 Ga0068869_100187384 Ga0068869_1001873842 153
299 3300005337 Ga0070682_100002611 Ga0070682_1000026119 153
300 3300005338 Ga0068868_100008846 Ga0068868_1000088467 153
301 3300005339 Ga0070660_100039302 Ga0070660_1000393023 153
302 3300005339 Ga0070660_100572524 Ga0070660_1005725242 153
303 3300005340 Ga0070689_100048812 Ga0070689_1000488125 153
304 3300005341 Ga0070691_10091063 Ga0070691_100910632 153
305 3300005344 Ga0070661_100037902 Ga0070661_1000379022 153
306 3300005345 Ga0070692_10174083 Ga0070692_101740831 153
307 3300005347 Ga0070668_100047269 Ga0070668_1000472692 153
308 3300005347 Ga0070668_100251306 Ga0070668_1002513063 153
309 3300005347 Ga0070668_100274659 Ga0070668_1002746592 153
310 3300005355 Ga0070671_101036606 Ga0070671_1010366061 153
311 3300005366 Ga0070659_100013862 Ga0070659_1000138623 153
312 3300005367 Ga0070667_100001076 Ga0070667_10000107618 153
313 3300005434 Ga0070709_10198710 Ga0070709_101987102 153
314 3300005435 Ga0070714_100008647 Ga0070714_1000086476 153
315 3300005435 Ga0070714_100063920 Ga0070714_1000639204 153
316 3300005435 Ga0070714_100487223 Ga0070714_1004872232 153
317 3300005436 Ga0070713_100257901 Ga0070713_1002579012 153
318 3300005436 Ga0070713_100268753 Ga0070713_1002687532 153
319 3300005436 Ga0070713_100286600 Ga0070713_1002866002 153
320 3300005436 Ga0070713_100542561 Ga0070713_1005425612 153
321 3300005437 Ga0070710_10030600 Ga0070710_100306004 153
322 3300005437 Ga0070710_10052550 Ga0070710_100525503 153
323 3300005437 Ga0070710_10159492 Ga0070710_101594923 153
324 3300005439 Ga0070711_100154693 Ga0070711_1001546933 153
325 3300005440 Ga0070705_100031635 Ga0070705_1000316352 153
326 3300005441 Ga0070700_100030817 Ga0070700_1000308173 153
327 3300005455 Ga0070663_100083146 Ga0070663_1000831464 153
328 3300005456 Ga0070678_100456361 Ga0070678_1004563612 153
329 3300005458 Ga0070681_10033452 Ga0070681_100334522 153
330 3300005466 Ga0070685_10128988 Ga0070685_101289881 153
331 3300005530 Ga0070679_100000913 Ga0070679_10000091318 153
332 3300005530 Ga0070679_101569044 Ga0070679_1015690441 153
333 3300005535 Ga0070684_100036110 Ga0070684_1000361103 153
334 3300005535 Ga0070684_100235410 Ga0070684_1002354103 153
335 3300005539 Ga0068853_100014672 Ga0068853_1000146724 153
336 3300005543 Ga0070672_100801550 Ga0070672_1008015501 153
337 3300005544 Ga0070686_100078179 Ga0070686_1000781792 153
338 3300005545 Ga0070695_100169338 Ga0070695_1001693382 153
339 3300005545 Ga0070695_100365579 Ga0070695_1003655791 153
340 3300005548 Ga0070665_100000141 Ga0070665_100000141104 153
341 3300005548 Ga0070665_100071712 Ga0070665_1000717125 153
342 3300005548 Ga0070665_100940423 Ga0070665_1009404232 153
343 3300005563 Ga0068855_100887862 Ga0068855_1008878621 153
344 3300005564 Ga0070664_100044347 Ga0070664_1000443472 153
345 3300005564 Ga0070664_100163606 Ga0070664_1001636062 153
346 3300005578 Ga0068854_100006720 Ga0068854_1000067202 153
347 3300005578 Ga0068854_101312474 Ga0068854_1013124741 153
348 3300005614 Ga0068856_100011418 Ga0068856_1000114186 153
349 3300005614 Ga0068856_100015710 Ga0068856_1000157105 153
350 3300005614 Ga0068856_100571679 Ga0068856_1005716792 153
351 3300005614 Ga0068856_102126307 Ga0068856_1021263071 153
352 3300005615 Ga0070702_100011078 Ga0070702_1000110782 153
353 3300005618 Ga0068864_100000015 Ga0068864_100000015169 153
354 3300005618 Ga0068864_100557033 Ga0068864_1005570332 153
355 3300005719 Ga0068861_100084338 Ga0068861_1000843383 153
