F477036

General Info

Members Datasets Scaffolds Average Seq Length
716 373 1432 124

Family's Representative Sequence

Representative Sequence 3300005539|Ga0068853_101222574|Ga0068853_1012225742
Length 145
Sequence MIPKSGIRFSGKIMPKNKGEMMQDEPTPTELIKAVADFLRNEISPEIKGHNAFKLRVGINALDLVTRQLALEDGGDTAEGARLKALLGTEGSLLDLNRALSDKIAKGEVDLQTPGLAEHLWQTTLDKLAVDQPNYAAYKRELGRK

Samples

Sample ID Description Type Environment
1 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
63 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
67 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
68 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
69 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
78 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
79 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
94 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
108 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
166 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
167 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
168 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
169 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
170 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
171 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
172 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
173 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
174 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
175 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
176 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
177 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
178 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
179 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
180 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
181 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
182 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
183 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
184 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
185 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
186 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
187 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
188 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
189 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
190 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
191 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
192 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
193 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
194 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
195 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
196 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
197 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
198 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
199 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
200 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
201 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
202 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
203 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
204 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
205 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
206 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
207 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
208 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
209 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
210 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
211 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
212 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
213 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
214 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
215 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
216 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
217 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
218 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
219 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
220 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
221 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
222 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
223 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
224 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
225 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
226 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
227 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
228 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
229 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
230 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
231 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
232 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
233 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
234 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
235 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
236 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
237 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
238 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
239 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
240 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
241 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
242 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
243 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
244 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
245 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
246 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
247 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
248 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
249 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
250 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
251 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
252 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
253 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
254 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
255 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
256 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
257 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
258 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
259 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
260 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
261 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
262 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
263 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
264 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
265 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
266 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
267 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
268 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
269 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
270 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
271 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
272 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
273 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
274 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
275 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
276 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