356 3300005719 Ga0068861_100313583 Ga0068861_1003135832 153
357 3300005719 Ga0068861_100987796 Ga0068861_1009877961 153
358 3300005841 Ga0068863_100131471 Ga0068863_1001314714 153
359 3300005842 Ga0068858_100000118 Ga0068858_10000011855 153
360 3300005844 Ga0068862_100000943 Ga0068862_10000094324 153
361 3300005844 Ga0068862_100103960 Ga0068862_1001039602 153
362 3300005937 Ga0081455_10025195 Ga0081455_100251958 153
363 3300005937 Ga0081455_10414886 Ga0081455_104148862 153
364 3300005981 Ga0081538_10000099 Ga0081538_1000009932 153
365 3300005981 Ga0081538_10000318 Ga0081538_1000031820 153
366 3300005981 Ga0081538_10000473 Ga0081538_1000047351 153
367 3300005981 Ga0081538_10000623 Ga0081538_1000062310 153
368 3300005981 Ga0081538_10001033 Ga0081538_1000103334 153
369 3300005981 Ga0081538_10001060 Ga0081538_1000106010 153
370 3300005981 Ga0081538_10003949 Ga0081538_100039498 153
371 3300005981 Ga0081538_10004775 Ga0081538_1000477514 153
372 3300005981 Ga0081538_10005946 Ga0081538_100059463 153
373 3300005981 Ga0081538_10019166 Ga0081538_100191663 153
374 3300005981 Ga0081538_10026358 Ga0081538_100263584 153
375 3300005981 Ga0081538_10026976 Ga0081538_100269766 153
376 3300005981 Ga0081538_10135688 Ga0081538_101356881 153
377 3300005985 Ga0081539_10179135 Ga0081539_101791352 153
378 3300006028 Ga0070717_10012514 Ga0070717_100125145 153
379 3300006028 Ga0070717_10035953 Ga0070717_100359536 153
380 3300006028 Ga0070717_10037977 Ga0070717_100379778 153
381 3300006028 Ga0070717_10829022 Ga0070717_108290222 153
382 3300006051 Ga0075364_10519368 Ga0075364_105193682 153
383 3300006058 Ga0075432_10003469 Ga0075432_100034695 153
384 3300006175 Ga0070712_100013357 Ga0070712_1000133573 153
385 3300006237 Ga0097621_100051997 Ga0097621_1000519972 153
386 3300006844 Ga0075428_100022990 Ga0075428_1000229903 153
387 3300006844 Ga0075428_100319517 Ga0075428_1003195172 153
388 3300006844 Ga0075428_100690460 Ga0075428_1006904602 153
389 3300006844 Ga0075428_100831705 Ga0075428_1008317052 153
390 3300006846 Ga0075430_100005498 Ga0075430_1000054982 153
391 3300006846 Ga0075430_100055547 Ga0075430_1000555472 153
392 3300006846 Ga0075430_100183035 Ga0075430_1001830352 153
393 3300006846 Ga0075430_100776631 Ga0075430_1007766312 153
394 3300006847 Ga0075431_100006641 Ga0075431_10000664110 153
395 3300006847 Ga0075431_100152295 Ga0075431_1001522953 153
396 3300006847 Ga0075431_100166533 Ga0075431_1001665332 153
397 3300006847 Ga0075431_101471849 Ga0075431_1014718492 153
398 3300006852 Ga0075433_10016407 Ga0075433_100164077 153
399 3300006852 Ga0075433_10024484 Ga0075433_100244844 153
400 3300006852 Ga0075433_10028882 Ga0075433_100288826 153
401 3300006852 Ga0075433_10241441 Ga0075433_102414412 153
402 3300006871 Ga0075434_100042447 Ga0075434_1000424473 153
403 3300006871 Ga0075434_100422865 Ga0075434_1004228652 153
404 3300006880 Ga0075429_100692558 Ga0075429_1006925582 153
405 3300007076 Ga0075435_100086662 Ga0075435_1000866624 153
406 3300007076 Ga0075435_100164988 Ga0075435_1001649883 153
407 3300007076 Ga0075435_100654677 Ga0075435_1006546771 153
408 3300009093 Ga0105240_11230602 Ga0105240_112306022 153
409 3300009094 Ga0111539_10015589 Ga0111539_100155898 153
410 3300009094 Ga0111539_10061276 Ga0111539_100612763 153
411 3300009094 Ga0111539_10099199 Ga0111539_100991993 153
412 3300009098 Ga0105245_10002315 Ga0105245_1000231516 153
413 3300009098 Ga0105245_10027258 Ga0105245_100272582 153
414 3300009101 Ga0105247_10059316 Ga0105247_100593163 153