277 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
278 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
279 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
280 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
281 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
282 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
283 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
284 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
285 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
286 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
287 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
288 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
289 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
290 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
291 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
292 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
293 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
294 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
295 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
296 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
297 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
298 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
299 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
300 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
301 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
302 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
303 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
304 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
305 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
306 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
307 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
308 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
309 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
310 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
311 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
313 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
314 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
315 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
316 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
317 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
318 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
319 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
320 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
321 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
322 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
323 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
324 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
325 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
326 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
327 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
328 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
329 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
330 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
331 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
332 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
333 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
334 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
335 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
336 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
337 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
338 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
339 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
340 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
341 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
342 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
343 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
344 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
345 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
346 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
347 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
348 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
349 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
350 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
351 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
352 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
353 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
354 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
355 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
356 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
357 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
358 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
359 2904699407
360 2906610324
361 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
362 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
363 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
364 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
365 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
366 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
367 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
368 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
369 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
370 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
371 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
372 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
373 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.64
Metatranscriptomes 0
Isolates 3.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.64
Nodule 2.23
Rhizoplane 5.73
Rhizosphere 75.56
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068853_101222574 3300005539 Bacteria 726
2 JGI24743J22301_10091420 3300001991 Bacteria 649
3 JGI25406J46586_10006725 3300003203 Bacteria 5283
4 JGI25406J46586_10013482 3300003203 Bacteria 3509
5 JGI25153J46596_10003572 3300003215 Bacteria 8652
6 JGI25404J52841_10006565 3300003659 Bacteria 2441
7 JGI25404J52841_10015669 3300003659 Bacteria 1644
8 JGI25404J52841_10017355 3300003659 Bacteria 1560
9 JGI25404J52841_10018895 3300003659 Bacteria 1493
10 JGI25404J52841_10055268 3300003659 Bacteria 833
11 JGI25404J52841_10104462 3300003659 Bacteria 594
12 Ga0065707_10714355 3300005295 Bacteria 633
13 Ga0070676_10385437 3300005328 Bacteria 972
14 Ga0070683_100092275 3300005329 Bacteria 2844
15 Ga0068869_100181628 3300005334 Bacteria 1649
16 Ga0068869_100509714 3300005334 Bacteria 1006
17 Ga0068869_100545289 3300005334 Bacteria 973
18 Ga0068869_101222961 3300005334 Bacteria 661
19 Ga0068869_101439618 3300005334 Bacteria 611
20 Ga0070680_100856309 3300005336 Bacteria 784
21 Ga0070680_101279924 3300005336 Bacteria 635
22 Ga0070680_101888066 3300005336 Bacteria 518
23 Ga0070682_100140858 3300005337 Bacteria 1644
24 Ga0068868_100254287 3300005338 Bacteria 1479
25 Ga0070660_100684192 3300005339 Bacteria 860
26 Ga0070661_100057205 3300005344 Bacteria 2858
27 Ga0070661_100127903 3300005344 Bacteria 1906
28 Ga0070668_100058827 3300005347 Bacteria 2974
29 Ga0070668_100842966 3300005347 Bacteria 816
30 Ga0070669_100046134 3300005353 Bacteria 3177
31 Ga0070669_100703172 3300005353 Bacteria 854
32 Ga0070675_101183277 3300005354 Bacteria 704
33 Ga0070671_101232576 3300005355 Bacteria 659
34 Ga0070674_100809000 3300005356 Bacteria 810
35 Ga0070673_101073409 3300005364 Bacteria 752