415 3300009101 Ga0105247_10793586 Ga0105247_107935862 153
416 3300009147 Ga0114129_10028714 Ga0114129_100287147 153
417 3300009147 Ga0114129_10071219 Ga0114129_100712196 153
418 3300009147 Ga0114129_10299267 Ga0114129_102992672 153
419 3300009148 Ga0105243_10010712 Ga0105243_100107123 153
420 3300009174 Ga0105241_10087270 Ga0105241_100872702 153
421 3300009176 Ga0105242_10332659 Ga0105242_103326591 153
422 3300009176 Ga0105242_10750350 Ga0105242_107503501 153
423 3300009177 Ga0105248_10411253 Ga0105248_104112531 153
424 3300009553 Ga0105249_10000178 Ga0105249_1000017838 153
425 3300009553 Ga0105249_10003509 Ga0105249_1000350917 153
426 3300009553 Ga0105249_10027036 Ga0105249_100270363 153
427 3300010375 Ga0105239_10028036 Ga0105239_100280366 153
428 3300011119 Ga0105246_10019647 Ga0105246_100196474 153
429 3300013105 Ga0157369_10257524 Ga0157369_102575243 153
430 3300013296 Ga0157374_10036246 Ga0157374_100362463 153
431 3300013306 Ga0163162_10011116 Ga0163162_100111162 153
432 3300013306 Ga0163162_10350011 Ga0163162_103500113 153
433 3300013307 Ga0157372_10030500 Ga0157372_100305003 153
434 3300013308 Ga0157375_10059940 Ga0157375_100599403 153
435 3300014325 Ga0163163_10091411 Ga0163163_100914114 153
436 3300014326 Ga0157380_10038130 Ga0157380_100381303 153
437 3300014326 Ga0157380_10502783 Ga0157380_105027832 153
438 3300014745 Ga0157377_10006554 Ga0157377_100065543 153
439 3300014968 Ga0157379_10002058 Ga0157379_100020589 153
440 3300014968 Ga0157379_10011155 Ga0157379_100111557 153
441 3300014968 Ga0157379_10379494 Ga0157379_103794941 153
442 3300017792 Ga0163161_10141770 Ga0163161_101417702 153
443 3300021384 Ga0213876_10468401 Ga0213876_104684011 153
444 3300021388 Ga0213875_10000092 Ga0213875_1000009255 153
445 3300025893 Ga0207682_10000155 Ga0207682_1000015517 153
446 3300025898 Ga0207692_10039942 Ga0207692_100399424 153
447 3300025898 Ga0207692_10304844 Ga0207692_103048442 153
448 3300025901 Ga0207688_10001463 Ga0207688_1000146312 153
449 3300025901 Ga0207688_10032737 Ga0207688_100327373 153
450 3300025904 Ga0207647_10408923 Ga0207647_104089231 153
451 3300025905 Ga0207685_10028047 Ga0207685_100280474 153
452 3300025906 Ga0207699_10086951 Ga0207699_100869514 153
453 3300025906 Ga0207699_10654453 Ga0207699_106544532 153
454 3300025911 Ga0207654_10049139 Ga0207654_100491392 153
455 3300025912 Ga0207707_10033886 Ga0207707_100338863 153
456 3300025915 Ga0207693_10004163 Ga0207693_100041638 153
457 3300025915 Ga0207693_10103732 Ga0207693_101037323 153
458 3300025916 Ga0207663_10178801 Ga0207663_101788012 153
459 3300025919 Ga0207657_10486435 Ga0207657_104864352 153
460 3300025919 Ga0207657_10984520 Ga0207657_109845202 153
461 3300025920 Ga0207649_10006670 Ga0207649_100066708 153
462 3300025921 Ga0207652_10003179 Ga0207652_1000317918 153
463 3300025923 Ga0207681_10235176 Ga0207681_102351762 153
464 3300025927 Ga0207687_10000085 Ga0207687_1000008551 153
465 3300025927 Ga0207687_10040757 Ga0207687_100407573 153
466 3300025928 Ga0207700_10105546 Ga0207700_101055462 153
467 3300025928 Ga0207700_10191297 Ga0207700_101912974 153
468 3300025928 Ga0207700_10216653 Ga0207700_102166532 153
469 3300025928 Ga0207700_10744706 Ga0207700_107447061 153
470 3300025928 Ga0207700_11166138 Ga0207700_111661381 153
471 3300025929 Ga0207664_10006572 Ga0207664_100065726 153
472 3300025929 Ga0207664_10119433 Ga0207664_101194334 153
473 3300025929 Ga0207664_10977120 Ga0207664_109771201 153
474 3300025931 Ga0207644_10905327 Ga0207644_109053272 153
475 3300025932 Ga0207690_10006710 Ga0207690_100067107 153
476 3300025935 Ga0207709_10014822 Ga0207709_100148224 153
477 3300025936 Ga0207670_10774233 Ga0207670_107742332 153
478 3300025938 Ga0207704_11396538 Ga0207704_113965382 153
479 3300025941 Ga0207711_10284537 Ga0207711_102845371 153
480 3300025942 Ga0207689_10018894 Ga0207689_100188945 153
481 3300025942 Ga0207689_10196142 Ga0207689_101961422 153
482 3300025944 Ga0207661_10005670 Ga0207661_100056705 153
483 3300025944 Ga0207661_10022461 Ga0207661_100224613 153
484 3300025944 Ga0207661_10045458 Ga0207661_100454583 153
485 3300025945 Ga0207679_10017271 Ga0207679_100172712 153
486 3300025961 Ga0207712_10000118 Ga0207712_1000011840 153
487 3300025961 Ga0207712_10011490 Ga0207712_100114905 153
488 3300025961 Ga0207712_10172949 Ga0207712_101729492 153
489 3300025961 Ga0207712_10717794 Ga0207712_107177942 153
490 3300025972 Ga0207668_10003764 Ga0207668_100037644 153
491 3300025972 Ga0207668_10031903 Ga0207668_100319036 153
492 3300025972 Ga0207668_10205640 Ga0207668_102056401 153
493 3300025981 Ga0207640_10004771 Ga0207640_100047718 153
494 3300025986 Ga0207658_10003877 Ga0207658_100038773 153
495 3300026023 Ga0207677_10027216 Ga0207677_100272162 153
496 3300026023 Ga0207677_12113950 Ga0207677_121139501 153
497 3300026035 Ga0207703_10000061 Ga0207703_1000006172 153
498 3300026041 Ga0207639_10008945 Ga0207639_100089454 153
499 3300026067 Ga0207678_10196352 Ga0207678_101963521 153
500 3300026075 Ga0207708_10002521 Ga0207708_100025215 153
501 3300026075 Ga0207708_10022177 Ga0207708_100221774 153
502 3300026078 Ga0207702_10064452 Ga0207702_100644527 153
503 3300026078 Ga0207702_10069870 Ga0207702_100698703 153
504 3300026095 Ga0207676_10000018 Ga0207676_10000018131 153
505 3300026095 Ga0207676_10045515 Ga0207676_100455156 153
506 3300026118 Ga0207675_100190001 Ga0207675_1001900013 153
507 3300026118 Ga0207675_100229136 Ga0207675_1002291362 153
508 3300026118 Ga0207675_101330844 Ga0207675_1013308441 153
509 3300026121 Ga0207683_10039762 Ga0207683_100397622 153
510 3300027907 Ga0207428_10040292 Ga0207428_100402923 153
511 3300027907 Ga0207428_10238666 Ga0207428_102386662 153
512 3300028379 Ga0268266_10000056 Ga0268266_10000056111 153
513 3300028379 Ga0268266_10026262 Ga0268266_100262622 153
514 3300028379 Ga0268266_10585279 Ga0268266_105852792 153
515 3300028379 Ga0268266_11341145 Ga0268266_113411451 153
516 3300028380 Ga0268265_10001477 Ga0268265_100014773 153
517 3300028380 Ga0268265_10189223 Ga0268265_101892233 153
518 3300031548 Ga0307408_100444973 Ga0307408_1004449732 153
519 3300031901 Ga0307406_10332294 Ga0307406_103322942 153
520 3300031903 Ga0307407_10441894 Ga0307407_104418942 153
521 3300031995 Ga0307409_100203821 Ga0307409_1002038212 153
522 3300031995 Ga0307409_100467354 Ga0307409_1004673542 153
523 3300031995 Ga0307409_101085030 Ga0307409_1010850301 153
524 3300032002 Ga0307416_100264505 Ga0307416_1002645052 153
525 3300032002 Ga0307416_100288071 Ga0307416_1002880712 153
526 3300032002 Ga0307416_100426506 Ga0307416_1004265062 153
527 3300032002 Ga0307416_100426966 Ga0307416_1004269662 153
528 3300032004 Ga0307414_11171869 Ga0307414_111718692 153
529 3300032126 Ga0307415_100779586 Ga0307415_1007795862 153
530 3300035111 Ga0373923_0084751 Ga0373923_0084751_382_843 153
531 3300035112 Ga0373932_0124646 Ga0373932_0124646_296_757 153
532 3300035241 Ga0373961_0140984 Ga0373961_0140984_184_645 153