36 Ga0070688_100285454 3300005365 Bacteria 1188
37 Ga0070688_101015025 3300005365 Bacteria 660
38 Ga0070667_100998950 3300005367 Bacteria 781
39 Ga0070709_10070318 3300005434 Bacteria 2255
40 Ga0070714_100071834 3300005435 Bacteria 2994
41 Ga0070714_100156939 3300005435 Bacteria 2055
42 Ga0070713_100001443 3300005436 Bacteria 15239
43 Ga0070713_100007690 3300005436 Bacteria 7584
44 Ga0070713_100202384 3300005436 Bacteria 1794
45 Ga0070713_102173189 3300005436 Bacteria 538
46 Ga0070710_10115476 3300005437 Bacteria 1618
47 Ga0070710_11532206 3300005437 Bacteria 502
48 Ga0070711_100012345 3300005439 Bacteria 5332
49 Ga0070708_100526876 3300005445 Bacteria 1115
50 Ga0070663_100045576 3300005455 Bacteria 3098
51 Ga0070663_100067261 3300005455 Bacteria 2598
52 Ga0070663_100097496 3300005455 Bacteria 2189
53 Ga0070663_100224797 3300005455 Bacteria 1475
54 Ga0070663_100942935 3300005455 Bacteria 748
55 Ga0070678_100080228 3300005456 Bacteria 2470
56 Ga0070678_100144901 3300005456 Bacteria 1905
57 Ga0070678_100243239 3300005456 Bacteria 1505
58 Ga0070662_100501335 3300005457 Bacteria 1013
59 Ga0070662_101417574 3300005457 Bacteria 599
60 Ga0070681_10013908 3300005458 Bacteria 8008
61 Ga0070685_10461600 3300005466 Bacteria 892
62 Ga0070706_101143666 3300005467 Bacteria 716
63 Ga0070707_100095241 3300005468 Bacteria 2883
64 Ga0070698_100289302 3300005471 Bacteria 1570
65 Ga0070699_101453547 3300005518 Bacteria 629
66 Ga0070699_101601533 3300005518 Bacteria 597
67 Ga0070679_100097785 3300005530 Bacteria 2923
68 Ga0070679_100193859 3300005530 Bacteria 2000
69 Ga0070679_101671083 3300005530 Bacteria 585
70 Ga0070684_100115656 3300005535 Bacteria 2409
71 Ga0070684_100160950 3300005535 Bacteria 2036
72 Ga0070684_100935390 3300005535 Bacteria 813
73 Ga0070684_101873041 3300005535 Bacteria 566
74 Ga0068853_100162127 3300005539 Bacteria 2019
75 Ga0068853_100323700 3300005539 Bacteria 1430
76 Ga0070695_100133292 3300005545 Bacteria 1714
77 Ga0070693_100695498 3300005547 Bacteria 744
78 Ga0070693_101355377 3300005547 Bacteria 552
79 Ga0070665_100038548 3300005548 Bacteria 4804
80 Ga0070665_100111668 3300005548 Bacteria 2736
81 Ga0070665_100230192 3300005548 Bacteria 1853
82 Ga0070665_100660593 3300005548 Bacteria 1058
83 Ga0070665_101006768 3300005548 Bacteria 845
84 Ga0070704_101356413 3300005549 Bacteria 652
85 Ga0070704_102069521 3300005549 Bacteria 529
86 Ga0068855_100031944 3300005563 Bacteria 6285
87 Ga0068855_101611820 3300005563 Bacteria 664
88 Ga0070664_100364972 3300005564 Bacteria 1316
89 Ga0070664_100799568 3300005564 Bacteria 882
90 Ga0068856_100266259 3300005614 Bacteria 1730
91 Ga0070702_100150085 3300005615 Bacteria 1495
92 Ga0070702_101001121 3300005615 Bacteria 661
93 Ga0068852_100407546 3300005616 Bacteria 1338
94 Ga0068852_100600520 3300005616 Bacteria 1105
95 Ga0068852_100642796 3300005616 Bacteria 1068
96 Ga0068852_100896572 3300005616 Bacteria 904
97 Ga0068852_101784735 3300005616 Bacteria 638
98 Ga0068859_100057641 3300005617 Bacteria 3912
99 Ga0068859_102991185 3300005617 Bacteria 517
100 Ga0068864_100163649 3300005618 Bacteria 2024
101 Ga0068864_100833624 3300005618 Bacteria 908
102 Ga0068864_100888454 3300005618 Bacteria 879
103 Ga0068866_10575534 3300005718 Bacteria 757
104 Ga0068861_100113676 3300005719 Bacteria 2172
105 Ga0068861_100354198 3300005719 Bacteria 1289
106 Ga0068861_100454311 3300005719 Bacteria 1149
107 Ga0068861_102039294 3300005719 Bacteria 573
108 Ga0068863_100936400 3300005841 Bacteria 867
109 Ga0068863_101753614 3300005841 Bacteria 631
110 Ga0068858_100128143 3300005842 Bacteria 2378
111 Ga0068860_102346549 3300005843 Bacteria 554
112 Ga0068862_100036909 3300005844 Bacteria 4141
113 Ga0068862_100613828 3300005844 Bacteria 1046
114 Ga0068862_101830373 3300005844 Bacteria 616
115 Ga0081455_10202804 3300005937 Bacteria 1484
116 Ga0081455_10415145 3300005937 Bacteria 930
117 Ga0081455_10445298 3300005937 Bacteria 886
118 Ga0081455_10564387 3300005937 Bacteria 750
119 Ga0081540_1003361 3300005983 Bacteria 12678
120 Ga0081540_1005422 3300005983 Bacteria 9519
121 Ga0081540_1013327 3300005983 Bacteria 5351
122 Ga0081540_1015125 3300005983 Bacteria 4897
123 Ga0081540_1019809 3300005983 Bacteria 4073
124 Ga0081540_1031210 3300005983 Bacteria 2934
125 Ga0081540_1035542 3300005983 Bacteria 2670
126 Ga0081540_1035686 3300005983 Bacteria 2663
127 Ga0081540_1064447 3300005983 Bacteria 1729
128 Ga0081540_1068833 3300005983 Bacteria 1647
129 Ga0081540_1069505 3300005983 Bacteria 1636
130 Ga0081540_1098851 3300005983 Bacteria 1262
131 Ga0081540_1179771 3300005983 Bacteria 793
132 Ga0081540_1235849 3300005983 Bacteria 643
133 Ga0081540_1311748 3300005983 Bacteria 540
134 Ga0081539_10001470 3300005985 Bacteria 39952
135 Ga0081539_10186639 3300005985 Bacteria 968
136 Ga0070717_10002220 3300006028 Bacteria 13629
137 Ga0070717_10467766 3300006028 Bacteria 1138
138 Ga0070717_10547546 3300006028 Bacteria 1048
139 Ga0075365_10044957 3300006038 Bacteria 2895
140 Ga0075365_10208076 3300006038 Bacteria 1371
141 Ga0075365_10258021 3300006038 Bacteria 1225
142 Ga0075365_10281481 3300006038 Bacteria 1170
143 Ga0075365_10633801 3300006038 Bacteria 756
144 Ga0075368_10007218 3300006042 Bacteria 3916
145 Ga0075368_10185089 3300006042 Bacteria 878
146 Ga0075368_10288124 3300006042 Bacteria 707
147 Ga0075363_100000503 3300006048 Bacteria 12478
148 Ga0075363_100138530 3300006048 Bacteria 1369
149 Ga0075363_100299171 3300006048 Bacteria 933
150 Ga0075363_100543183 3300006048 Bacteria 693
151 Ga0070716_101642313 3300006173 Bacteria 529
152 Ga0070712_100023933 3300006175 Bacteria 4040
153 Ga0070712_100779186 3300006175 Bacteria 820
154 Ga0070712_100937222 3300006175 Bacteria 748
155 Ga0075362_10229118 3300006177 Bacteria 910
156 Ga0075367_10106837 3300006178 Bacteria 1715
157 Ga0075367_10246069 3300006178 Bacteria 1121
158 Ga0075367_10350710 3300006178 Bacteria 931
159 Ga0075369_10037242 3300006186 Bacteria 2071
160 Ga0075369_10095711 3300006186 Bacteria 1328
161 Ga0075369_10125598 3300006186 Bacteria 1163
162 Ga0075366_10601643 3300006195 Bacteria 682
163 Ga0097621_100025839 3300006237 Bacteria 4599
164 Ga0097621_100864619 3300006237 Bacteria 841
165 Ga0097621_101046259 3300006237 Bacteria 765
166 Ga0097621_101679616 3300006237 Bacteria 604
167 Ga0075370_10084725 3300006353 Bacteria 1824
168 Ga0068871_100310646 3300006358 Bacteria 1386
169 Ga0068871_100366128 3300006358 Bacteria 1278
170 Ga0075430_100726349 3300006846 Bacteria 819
171 Ga0068865_100095637 3300006881 Bacteria 2165
172 Ga0068865_100219791 3300006881 Bacteria 1485
173 Ga0097620_100057642 3300006931 Bacteria 3912
174 Ga0097620_102991297 3300006931 Bacteria 517
175 Ga0075435_100869066 3300007076 Bacteria 786
176 Ga0099794_10659905 3300007265 Bacteria 556
177 Ga0099795_10061353 3300007788 Bacteria 1396
178 Ga0099795_10074681 3300007788 Bacteria 1285
179 Ga0099795_10091014 3300007788 Bacteria 1182
180 Ga0099795_10600522 3300007788 Bacteria 524
181 Ga0105250_10534645 3300009092 Bacteria 536
182 Ga0105240_10034676 3300009093 Bacteria 6507
183 Ga0105240_10403439 3300009093 Bacteria 1539
184 Ga0105240_11484208 3300009093 Bacteria 711
185 Ga0105240_11614221 3300009093 Bacteria 678
186 Ga0105240_11865796 3300009093 Bacteria 626
187 Ga0105240_12461249 3300009093 Bacteria 538
188 Ga0105245_10069475 3300009098 Bacteria 3194
189 Ga0105245_10193858 3300009098 Bacteria 1948
190 Ga0105245_10624726 3300009098 Bacteria 1106
191 Ga0105245_10696004 3300009098 Bacteria 1049
192 Ga0105247_10231734 3300009101 Bacteria 1254
193 Ga0114129_11429045 3300009147 Bacteria 853
194 Ga0105243_11387693 3300009148 Bacteria 723
195 Ga0105243_12672416 3300009148 Bacteria 539
196 Ga0105241_10103601 3300009174 Bacteria 2266
197 Ga0105241_11279554 3300009174 Bacteria 698
198 Ga0105242_10422044 3300009176 Bacteria 1250
199 Ga0105242_11093633 3300009176 Bacteria 811
200 Ga0105248_10498284 3300009177 Bacteria 1373
201 Ga0105248_10627738 3300009177 Bacteria 1212
202 Ga0105248_10790251 3300009177 Bacteria 1071
203 Ga0105237_10092782 3300009545 Bacteria 3009
204 Ga0105237_10340636 3300009545 Bacteria 1504
205 Ga0105237_10608209 3300009545 Bacteria 1100
206 Ga0105237_11184646 3300009545 Bacteria 770
207 Ga0105238_10138400 3300009551 Bacteria 2412
208 Ga0105238_10173286 3300009551 Bacteria 2134
209 Ga0105238_10363358 3300009551 Bacteria 1437
210 Ga0105238_10641816 3300009551 Bacteria 1071
211 Ga0105238_12870742 3300009551 Bacteria 518
212 Ga0105249_10261820 3300009553 Bacteria 1719
213 Ga0105249_10601048 3300009553 Bacteria 1155
214 Ga0105249_11296408 3300009553 Bacteria 800
215 Ga0105249_12009922 3300009553 Bacteria 651
216 Ga0105239_10083629 3300010375 Bacteria 3515
217 Ga0105239_10765678 3300010375 Bacteria 1105
218 Ga0105239_11252869 3300010375 Bacteria 855
219 Ga0105239_11547378 3300010375 Bacteria 767
220 Ga0105246_10021360 3300011119 Bacteria 4166
221 Ga0105246_11014808 3300011119 Bacteria 752
222 Ga0105246_11260201 3300011119 Bacteria 683
223 Ga0105246_11615898 3300011119 Bacteria 613
224 Ga0157344_1007107 3300012476 Bacteria 739
225 Ga0157341_1008633 3300012494 Bacteria 835
226 Ga0157370_10156607 3300013104 Bacteria 2119
227 Ga0157370_10877767 3300013104 Bacteria 814
228 Ga0157370_11800752 3300013104 Bacteria 549
229 Ga0157374_10643482 3300013296 Bacteria 1072
230 Ga0157374_11036724 3300013296 Bacteria 840
231 Ga0157374_11885528 3300013296 Bacteria 623
232 Ga0157378_10525645 3300013297 Bacteria 1185
233 Ga0163162_10246533 3300013306 Bacteria 1918
234 Ga0163162_10419785 3300013306 Bacteria 1470
235 Ga0163162_11807171 3300013306 Bacteria 699
236 Ga0163162_12246891 3300013306 Bacteria 626
237 Ga0157372_10117900 3300013307 Bacteria 3045
238 Ga0157372_10682936 3300013307 Bacteria 1195
239 Ga0157372_10694732 3300013307 Bacteria 1184
240 Ga0157375_10233150 3300013308 Bacteria 2000
241 Ga0157375_10560132 3300013308 Bacteria 1304
242 Ga0157375_10960916 3300013308 Bacteria 996
243 Ga0157375_11270549 3300013308 Bacteria 865
244 Ga0163163_10101104 3300014325 Bacteria 2905
245 Ga0163163_10127526 3300014325 Bacteria 2583
246 Ga0157380_10392517 3300014326 Bacteria 1314
247 Ga0157380_10526188 3300014326 Bacteria 1154
248 Ga0157377_10294170 3300014745 Bacteria 1069
249 Ga0157377_10321062 3300014745 Bacteria 1029
250 Ga0157379_10365422 3300014968 Bacteria 1323
251 Ga0157379_10437304 3300014968 Bacteria 1206
252 Ga0157379_10810442 3300014968 Bacteria 884
253 Ga0157379_11845729 3300014968 Bacteria 595
254 Ga0157376_10824326 3300014969 Bacteria 942
255 Ga0157376_10974097 3300014969 Bacteria 869
256 Ga0163161_10377317 3300017792 Bacteria 1132
257 Ga0163161_11485070 3300017792 Bacteria 594
258 Ga0209233_1014853 3300025261 Bacteria 2183
259 Ga0207656_10009794 3300025321 Bacteria 3565
260 Ga0207642_10118481 3300025899 Bacteria 1361
261 Ga0207642_10355348 3300025899 Bacteria 866
262 Ga0207710_10061750 3300025900 Bacteria 1701
263 Ga0207710_10109533 3300025900 Bacteria 1310
264 Ga0207710_10512910 3300025900 Bacteria 623
265 Ga0207688_10335387 3300025901 Bacteria 929
266 Ga0207688_10637441 3300025901 Bacteria 672
267 Ga0207688_11091722 3300025901 Bacteria 503
268 Ga0207645_10200605 3300025907 Bacteria 1312
269 Ga0207645_10675581 3300025907 Bacteria 702
270 Ga0207643_10193845 3300025908 Bacteria 1234
271 Ga0207684_10421639 3300025910 Bacteria 1147
272 Ga0207684_10671876 3300025910 Bacteria 882
273 Ga0207654_10239999 3300025911 Bacteria 1211
274 Ga0207654_10312008 3300025911 Bacteria 1072
275 Ga0207707_10040154 3300025912 Bacteria 4088
276 Ga0207707_10176189 3300025912 Bacteria 1868
277 Ga0207695_10290030 3300025913 Bacteria 1529
278 Ga0207695_10296419 3300025913 Bacteria 1509
279 Ga0207695_10862922 3300025913 Bacteria 785
280 Ga0207671_10087252 3300025914 Bacteria 2346
281 Ga0207671_10158502 3300025914 Bacteria 1752
282 Ga0207671_10866370 3300025914 Bacteria 715
283 Ga0207693_10036084 3300025915 Bacteria 3896
284 Ga0207693_10404349 3300025915 Bacteria 1067
285 Ga0207663_10030184 3300025916 Bacteria 3194
286 Ga0207663_10124488 3300025916 Bacteria 1771
287 Ga0207663_11308738 3300025916 Bacteria 584
288 Ga0207660_10332230 3300025917 Bacteria 1215
289 Ga0207660_10770700 3300025917 Bacteria 785
290 Ga0207657_10293110 3300025919 Bacteria 1290
291 Ga0207649_10026045 3300025920 Bacteria 3417
292 Ga0207649_10131180 3300025920 Bacteria 1702
293 Ga0207649_11659151 3300025920 Bacteria 506
294 Ga0207652_10100751 3300025921 Bacteria 2550
295 Ga0207646_10091694 3300025922 Bacteria 2719
296 Ga0207681_10029279 3300025923 Bacteria 3575
297 Ga0207681_10231223 3300025923 Bacteria 1435
298 Ga0207694_10137758 3300025924 Bacteria 1961
299 Ga0207694_10207643 3300025924 Bacteria 1595
300 Ga0207659_10851284 3300025926 Bacteria 784
301 Ga0207687_10041702 3300025927 Bacteria 3153
302 Ga0207687_11217518 3300025927 Bacteria 647
303 Ga0207700_10002327 3300025928 Bacteria 10893
304 Ga0207700_10015419 3300025928 Bacteria 5042
305 Ga0207700_10154298 3300025928 Bacteria 1901
306 Ga0207664_10020316 3300025929 Bacteria 4920
307 Ga0207664_10045136 3300025929 Bacteria 3455
308 Ga0207644_10448209 3300025931 Bacteria 1060
309 Ga0207706_10384574 3300025933 Bacteria 1217
310 Ga0207706_10432234 3300025933 Bacteria 1140
311 Ga0207706_10805613 3300025933 Bacteria 798
312 Ga0207686_10389264 3300025934 Bacteria 1059
313 Ga0207709_10638913 3300025935 Bacteria 846
314 Ga0207670_10425284 3300025936 Bacteria 1066
315 Ga0207669_10199082 3300025937 Bacteria 1452
316 Ga0207669_10327407 3300025937 Bacteria 1175
317 Ga0207669_11071826 3300025937 Bacteria 679
318 Ga0207704_10373858 3300025938 Bacteria 1117
319 Ga0207704_10398691 3300025938 Bacteria 1085
320 Ga0207704_11039661 3300025938 Bacteria 694
321 Ga0207665_10009005 3300025939 Bacteria 6551
322 Ga0207665_10159629 3300025939 Bacteria 1621
323 Ga0207665_10473309 3300025939 Bacteria 964
324 Ga0207691_10684395 3300025940 Bacteria 865
325 Ga0207711_10270876 3300025941 Bacteria 1562
326 Ga0207689_10098727 3300025942 Bacteria 2399
327 Ga0207689_10099357 3300025942 Bacteria 2391
328 Ga0207689_10476282 3300025942 Bacteria 1045
329 Ga0207689_10496196 3300025942 Bacteria 1023
330 Ga0207689_11459044 3300025942 Bacteria 572
331 Ga0207661_10004542 3300025944 Bacteria 9725
332 Ga0207661_11569216 3300025944 Bacteria 603
333 Ga0207667_10057259 3300025949 Bacteria 4092
334 Ga0207667_10491911 3300025949 Bacteria 1245
335 Ga0207651_10822538 3300025960 Bacteria 824
336 Ga0207651_10935002 3300025960 Bacteria 773
337 Ga0207712_10237821 3300025961 Bacteria 1466
338 Ga0207712_10751963 3300025961 Bacteria 854
339 Ga0207668_10202328 3300025972 Bacteria 1582
340 Ga0207668_10605831 3300025972 Bacteria 954
341 Ga0207640_10525247 3300025981 Bacteria 990
342 Ga0207640_11260204 3300025981 Bacteria 659
343 Ga0207658_10609712 3300025986 Bacteria 981
344 Ga0207658_10939694 3300025986 Bacteria 788
345 Ga0207658_11015093 3300025986 Bacteria 757