533 3300035242 Ga0373962_0061522 Ga0373962_0061522_201_662 153
534 3300035692 Ga0373935_0997933 Ga0373935_0997933_118_591 153
535 3300035724 Ga0373933_0215486 Ga0373933_0215486_633_1094 153
536 3300036401 Ga0373937_0023832 Ga0373937_0023832_3380_3841 153
537 3300036401 Ga0373937_0505888 Ga0373937_0505888_117_578 153
538 3300036401 Ga0373937_0900362 Ga0373937_0900362_235_696 153
539 3300037418 Ga0395900_1344206 Ga0395900_1344206_132_596 153
540 3300037466 Ga0395898_0281982 Ga0395898_0281982_447_908 153
541 3300037466 Ga0395898_0311782 Ga0395898_0311782_282_755 153
542 3300037466 Ga0395898_0396264 Ga0395898_0396264_567_1028 153
543 3300037853 Ga0436364_0101821 Ga0436364_0101821_198_659 153
544 3300037853 Ga0436364_0527355 Ga0436364_0527355_100217_100678 153
545 3300037853 Ga0436364_0871836 Ga0436364_0871836_42_503 153
546 3300037853 Ga0436364_1212621 Ga0436364_1212621_1547_2008 153
547 3300038443 Ga0395901_0047569 Ga0395901_0047569_3535_3996 153
548 3300038443 Ga0395901_0235963 Ga0395901_0235963_471_932 153
549 3300038443 Ga0395901_0450187 Ga0395901_0450187_59_520 153
550 3300039437 Ga0436365_0584781 Ga0436365_0584781_281_742 153
551 3300039450 Ga0436363_1072591 Ga0436363_1072591_191_652 153
552 3300041512 Ga0451853_0066269 Ga0451853_0066269_4105_4566 153
553 3300042437 Ga0439444_0026038 Ga0439444_0026038_135_596 153
554 3300042461 Ga0439460_0032601 Ga0439460_0032601_629_1090 153
555 3300042993 Ga0439440_0084737 Ga0439440_0084737_252_713 153
556 3300044656 Ga0466969_0047859 Ga0466969_0047859_1274_1735 153
557 3300044684 Ga0466966_0050150 Ga0466966_0050150_1134_1595 153
558 3300044684 Ga0466966_0215976 Ga0466966_0215976_228_689 153
559 3300044693 Ga0466961_0033653 Ga0466961_0033653_1697_2158 153
560 3300044693 Ga0466961_0632880 Ga0466961_0632880_162_623 153
561 3300044694 Ga0466963_0194549 Ga0466963_0194549_521_982 153
562 3300044706 Ga0466964_0032811 Ga0466964_0032811_1177_1638 153
563 3300044842 Ga0466957_1035931 Ga0466957_1035931_45_506 153
564 3300044842 Ga0466957_1240084 Ga0466957_1240084_14_475 153
565 3300044901 Ga0466960_0239216 Ga0466960_0239216_99_560 153
566 3300045049 Ga0466959_0143418 Ga0466959_0143418_849_1310 153
567 3300045049 Ga0466959_0308002 Ga0466959_0308002_550_1011 153
568 3300045049 Ga0466959_0784177 Ga0466959_0784177_78_539 153
569 3300045836 Ga0466958_0024372 Ga0466958_0024372_2445_2906 153
570 3300045836 Ga0466958_0360228 Ga0466958_0360228_88_549 153
571 3300045836 Ga0466958_0839676 Ga0466958_0839676_101_562 153
572 3300046459 Ga0495629_0162383 Ga0495629_0162383_957_1418 153
573 3300046461 Ga0495641_0000005 Ga0495641_0000005_117593_118054 153
574 3300046461 Ga0495641_0039116 Ga0495641_0039116_636_1097 153
575 3300046461 Ga0495641_0120749 Ga0495641_0120749_267_728 153
576 3300046462 Ga0495651_0011617 Ga0495651_0011617_459_920 153
577 3300046463 Ga0495653_0128610 Ga0495653_0128610_765_1226 153
578 3300046463 Ga0495653_0221127 Ga0495653_0221127_239_700 153
579 3300046463 Ga0495653_0466412 Ga0495653_0466412_199_660 153
580 3300046476 Ga0495662_0054000 Ga0495662_0054000_747_1208 153
581 3300046500 Ga0495596_0025129 Ga0495596_0025129_818_1279 153
582 3300046511 Ga0495608_0053756 Ga0495608_0053756_362_823 153
583 3300046511 Ga0495608_0093867 Ga0495608_0093867_518_979 153
584 3300046515 Ga0495620_0000972 Ga0495620_0000972_2905_3366 153
585 3300046515 Ga0495620_0209224 Ga0495620_0209224_161_622 153
586 3300046516 Ga0495628_0454158 Ga0495628_0454158_296_757 153