346 Ga0207677_10092314 3300026023 Bacteria 2204
347 Ga0207677_10302918 3300026023 Bacteria 1321
348 Ga0207703_10145131 3300026035 Bacteria 2063
349 Ga0207639_10177706 3300026041 Bacteria 1808
350 Ga0207639_10272047 3300026041 Bacteria 1486
351 Ga0207639_10567254 3300026041 Bacteria 1044
352 Ga0207639_11526955 3300026041 Bacteria 627
353 Ga0207678_10015836 3300026067 Bacteria 6627
354 Ga0207678_10039984 3300026067 Bacteria 4068
355 Ga0207678_10080741 3300026067 Bacteria 2784
356 Ga0207678_10198595 3300026067 Bacteria 1714
357 Ga0207678_10332148 3300026067 Bacteria 1309
358 Ga0207678_10360133 3300026067 Bacteria 1255
359 Ga0207702_10997745 3300026078 Bacteria 831
360 Ga0207641_10437606 3300026088 Bacteria 1262
361 Ga0207641_10930727 3300026088 Bacteria 864
362 Ga0207641_10939334 3300026088 Bacteria 860
363 Ga0207676_12004924 3300026095 Bacteria 577
364 Ga0207676_12134420 3300026095 Bacteria 558
365 Ga0207676_12431738 3300026095 Bacteria 521
366 Ga0207675_100214219 3300026118 Bacteria 1854
367 Ga0207675_100261939 3300026118 Bacteria 1676
368 Ga0207675_100271460 3300026118 Bacteria 1646
369 Ga0207675_102638724 3300026118 Bacteria 512
370 Ga0207683_10091726 3300026121 Bacteria 2706
371 Ga0207683_10092082 3300026121 Bacteria 2701
372 Ga0207683_10093548 3300026121 Bacteria 2679
373 Ga0207698_10533223 3300026142 Bacteria 1148
374 Ga0209588_1004503 3300027671 Bacteria 3936
375 Ga0209813_10031470 3300027866 Bacteria 1566
376 Ga0209813_10077854 3300027866 Bacteria 1090
377 Ga0268266_10009754 3300028379 Bacteria 8446
378 Ga0268266_10088172 3300028379 Bacteria 2715
379 Ga0268266_10104382 3300028379 Bacteria 2502
380 Ga0268266_10235416 3300028379 Bacteria 1688
381 Ga0268266_10311275 3300028379 Bacteria 1471
382 Ga0268266_10748731 3300028379 Bacteria 943
383 Ga0268266_10824073 3300028379 Bacteria 896
384 Ga0268266_10833685 3300028379 Bacteria 891
385 Ga0268266_10995560 3300028379 Bacteria 811
386 Ga0268266_11932821 3300028379 Bacteria 564
387 Ga0268265_10033146 3300028380 Bacteria 3752
388 Ga0268265_10042573 3300028380 Bacteria 3370
389 Ga0268265_10477944 3300028380 Bacteria 1169
390 Ga0268264_10171186 3300028381 Bacteria 1964
391 Ga0268264_10921968 3300028381 Bacteria 878
392 Ga0307517_10000634 3300028786 Bacteria 60194
393 Ga0307515_10791720 3300028794 Bacteria 570
394 Ga0307511_10156638 3300030521 Bacteria 1291
395 Ga0265330_10050418 3300031235 Bacteria 1826
396 Ga0265332_10017916 3300031238 Bacteria 3122
397 Ga0265332_10020441 3300031238 Bacteria 2923
398 Ga0265325_10005682 3300031241 Bacteria 7666
399 Ga0265339_10005528 3300031249 Bacteria 8406
400 Ga0265339_10061435 3300031249 Bacteria 2022
401 Ga0265331_10313539 3300031250 Bacteria 702
402 Ga0307513_10246590 3300031456 Bacteria 1586
403 Ga0307509_10231715 3300031507 Bacteria 1649
404 Ga0307408_100570992 3300031548 Bacteria 1001
405 Ga0307408_100734661 3300031548 Bacteria 890
406 Ga0307408_101933753 3300031548 Bacteria 566
407 Ga0307508_10382595 3300031616 Bacteria 998
408 Ga0307508_10540237 3300031616 Bacteria 763
409 Ga0265314_10083139 3300031711 Bacteria 2105
410 Ga0307516_10014729 3300031730 Bacteria 8261
411 Ga0307516_10060750 3300031730 Bacteria 3670
412 Ga0307516_10306644 3300031730 Bacteria 1262
413 Ga0307516_10487832 3300031730 Bacteria 887
414 Ga0307516_10494320 3300031730 Bacteria 878
415 Ga0307405_10438984 3300031731 Bacteria 1032
416 Ga0307412_10132431 3300031911 Bacteria 1813
417 Ga0307412_10481059 3300031911 Bacteria 1030
418 Ga0307412_11461911 3300031911 Bacteria 620
419 Ga0307409_101521484 3300031995 Bacteria 697
420 Ga0307416_100836381 3300032002 Bacteria 1018
421 Ga0307416_102671446 3300032002 Bacteria 596
422 Ga0307411_10899923 3300032005 Bacteria 786
423 Ga0307415_100898249 3300032126 Bacteria 816
424 Ga0307507_10603106 3300033179 Bacteria 567
425 Ga0307510_10023227 3300033180 Bacteria 7192
426 Ga0315911_1000002 3300033442 Bacteria 926833
427 Ga0373929_0057974 3300035085 Bacteria 900
428 Ga0373934_0021398 3300035086 Bacteria 2490
429 Ga0373923_0006710 3300035111 Bacteria 4000
430 Ga0373936_0081781 3300035113 Bacteria 1345
431 Ga0373936_0135147 3300035113 Bacteria 1062
432 Ga0373939_0047402 3300035114 Bacteria 1320
433 Ga0373941_0085118 3300035115 Bacteria 1075
434 Ga0373945_0079304 3300035116 Bacteria 1255
435 Ga0373945_0158069 3300035116 Bacteria 922
436 Ga0373954_0015636 3300035118 Bacteria 3393
437 Ga0373954_0480090 3300035118 Bacteria 616
438 Ga0373956_0281865 3300035119 Bacteria 791
439 Ga0373957_0025628 3300035120 Bacteria 2127
440 Ga0373943_0032461 3300035170 Bacteria 2483
441 Ga0373943_0070364 3300035170 Bacteria 1770
442 Ga0373946_0017997 3300035171 Bacteria 2707
443 Ga0373946_0029415 3300035171 Bacteria 2186
444 Ga0373955_0111170 3300035172 Bacteria 1584
445 Ga0373955_0299565 3300035172 Bacteria 969
446 Ga0373942_0053701 3300035207 Bacteria 1137
447 Ga0373924_0161248 3300035410 Bacteria 983
448 Ga0373935_0004267 3300035692 Bacteria 8382
449 Ga0373935_0145821 3300035692 Bacteria 1602
450 Ga0373927_0001468 3300035695 Bacteria 17747
451 Ga0373927_0014398 3300035695 Bacteria 5236
452 Ga0373927_0041622 3300035695 Bacteria 2980
453 Ga0373933_0011609 3300035724 Bacteria 4860
454 Ga0373933_0384388 3300035724 Bacteria 914
455 Ga0373947_0000755 3300035725 Bacteria 19381
456 Ga0373937_0141690 3300036401 Bacteria 2249
457 Ga0373925_0002143 3300037068 Bacteria 16126
458 Ga0373925_0126935 3300037068 Bacteria 1985
459 Ga0373925_0183187 3300037068 Bacteria 1659
460 Ga0373925_0496505 3300037068 Bacteria 1002
461 Ga0395900_0018596 3300037418 Bacteria 7086
462 Ga0395898_0272155 3300037466 Bacteria 1615
463 Ga0436364_0758732 3300037853 Bacteria 598
464 Ga0436365_1755197 3300039437 Bacteria 708
465 Ga0451795_0208579 3300041456 Bacteria 896
466 Ga0451802_1548451 3300041460 Bacteria 548
467 Ga0451833_0479195 3300041491 Bacteria 595
468 Ga0451851_0474645 3300041507 Bacteria 634
469 Ga0451843_0708952 3300041509 Bacteria 781
470 Ga0451853_2687330 3300041512 Bacteria 924
471 Ga0439455_0262621 3300042012 Bacteria 507
472 Ga0466972_0005057 3300044658 Bacteria 6608
473 Ga0466963_1289292 3300044694 Bacteria 513
474 Ga0495617_007067 3300046452 Bacteria 3915
475 Ga0495592_0011034 3300046454 Bacteria 6817
476 Ga0495603_0000217 3300046455 Bacteria 29788
477 Ga0495603_0146829 3300046455 Bacteria 1371
478 Ga0495603_0156964 3300046455 Bacteria 1320
479 Ga0495629_0000188 3300046459 Bacteria 56009
480 Ga0495629_0030849 3300046459 Bacteria 3798
481 Ga0495638_0025061 3300046460 Bacteria 3881
482 Ga0495638_0386804 3300046460 Bacteria 729
483 Ga0495653_0334513 3300046463 Bacteria 978
484 Ga0495653_0857792 3300046463 Bacteria 543
485 Ga0495580_0003058 3300046472 Bacteria 14329
486 Ga0495580_0786153 3300046472 Bacteria 618
487 Ga0495582_0002016 3300046473 Bacteria 11377
488 Ga0495582_0075786 3300046473 Bacteria 1863
489 Ga0495605_0117239 3300046474 Bacteria 1210
490 Ga0495605_0298628 3300046474 Bacteria 682
491 Ga0495639_0000011 3300046475 Bacteria 92268
492 Ga0495639_0009124 3300046475 Bacteria 4251
493 Ga0495662_0004000 3300046476 Bacteria 7426
494 Ga0495662_0345158 3300046476 Bacteria 732
495 Ga0495664_0017699 3300046477 Bacteria 4075
496 Ga0495664_0025627 3300046477 Bacteria 3434
497 Ga0495664_0045898 3300046477 Bacteria 2592
498 Ga0495585_0087821 3300046492 Bacteria 1678
499 Ga0495594_0000128 3300046499 Bacteria 35750
500 Ga0495596_0363539 3300046500 Bacteria 564
501 Ga0495606_0324035 3300046507 Bacteria 827
502 Ga0495618_0532814 3300046514 Bacteria 705
503 Ga0495620_0345759 3300046515 Bacteria 564
504 Ga0495628_0045528 3300046516 Bacteria 3488
505 Ga0495628_0874139 3300046516 Bacteria 625
506 Ga0495630_0020303 3300046517 Bacteria 4898
507 Ga0495630_0048149 3300046517 Bacteria 3190
508 Ga0495630_0940494 3300046517 Bacteria 658
509 Ga0495631_0149252 3300046518 Bacteria 1003
510 Ga0495632_0020048 3300046519 Bacteria 3630
511 Ga0495632_0142302 3300046519 Bacteria 1112
512 Ga0495643_0191383 3300046522 Bacteria 988
513 Ga0495644_0117631 3300046523 Bacteria 1010
514 Ga0495648_0179177 3300046524 Bacteria 1079
515 Ga0495663_0135554 3300046525 Bacteria 833
516 Ga0495666_0050474 3300046526 Bacteria 2000
517 Ga0495666_0086548 3300046526 Bacteria 1480
518 Ga0495652_0036486 3300046529 Bacteria 4274
519 Ga0495652_0060264 3300046529 Bacteria 3208
520 Ga0495652_0307039 3300046529 Bacteria 1151
521 Ga0495665_0000133 3300046531 Bacteria 35771
522 Ga0495640_0021557 3300046533 Bacteria 4727
523 Ga0495640_0061522 3300046533 Bacteria 2550
524 Ga0495587_0224989 3300046536 Bacteria 1058
525 Ga0495609_0135889 3300046538 Bacteria 1051
526 Ga0495609_0340470 3300046538 Bacteria 606
527 Ga0495621_0189158 3300046539 Bacteria 825
528 Ga0495597_0232148 3300046542 Bacteria 730
529 Ga0495645_0019327 3300046543 Bacteria 4905
530 Ga0495645_0066950 3300046543 Bacteria 2594
531 Ga0495622_0038041 3300046557 Bacteria 2240
532 Ga0495622_0218259 3300046557 Bacteria 845
533 Ga0495633_0430287 3300046558 Bacteria 596
534 Ga0495667_0740565 3300046559 Bacteria 608
535 Ga0495667_0813564 3300046559 Bacteria 576
536 Ga0495668_0093215 3300046616 Bacteria 1649
537 Ga0495634_0000402 3300046642 Bacteria 42617
538 Ga0495634_0021616 3300046642 Bacteria 4545
539 Ga0495611_0366473 3300046648 Bacteria 660
540 Ga0495625_0120099 3300046660 Bacteria 1789
541 Ga0495635_0002969 3300046663 Bacteria 11639
542 Ga0495635_0088433 3300046663 Bacteria 2120
543 Ga0495659_0359916 3300046664 Bacteria 623
544 Ga0495646_0021019 3300046680 Bacteria 4126
545 Ga0495647_0000726 3300046681 Bacteria 9746
546 Ga0495647_0042356 3300046681 Bacteria 1738
547 Ga0495658_0003384 3300046683 Bacteria 7902
548 Ga0495658_0043614 3300046683 Bacteria 2510
549 Ga0495669_0127745 3300046684 Bacteria 1195
550 Ga0495613_0011524 3300046689 Bacteria 6576
551 Ga0495624_0004589 3300046690 Bacteria 10084
552 Ga0495670_0341468 3300046691 Bacteria 805
553 Ga0495671_0376739 3300046692 Bacteria 680
554 Ga0495649_0243668 3300046694 Bacteria 925
555 Ga0495600_0103653 3300046809 Bacteria 1854
556 Ga0495600_0398514 3300046809 Bacteria 857
557 Ga0495660_0146706 3300046810 Bacteria 1169
558 Ga0495581_0000293 3300047315 Bacteria 24244
559 Ga0495581_0120712 3300047315 Bacteria 1525
560 Ga0495604_0134672 3300047317 Bacteria 1772
561 Ga0495674_0108900 3300047319 Bacteria 2350
562 Ga0495674_0409856 3300047319 Bacteria 1093
563 Ga0495672_0210859 3300047320 Bacteria 965
564 Ga0495676_0071194 3300047321 Bacteria 2673
565 Ga0495680_0176648 3300047322 Bacteria 1543
566 Ga0495675_0258543 3300047444 Bacteria 1044
567 Ga0495677_0028610 3300047445 Bacteria 2025
568 Ga0495681_0122611 3300047470 Bacteria 1114
569 Ga0495684_0038784 3300047471 Bacteria 3652
570 Ga0495593_0002447 3300047673 Bacteria 11168
571 Ga0496100_0034795 3300048903 Bacteria 3164
572 Ga0496100_0126437 3300048903 Bacteria 1795
573 Ga0496100_1000222 3300048903 Bacteria 658
574 Ga0496100_1154024 3300048903 Bacteria 611
575 Ga0496100_1545545 3300048903 Bacteria 524
576 Ga0496101_0123816 3300048904 Bacteria 1957
577 Ga0496101_0191504 3300048904 Bacteria 1578
578 Ga0496101_0643367 3300048904 Bacteria 838
579 Ga0496102_0007134 3300048905 Bacteria 9543
580 Ga0496102_0738676 3300048905 Bacteria 907
581 Ga0496102_0836716 3300048905 Bacteria 843
582 Ga0496102_1433812 3300048905 Bacteria 609
583 Ga0496103_0008518 3300048906 Bacteria 6092
584 Ga0496103_0173559 3300048906 Bacteria 1385
585 Ga0496104_0023259 3300048907 Bacteria 5697
586 Ga0496104_0402819 3300048907 Bacteria 1280
587 Ga0496105_0004094 3300048908 Bacteria 10925
588 Ga0496105_0166849 3300048908 Bacteria 1806
589 Ga0496106_0052364 3300048909 Bacteria 3079
590 Ga0496107_0001167 3300048910 Bacteria 15918
591 Ga0496108_0011742 3300048911 Bacteria 7124
592 Ga0496108_0755847 3300048911 Bacteria 841
593 Ga0496109_0076868 3300048912 Bacteria 3071
594 Ga0496109_1156424 3300048912 Bacteria 711
595 Ga0496109_1567925 3300048912 Bacteria 593
596 Ga0496110_0006530 3300048913 Bacteria 9254
597 Ga0496110_0052942 3300048913 Bacteria 3567
598 Ga0496110_0207993 3300048913 Bacteria 1778
599 Ga0496111_0017721 3300048914 Bacteria 4925
600 Ga0496111_0260758 3300048914 Bacteria 1286
601 Ga0496112_0014473 3300048915 Bacteria 7322
602 Ga0496112_0245465 3300048915 Bacteria 1742
603 Ga0496113_0004386 3300048916 Bacteria 8655
604 Ga0496113_0034043 3300048916 Bacteria 3714
605 Ga0496114_0017028 3300048917 Bacteria 5862
606 Ga0496114_0085629 3300048917 Bacteria 2669
607 Ga0496115_0001479 3300048918 Bacteria 16884
608 Ga0496115_0098802 3300048918 Bacteria 2391
609 Ga0496118_0131089 3300048921 Bacteria 1610
610 Ga0496118_0290189 3300048921 Bacteria 905
611 Ga0496119_0099898 3300048922 Bacteria 1631
612 Ga0496121_0000230 3300048924 Bacteria 120616
613 Ga0496121_0059253 3300048924 Bacteria 3158
614 Ga0496121_0090900 3300048924 Bacteria 2385
615 Ga0496121_0166974 3300048924 Bacteria 1603
616 Ga0496121_0184469 3300048924 Bacteria 1502
617 Ga0496121_0473430 3300048924 Bacteria 802
618 Ga0496124_0040460 3300048927 Bacteria 4031
619 Ga0496124_0385301 3300048927 Bacteria 979
620 Ga0496125_0193709 3300048928 Bacteria 1339
621 Ga0496125_0375060 3300048928 Bacteria 841
622 Ga0496126_0008238 3300048929 Bacteria 11260
623 Ga0496126_0017353 3300048929 Bacteria 7173
624 Ga0496126_0053315 3300048929 Bacteria 3670
625 Ga0496126_0145901 3300048929 Bacteria 2032
626 Ga0496126_0190559 3300048929 Bacteria 1737
627 Ga0496126_0690184 3300048929 Bacteria 794
628 Ga0495678_090514 3300049459 Bacteria 1079
629 Ga0501041_0623714 3300049577 Bacteria 689
630 Ga0501048_0476304 3300049582 Bacteria 895
631 Ga0501067_0182817 3300049583 Bacteria 1168
632 nmdc:mga03683_184706_c1 3300050489 Bacteria 952
633 nmdc:mga03683_226380_c1 3300050489 Bacteria 864
634 nmdc:mga03n38_129968_c1 3300050490 Bacteria 1247
635 nmdc:mga03n38_343108_c1 3300050490 Bacteria 811
636 nmdc:mga03n38_887349_c1 3300050490 Bacteria 523
637 nmdc:mga00v17_113642_c1 3300050491 Bacteria 1719
638 nmdc:mga00v17_39454_c1 3300050491 Bacteria 2828
639 nmdc:mga0yw44_216033_c1 3300050492 Bacteria 1270
640 nmdc:mga0yw44_499086_c1 3300050492 Bacteria 826
641 nmdc:mga0yw44_500926_c1 3300050492 Bacteria 824
642 nmdc:mga0yw44_562032_c1 3300050492 Bacteria 775
643 nmdc:mga0k408_497799_c1 3300050493 Bacteria 722
644 nmdc:mga0k408_569510_c1 3300050493 Bacteria 669
645 nmdc:mga06z11_1030292_c1 3300050494 Bacteria 502
646 nmdc:mga06z11_159561_c1 3300050494 Bacteria 1288
647 nmdc:mga06z11_261259_c1 3300050494 Bacteria 1022
648 nmdc:mga06z11_9769_c1 3300050494 Bacteria 4055
649 nmdc:mga04h51_192384_c1 3300050495 Bacteria 798
650 nmdc:mga04h51_37502_c1 3300050495 Bacteria 1565
651 nmdc:mga04h51_95417_c1 3300050495 Bacteria 1076
652 nmdc:mga07m45_175021_c1 3300050496 Bacteria 1248
653 nmdc:mga07m45_704661_c1 3300050496 Bacteria 580
654 nmdc:mga05p37_595524_c1 3300050507 Bacteria 1249
655 nmdc:mga0n895_103606_c1 3300050512 Bacteria 2857