587 3300046516 Ga0495628_0947914 Ga0495628_0947914_85_546 153
588 3300046517 Ga0495630_0045063 Ga0495630_0045063_1942_2403 153
589 3300046518 Ga0495631_0375151 Ga0495631_0375151_68_529 153
590 3300046525 Ga0495663_0166487 Ga0495663_0166487_163_624 153
591 3300046529 Ga0495652_0263669 Ga0495652_0263669_530_991 153
592 3300046536 Ga0495587_0019289 Ga0495587_0019289_662_1123 153
593 3300046537 Ga0495598_0126442 Ga0495598_0126442_380_841 153
594 3300046542 Ga0495597_0341472 Ga0495597_0341472_29_490 153
595 3300046543 Ga0495645_0142490 Ga0495645_0142490_655_1116 153
596 3300046559 Ga0495667_0026645 Ga0495667_0026645_3267_3728 153
597 3300046559 Ga0495667_0182188 Ga0495667_0182188_504_965 153
598 3300046615 Ga0495656_0000876 Ga0495656_0000876_5617_6078 153
599 3300046660 Ga0495625_0000688 Ga0495625_0000688_14864_15325 153
600 3300046675 Ga0495657_0426170 Ga0495657_0426170_25_486 153
601 3300046678 Ga0495599_0028373 Ga0495599_0028373_2467_2928 153
602 3300046684 Ga0495669_0000076 Ga0495669_0000076_36273_36764 153
603 3300046694 Ga0495649_0003116 Ga0495649_0003116_5324_5785 153
604 3300046809 Ga0495600_0033198 Ga0495600_0033198_68_529 153
605 3300046809 Ga0495600_0075765 Ga0495600_0075765_1124_1585 153
606 3300046809 Ga0495600_0419674 Ga0495600_0419674_262_723 153
607 3300046810 Ga0495660_0319139 Ga0495660_0319139_31_492 153
608 3300047315 Ga0495581_0278135 Ga0495581_0278135_310_771 153
609 3300047317 Ga0495604_0109898 Ga0495604_0109898_859_1320 153
610 3300047319 Ga0495674_0154770 Ga0495674_0154770_43_504 153
611 3300047319 Ga0495674_0272861 Ga0495674_0272861_720_1181 153
612 3300047319 Ga0495674_0550544 Ga0495674_0550544_179_640 153
613 3300047321 Ga0495676_0000238 Ga0495676_0000238_15315_15776 153
614 3300047322 Ga0495680_0000488 Ga0495680_0000488_39328_39789 153
615 3300047322 Ga0495680_0014912 Ga0495680_0014912_4892_5353 153
616 3300047322 Ga0495680_0495093 Ga0495680_0495093_21_482 153
617 3300047471 Ga0495684_0221941 Ga0495684_0221941_17_478 153
618 3300047673 Ga0495593_0117786 Ga0495593_0117786_183_644 153
619 3300048088 Ga0495602_0296301 Ga0495602_0296301_68_529 153
620 3300048089 Ga0495614_0198967 Ga0495614_0198967_224_685 153
621 3300048090 Ga0495615_0165603 Ga0495615_0165603_166_627 153
622 3300048903 Ga0496100_0000059 Ga0496100_0000059_21131_21592 153
623 3300048903 Ga0496100_0071390 Ga0496100_0071390_660_1133 153
624 3300048904 Ga0496101_0000135 Ga0496101_0000135_43927_44388 153
625 3300048905 Ga0496102_0010453 Ga0496102_0010453_4494_4967 153
626 3300048906 Ga0496103_0007100 Ga0496103_0007100_4778_5251 153
627 3300048907 Ga0496104_0000025 Ga0496104_0000025_35152_35613 153
628 3300048907 Ga0496104_0036817 Ga0496104_0036817_3852_4325 153
629 3300048907 Ga0496104_0172010 Ga0496104_0172010_371_832 153
630 3300048907 Ga0496104_1398966 Ga0496104_1398966_29_490 153
631 3300048908 Ga0496105_0000023 Ga0496105_0000023_35152_35613 153
632 3300048908 Ga0496105_0053603 Ga0496105_0053603_1146_1619 153
633 3300048908 Ga0496105_0541865 Ga0496105_0541865_366_827 153
634 3300048909 Ga0496106_0000252 Ga0496106_0000252_16469_16930 153
635 3300048909 Ga0496106_0028208 Ga0496106_0028208_266_739 153
636 3300048910 Ga0496107_0000054 Ga0496107_0000054_43927_44388 153
637 3300048910 Ga0496107_0820495 Ga0496107_0820495_129_602 153
638 3300048911 Ga0496108_0000006 Ga0496108_0000006_414864_415325 153
639 3300048911 Ga0496108_0072626 Ga0496108_0072626_621_1094 153
640 3300048911 Ga0496108_0176271 Ga0496108_0176271_1106_1567 153