656 nmdc:mga0n895_593495_c1 3300050512 Bacteria 1110
657 nmdc:mga08x19_402363_c1 3300050514 Bacteria 960
658 nmdc:mga0sz30_172491_c1 3300050516 Bacteria 959
659 nmdc:mga0sz30_47850_c1 3300050516 Bacteria 1808
660 Ga0495601_0020668 3300053077 Bacteria 4023
661 Ga0495601_0031051 3300053077 Bacteria 3320
662 Ga0495601_0555593 3300053077 Bacteria 738
663 Ga0495612_0015145 3300053078 Bacteria 3092
664 Ga0495612_0039706 3300053078 Bacteria 1915
665 Ga0495612_0224191 3300053078 Bacteria 833
666 Ga0495612_0510137 3300053078 Bacteria 552
667 Ga0495655_0029576 3300053083 Bacteria 1318
668 Ga0495595_0035636 3300053084 Bacteria 2254
669 Ga0495619_0056084 3300053085 Bacteria 2611
670 Ga0495619_0186331 3300053085 Bacteria 1436
671 Ga0500643_068527 3300053087 Bacteria 987
672 Ga0500566_0068961 3300053094 Bacteria 1987
673 Ga0500641_0012688 3300053096 Bacteria 3084
674 Ga0500562_072304 3300053108 Bacteria 931
675 Ga0500595_003276 3300053119 Bacteria 7647
676 Ga0500595_004221 3300053119 Bacteria 6497
677 Ga0500595_162204 3300053119 Bacteria 623
678 Ga0500614_187511 3300053123 Bacteria 634
679 Ga0500642_0180455 3300053130 Bacteria 987
680 Ga0500655_033567 3300053133 Bacteria 993
681 Ga0500561_0036289 3300053137 Bacteria 1277
682 Ga0500588_0290716 3300053146 Bacteria 618
683 Ga0500604_0104496 3300053151 Bacteria 936
684 Ga0500638_000489 3300053162 Bacteria 9729
685 Ga0500636_0447108 3300053177 Bacteria 585
686 Ga0500636_0494896 3300053177 Bacteria 541
687 Ga0500637_0000042 3300053178 Bacteria 46215
688 Ga0500645_025118 3300053730 Bacteria 1819
689 Ga0500609_011701 3300053731 Bacteria 1187
690 Ga0500661_009657 3300055283 Bacteria 1763
691 2513698107 2513237101 Bacteria 7952346
692 2513856849 2513237137 Bacteria 9558895
693 2524468480 2524023210 Bacteria 9029266
694 2671123859 2667528175 Bacteria 7532676
695 2874607410 2874604998 Bacteria 7834745
696 2876817706 2876808645 Bacteria 8824342
697 2879111867 2879110137 Bacteria 8907982
698 2885391394 2885383462 Bacteria 9473874
699 2889038011 2889033259 Bacteria 9099371
700 2903755290 2903748898 Bacteria 9972761
701 2903769728 2903768456 Bacteria 9749579
702 2904701276
703 2906616515
704 2906635286 2906635258 Bacteria 8601019
705 2906663012 2906660503 Bacteria 8595048
706 2922366013 2922361189 Bacteria 7436256
707 2922386825 2922386360 Bacteria 7017218
708 3005481259 3005474847 Bacteria 9259049
709 8006939451 8006933436 Bacteria 10410654
710 8006972114 8006964411 Bacteria 8966052
711 8006979201 8006973647 Bacteria 10679141
712 8006984432 8006984368 Bacteria 9651211
713 8019565326 8019555841 Bacteria 9642137
714 8019575426 8019565922 Bacteria 9639779
715 8056679831 8056673599 Bacteria 7871253
716 8056684752 8056681323 Bacteria 8472857
717 Ga0068853_101222574
718 JGI24743J22301_10091420
719 JGI25406J46586_10006725
720 JGI25406J46586_10013482
721 JGI25153J46596_10003572
722 JGI25404J52841_10006565
723 JGI25404J52841_10015669
724 JGI25404J52841_10017355
725 JGI25404J52841_10018895
726 JGI25404J52841_10055268
727 JGI25404J52841_10104462
728 Ga0065707_10714355
729 Ga0070676_10385437
730 Ga0070683_100092275
731 Ga0068869_100181628
732 Ga0068869_100509714
733 Ga0068869_100545289
734 Ga0068869_101222961
735 Ga0068869_101439618
736 Ga0070680_100856309
737 Ga0070680_101279924
738 Ga0070680_101888066
739 Ga0070682_100140858
740 Ga0068868_100254287
741 Ga0070660_100684192
742 Ga0070661_100057205
743 Ga0070661_100127903
744 Ga0070668_100058827
745 Ga0070668_100842966
746 Ga0070669_100046134
747 Ga0070669_100703172
748 Ga0070675_101183277
749 Ga0070671_101232576
750 Ga0070674_100809000
751 Ga0070673_101073409
752 Ga0070688_100285454
753 Ga0070688_101015025
754 Ga0070667_100998950
755 Ga0070709_10070318
756 Ga0070714_100071834
757 Ga0070714_100156939
758 Ga0070713_100001443
759 Ga0070713_100007690
760 Ga0070713_100202384
761 Ga0070713_102173189
762 Ga0070710_10115476
763 Ga0070710_11532206
764 Ga0070711_100012345
765 Ga0070708_100526876
766 Ga0070663_100045576
767 Ga0070663_100067261
768 Ga0070663_100097496
769 Ga0070663_100224797
770 Ga0070663_100942935
771 Ga0070678_100080228
772 Ga0070678_100144901
773 Ga0070678_100243239
774 Ga0070662_100501335
775 Ga0070662_101417574
776 Ga0070681_10013908
777 Ga0070685_10461600
778 Ga0070706_101143666
779 Ga0070707_100095241
780 Ga0070698_100289302
781 Ga0070699_101453547
782 Ga0070699_101601533
783 Ga0070679_100097785
784 Ga0070679_100193859
785 Ga0070679_101671083
786 Ga0070684_100115656
787 Ga0070684_100160950
788 Ga0070684_100935390
789 Ga0070684_101873041
790 Ga0068853_100162127
791 Ga0068853_100323700
792 Ga0070695_100133292
793 Ga0070693_100695498
794 Ga0070693_101355377
795 Ga0070665_100038548
796 Ga0070665_100111668
797 Ga0070665_100230192
798 Ga0070665_100660593
799 Ga0070665_101006768
800 Ga0070704_101356413
801 Ga0070704_102069521
802 Ga0068855_100031944
803 Ga0068855_101611820
804 Ga0070664_100364972
805 Ga0070664_100799568
806 Ga0068856_100266259
807 Ga0070702_100150085
808 Ga0070702_101001121
809 Ga0068852_100407546
810 Ga0068852_100600520
811 Ga0068852_100642796
812 Ga0068852_100896572
813 Ga0068852_101784735
814 Ga0068859_100057641
815 Ga0068859_102991185
816 Ga0068864_100163649
817 Ga0068864_100833624
818 Ga0068864_100888454
819 Ga0068866_10575534
820 Ga0068861_100113676
821 Ga0068861_100354198
822 Ga0068861_100454311
823 Ga0068861_102039294
824 Ga0068863_100936400
825 Ga0068863_101753614
826 Ga0068858_100128143
827 Ga0068860_102346549
828 Ga0068862_100036909
829 Ga0068862_100613828
830 Ga0068862_101830373
831 Ga0081455_10202804
832 Ga0081455_10415145
833 Ga0081455_10445298
834 Ga0081455_10564387
835 Ga0081540_1003361
836 Ga0081540_1005422
837 Ga0081540_1013327
838 Ga0081540_1015125
839 Ga0081540_1019809
840 Ga0081540_1031210
841 Ga0081540_1035542
842 Ga0081540_1035686
843 Ga0081540_1064447
844 Ga0081540_1068833
845 Ga0081540_1069505
846 Ga0081540_1098851
847 Ga0081540_1179771
848 Ga0081540_1235849
849 Ga0081540_1311748
850 Ga0081539_10001470
851 Ga0081539_10186639
852 Ga0070717_10002220
853 Ga0070717_10467766
854 Ga0070717_10547546
855 Ga0075365_10044957
856 Ga0075365_10208076
857 Ga0075365_10258021
858 Ga0075365_10281481
859 Ga0075365_10633801
860 Ga0075368_10007218
861 Ga0075368_10185089
862 Ga0075368_10288124
863 Ga0075363_100000503
864 Ga0075363_100138530
865 Ga0075363_100299171
866 Ga0075363_100543183
867 Ga0070716_101642313
868 Ga0070712_100023933
869 Ga0070712_100779186
870 Ga0070712_100937222
871 Ga0075362_10229118
872 Ga0075367_10106837
873 Ga0075367_10246069
874 Ga0075367_10350710
875 Ga0075369_10037242
876 Ga0075369_10095711
877 Ga0075369_10125598
878 Ga0075366_10601643
879 Ga0097621_100025839
880 Ga0097621_100864619
881 Ga0097621_101046259
882 Ga0097621_101679616
883 Ga0075370_10084725
884 Ga0068871_100310646
885 Ga0068871_100366128
886 Ga0075430_100726349
887 Ga0068865_100095637
888 Ga0068865_100219791
889 Ga0097620_100057642
890 Ga0097620_102991297
891 Ga0075435_100869066
892 Ga0099794_10659905
893 Ga0099795_10061353
894 Ga0099795_10074681
895 Ga0099795_10091014
896 Ga0099795_10600522
897 Ga0105250_10534645
898 Ga0105240_10034676
899 Ga0105240_10403439
900 Ga0105240_11484208
901 Ga0105240_11614221
902 Ga0105240_11865796
903 Ga0105240_12461249
904 Ga0105245_10069475
905 Ga0105245_10193858
906 Ga0105245_10624726
907 Ga0105245_10696004
908 Ga0105247_10231734
909 Ga0114129_11429045
910 Ga0105243_11387693
911 Ga0105243_12672416
912 Ga0105241_10103601