641 3300048911 Ga0496108_0500656 Ga0496108_0500656_205_666 153
642 3300048912 Ga0496109_0000009 Ga0496109_0000009_181952_182413 153
643 3300048912 Ga0496109_0013153 Ga0496109_0013153_5402_5875 153
644 3300048913 Ga0496110_0017977 Ga0496110_0017977_3448_3921 153
645 3300048914 Ga0496111_0011889 Ga0496111_0011889_354_827 153
646 3300048915 Ga0496112_0006893 Ga0496112_0006893_7966_8439 153
647 3300048915 Ga0496112_0293721 Ga0496112_0293721_1090_1551 153
648 3300048915 Ga0496112_0345347 Ga0496112_0345347_561_1022 153
649 3300048916 Ga0496113_0003664 Ga0496113_0003664_3606_4067 153
650 3300048916 Ga0496113_0009882 Ga0496113_0009882_1650_2123 153
651 3300048916 Ga0496113_0161084 Ga0496113_0161084_1189_1650 153
652 3300048916 Ga0496113_0960070 Ga0496113_0960070_62_523 153
653 3300048917 Ga0496114_0208921 Ga0496114_0208921_1118_1579 153
654 3300048917 Ga0496114_0379134 Ga0496114_0379134_141_602 153
655 3300048917 Ga0496114_0803710 Ga0496114_0803710_249_722 153
656 3300048918 Ga0496115_0302569 Ga0496115_0302569_10_471 153
657 3300048918 Ga0496115_0620962 Ga0496115_0620962_50_523 153
658 3300048928 Ga0496125_0052439 Ga0496125_0052439_2829_3290 153
659 3300049568 Ga0501031_0145127 Ga0501031_0145127_912_1373 153
660 3300049572 Ga0501036_0269376 Ga0501036_0269376_937_1398 153
661 3300049572 Ga0501036_0886598 Ga0501036_0886598_111_572 153
662 3300049574 Ga0501038_0581847 Ga0501038_0581847_363_824 153
663 3300049575 Ga0501039_0083616 Ga0501039_0083616_1883_2344 153
664 3300049575 Ga0501039_1353687 Ga0501039_1353687_19_480 153
665 3300049576 Ga0501040_0068674 Ga0501040_0068674_1151_1612 153
666 3300049577 Ga0501041_0831293 Ga0501041_0831293_107_568 153
667 3300049578 Ga0501042_0063320 Ga0501042_0063320_1206_1667 153
668 3300049580 Ga0501046_0253760 Ga0501046_0253760_294_755 153
669 3300049586 Ga0501070_0125458 Ga0501070_0125458_714_1175 153
670 3300049590 Ga0501074_0246545 Ga0501074_0246545_400_861 153
671 3300049591 Ga0501075_0729051 Ga0501075_0729051_57_518 153
672 3300049592 Ga0501076_0202845 Ga0501076_0202845_168_629 153
673 3300049592 Ga0501076_0501048 Ga0501076_0501048_520_981 153
674 3300049741 Ga0501079_0325836 Ga0501079_0325836_185_646 153
675 3300049741 Ga0501079_0347697 Ga0501079_0347697_224_685 153
676 3300049742 Ga0501080_1095936 Ga0501080_1095936_44_505 153
677 3300049743 Ga0501081_0092097 Ga0501081_0092097_774_1235 153
678 3300049743 Ga0501081_0148679 Ga0501081_0148679_556_1017 153
679 3300049743 Ga0501081_1465787 Ga0501081_1465787_15_476 153
680 3300049822 Ga0501035_0831304 Ga0501035_0831304_122_583 153
681 3300050491 nmdc:mga00v17_231045_c1 nmdc:mga00v17_231045_c1_411_872 153
682 3300050494 nmdc:mga06z11_308852_c1 nmdc:mga06z11_308852_c1_104_565 153
683 3300050507 nmdc:mga05p37_27288_c1 nmdc:mga05p37_27288_c1_1414_1875 153
684 3300050507 nmdc:mga05p37_286433_c1 nmdc:mga05p37_286433_c1_849_1310 153
685 3300050507 nmdc:mga05p37_705547_c1 nmdc:mga05p37_705547_c1_125_586 153
686 3300050508 nmdc:mga09592_226034_c1 nmdc:mga09592_226034_c1_915_1376 153
687 3300050508 nmdc:mga09592_631670_c1 nmdc:mga09592_631670_c1_326_799 153
688 3300050509 nmdc:mga0qj67_40911_c1 nmdc:mga0qj67_40911_c1_1612_2073 153
689 3300050509 nmdc:mga0qj67_9991_c1 nmdc:mga0qj67_9991_c1_2255_2716 153
690 3300050510 nmdc:mga06r32_140791_c1 nmdc:mga06r32_140791_c1_1574_2035 153
691 3300050510 nmdc:mga06r32_238861_c1 nmdc:mga06r32_238861_c1_428_901 153
692 3300050510 nmdc:mga06r32_308068_c1 nmdc:mga06r32_308068_c1_479_940 153
693 3300050510 nmdc:mga06r32_9888_c1 nmdc:mga06r32_9888_c1_2688_3149 153
694 3300050511 nmdc:mga08y16_211564_c1 nmdc:mga08y16_211564_c1_825_1286 153
695 3300050511 nmdc:mga08y16_403990_c1 nmdc:mga08y16_403990_c1_224_685 153
696 3300050511 nmdc:mga08y16_59057_c1 nmdc:mga08y16_59057_c1_2835_3308 153
697 3300050512 nmdc:mga0n895_77920_c1 nmdc:mga0n895_77920_c1_701_1174 153
698 3300050513 nmdc:mga0rr50_1126973_c1 nmdc:mga0rr50_1126973_c1_15_485 153
699 3300050513 nmdc:mga0rr50_71823_c1 nmdc:mga0rr50_71823_c1_2152_2625 153
700 3300050513 nmdc:mga0rr50_73255_c1 nmdc:mga0rr50_73255_c1_649_1110 153
701 3300050514 nmdc:mga08x19_234686_c1 nmdc:mga08x19_234686_c1_18_491 153
702 3300050515 nmdc:mga0a205_286653_c1 nmdc:mga0a205_286653_c1_924_1385 153
703 3300050515 nmdc:mga0a205_296625_c1 nmdc:mga0a205_296625_c1_197_658 153
704 3300053078 Ga0495612_0000067 Ga0495612_0000067_21329_21790 153
705 3300053078 Ga0495612_0014801 Ga0495612_0014801_2106_2567 153
706 3300053083 Ga0495655_0078586 Ga0495655_0078586_345_806 153
707 3300053084 Ga0495595_0128113 Ga0495595_0128113_676_1137 153
708 3300053084 Ga0495595_0281587 Ga0495595_0281587_347_808 153
709 3300053085 Ga0495619_0007731 Ga0495619_0007731_4380_4841 153
710 3300053085 Ga0495619_0148072 Ga0495619_0148072_280_741 153
711 3300053123 Ga0500614_000427 Ga0500614_000427_2912_3373 153
712 3300054114 Ga0501084_0186064 Ga0501084_0186064_1170_1631 153
713 3300060353 Ga0501082_0371763 Ga0501082_0371763_77_538 153
714 3300060353 Ga0501082_0786262 Ga0501082_0786262_14_475 153
715 3300061719 Ga0466962_0022394 Ga0466962_0022394_244_705 153
716 3300061734 Ga0530510_0037571 Ga0530510_0037571_1883_2344 153
717 3300061734 Ga0530510_0282536 Ga0530510_0282536_756_1217 153

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01894

UPF0047

Uncharacterised protein family UPF0047

30

160

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xbf-assembly1.cif.gz_C x-ray structure northeast structural genomics consortium target car10 from c. acetobutylicum 0.9582 4 151
2p6c-assembly1.cif.gz_A crystal structure of hypothetical protein aq_2013 from aquifex aeolicus vf5. 0.9461 1 153
1xbf-assembly1.cif.gz_C x-ray structure northeast structural genomics consortium target car10 from c. acetobutylicum 0.9429 4 151
1vmj-assembly1.cif.gz_A crystal structure of a putative thiamin phosphate synthase (tm0723) from thermotoga maritima msb8 at 1.52 a resolution 0.9407 1 153
2p6c-assembly1.cif.gz_A crystal structure of hypothetical protein aq_2013 from aquifex aeolicus vf5. 0.9395 1 153
ID Description Score Start End Superfamily
2p6cB00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9459 1 153 2.60.120.460
2p6cB00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9392 1 153 2.60.120.460
1xbfB00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9243 6 151 2.60.120.460
1xbfB00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.9035 6 151 2.60.120.460
1vphC00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.8802 2 153 2.60.120.460
ID Description Score Start End GO Terms
AF-A0A7V8WEF2-F1-model_v4 YjbQ family protein 0.9584 3 153
AF-A0A1L6L9R6-F1-model_v4 deleted 0.9572 2 153
AF-A0A1G3AQ06-F1-model_v4 Secondary thiamine-phosphate synthase enzyme 0.9542 1 139
AF-A0A2V8CDQ4-F1-model_v4 Secondary thiamine-phosphate synthase enzyme 0.9526 1 140
AF-A0A2V8HHR8-F1-model_v4 Secondary thiamine-phosphate synthase enzyme 0.9515 10 138

Feature Viewer

pLDDT pTM Quality
88.81 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map