913 Ga0105241_11279554
914 Ga0105242_10422044
915 Ga0105242_11093633
916 Ga0105248_10498284
917 Ga0105248_10627738
918 Ga0105248_10790251
919 Ga0105237_10092782
920 Ga0105237_10340636
921 Ga0105237_10608209
922 Ga0105237_11184646
923 Ga0105238_10138400
924 Ga0105238_10173286
925 Ga0105238_10363358
926 Ga0105238_10641816
927 Ga0105238_12870742
928 Ga0105249_10261820
929 Ga0105249_10601048
930 Ga0105249_11296408
931 Ga0105249_12009922
932 Ga0105239_10083629
933 Ga0105239_10765678
934 Ga0105239_11252869
935 Ga0105239_11547378
936 Ga0105246_10021360
937 Ga0105246_11014808
938 Ga0105246_11260201
939 Ga0105246_11615898
940 Ga0157344_1007107
941 Ga0157341_1008633
942 Ga0157370_10156607
943 Ga0157370_10877767
944 Ga0157370_11800752
945 Ga0157374_10643482
946 Ga0157374_11036724
947 Ga0157374_11885528
948 Ga0157378_10525645
949 Ga0163162_10246533
950 Ga0163162_10419785
951 Ga0163162_11807171
952 Ga0163162_12246891
953 Ga0157372_10117900
954 Ga0157372_10682936
955 Ga0157372_10694732
956 Ga0157375_10233150
957 Ga0157375_10560132
958 Ga0157375_10960916
959 Ga0157375_11270549
960 Ga0163163_10101104
961 Ga0163163_10127526
962 Ga0157380_10392517
963 Ga0157380_10526188
964 Ga0157377_10294170
965 Ga0157377_10321062
966 Ga0157379_10365422
967 Ga0157379_10437304
968 Ga0157379_10810442
969 Ga0157379_11845729
970 Ga0157376_10824326
971 Ga0157376_10974097
972 Ga0163161_10377317
973 Ga0163161_11485070
974 Ga0209233_1014853
975 Ga0207656_10009794
976 Ga0207642_10118481
977 Ga0207642_10355348
978 Ga0207710_10061750
979 Ga0207710_10109533
980 Ga0207710_10512910
981 Ga0207688_10335387
982 Ga0207688_10637441
983 Ga0207688_11091722
984 Ga0207645_10200605
985 Ga0207645_10675581
986 Ga0207643_10193845
987 Ga0207684_10421639
988 Ga0207684_10671876
989 Ga0207654_10239999
990 Ga0207654_10312008
991 Ga0207707_10040154
992 Ga0207707_10176189
993 Ga0207695_10290030
994 Ga0207695_10296419
995 Ga0207695_10862922
996 Ga0207671_10087252
997 Ga0207671_10158502
998 Ga0207671_10866370
999 Ga0207693_10036084
1000 Ga0207693_10404349
1001 Ga0207663_10030184
1002 Ga0207663_10124488
1003 Ga0207663_11308738
1004 Ga0207660_10332230
1005 Ga0207660_10770700
1006 Ga0207657_10293110
1007 Ga0207649_10026045
1008 Ga0207649_10131180
1009 Ga0207649_11659151
1010 Ga0207652_10100751
1011 Ga0207646_10091694
1012 Ga0207681_10029279
1013 Ga0207681_10231223
1014 Ga0207694_10137758
1015 Ga0207694_10207643
1016 Ga0207659_10851284
1017 Ga0207687_10041702
1018 Ga0207687_11217518
1019 Ga0207700_10002327
1020 Ga0207700_10015419
1021 Ga0207700_10154298
1022 Ga0207664_10020316
1023 Ga0207664_10045136
1024 Ga0207644_10448209
1025 Ga0207706_10384574
1026 Ga0207706_10432234
1027 Ga0207706_10805613
1028 Ga0207686_10389264
1029 Ga0207709_10638913
1030 Ga0207670_10425284
1031 Ga0207669_10199082
1032 Ga0207669_10327407
1033 Ga0207669_11071826
1034 Ga0207704_10373858
1035 Ga0207704_10398691
1036 Ga0207704_11039661
1037 Ga0207665_10009005
1038 Ga0207665_10159629
1039 Ga0207665_10473309
1040 Ga0207691_10684395
1041 Ga0207711_10270876
1042 Ga0207689_10098727
1043 Ga0207689_10099357
1044 Ga0207689_10476282
1045 Ga0207689_10496196
1046 Ga0207689_11459044
1047 Ga0207661_10004542
1048 Ga0207661_11569216
1049 Ga0207667_10057259
1050 Ga0207667_10491911
1051 Ga0207651_10822538
1052 Ga0207651_10935002
1053 Ga0207712_10237821
1054 Ga0207712_10751963
1055 Ga0207668_10202328
1056 Ga0207668_10605831
1057 Ga0207640_10525247
1058 Ga0207640_11260204
1059 Ga0207658_10609712
1060 Ga0207658_10939694
1061 Ga0207658_11015093
1062 Ga0207677_10092314
1063 Ga0207677_10302918
1064 Ga0207703_10145131
1065 Ga0207639_10177706
1066 Ga0207639_10272047
1067 Ga0207639_10567254
1068 Ga0207639_11526955
1069 Ga0207678_10015836
1070 Ga0207678_10039984
1071 Ga0207678_10080741
1072 Ga0207678_10198595
1073 Ga0207678_10332148
1074 Ga0207678_10360133
1075 Ga0207702_10997745
1076 Ga0207641_10437606
1077 Ga0207641_10930727
1078 Ga0207641_10939334
1079 Ga0207676_12004924
1080 Ga0207676_12134420
1081 Ga0207676_12431738
1082 Ga0207675_100214219
1083 Ga0207675_100261939
1084 Ga0207675_100271460
1085 Ga0207675_102638724
1086 Ga0207683_10091726
1087 Ga0207683_10092082
1088 Ga0207683_10093548
1089 Ga0207698_10533223
1090 Ga0209588_1004503
1091 Ga0209813_10031470
1092 Ga0209813_10077854
1093 Ga0268266_10009754
1094 Ga0268266_10088172
1095 Ga0268266_10104382
1096 Ga0268266_10235416
1097 Ga0268266_10311275
1098 Ga0268266_10748731
1099 Ga0268266_10824073
1100 Ga0268266_10833685
1101 Ga0268266_10995560
1102 Ga0268266_11932821
1103 Ga0268265_10033146
1104 Ga0268265_10042573
1105 Ga0268265_10477944
1106 Ga0268264_10171186
1107 Ga0268264_10921968
1108 Ga0307517_10000634
1109 Ga0307515_10791720
1110 Ga0307511_10156638
1111 Ga0265330_10050418
1112 Ga0265332_10017916
1113 Ga0265332_10020441
1114 Ga0265325_10005682
1115 Ga0265339_10005528
1116 Ga0265339_10061435
1117 Ga0265331_10313539
1118 Ga0307513_10246590
1119 Ga0307509_10231715
1120 Ga0307408_100570992
1121 Ga0307408_100734661
1122 Ga0307408_101933753
1123 Ga0307508_10382595
1124 Ga0307508_10540237
1125 Ga0265314_10083139
1126 Ga0307516_10014729
1127 Ga0307516_10060750
1128 Ga0307516_10306644
1129 Ga0307516_10487832
1130 Ga0307516_10494320
1131 Ga0307405_10438984
1132 Ga0307412_10132431
1133 Ga0307412_10481059
1134 Ga0307412_11461911
1135 Ga0307409_101521484
1136 Ga0307416_100836381
1137 Ga0307416_102671446
1138 Ga0307411_10899923
1139 Ga0307415_100898249
1140 Ga0307507_10603106
1141 Ga0307510_10023227
1142 Ga0315911_1000002
1143 Ga0373929_0057974
1144 Ga0373934_0021398
1145 Ga0373923_0006710
1146 Ga0373936_0081781
1147 Ga0373936_0135147
1148 Ga0373939_0047402
1149 Ga0373941_0085118
1150 Ga0373945_0079304
1151 Ga0373945_0158069
1152 Ga0373954_0015636
1153 Ga0373954_0480090
1154 Ga0373956_0281865
1155 Ga0373957_0025628
1156 Ga0373943_0032461
1157 Ga0373943_0070364
1158 Ga0373946_0017997
1159 Ga0373946_0029415
1160 Ga0373955_0111170
1161 Ga0373955_0299565
1162 Ga0373942_0053701
1163 Ga0373924_0161248
1164 Ga0373935_0004267
1165 Ga0373935_0145821
1166 Ga0373927_0001468
1167 Ga0373927_0014398
1168 Ga0373927_0041622
1169 Ga0373933_0011609
1170 Ga0373933_0384388
1171 Ga0373947_0000755
1172 Ga0373937_0141690
1173 Ga0373925_0002143
1174 Ga0373925_0126935
1175 Ga0373925_0183187
1176 Ga0373925_0496505
1177 Ga0395900_0018596
1178 Ga0395898_0272155
1179 Ga0436364_0758732
1180 Ga0436365_1755197
1181 Ga0451795_0208579
1182 Ga0451802_1548451
1183 Ga0451833_0479195
1184 Ga0451851_0474645
1185 Ga0451843_0708952
1186 Ga0451853_2687330
1187 Ga0439455_0262621
1188 Ga0466972_0005057
1189 Ga0466963_1289292
1190 Ga0495617_007067
1191 Ga0495592_0011034
1192 Ga0495603_0000217
1193 Ga0495603_0146829
1194 Ga0495603_0156964
1195 Ga0495629_0000188
1196 Ga0495629_0030849
1197 Ga0495638_0025061
1198 Ga0495638_0386804
1199 Ga0495653_0334513
1200 Ga0495653_0857792
1201 Ga0495580_0003058
1202 Ga0495580_0786153
1203 Ga0495582_0002016
1204 Ga0495582_0075786
1205 Ga0495605_0117239
1206 Ga0495605_0298628
1207 Ga0495639_0000011
1208 Ga0495639_0009124
1209 Ga0495662_0004000
1210 Ga0495662_0345158
1211 Ga0495664_0017699
1212 Ga0495664_0025627
1213 Ga0495664_0045898
1214 Ga0495585_0087821
1215 Ga0495594_0000128
1216 Ga0495596_0363539
1217 Ga0495606_0324035
1218 Ga0495618_0532814
1219 Ga0495620_0345759
1220 Ga0495628_0045528
1221 Ga0495628_0874139
1222 Ga0495630_0020303
1223 Ga0495630_0048149
1224 Ga0495630_0940494
1225 Ga0495631_0149252
1226 Ga0495632_0020048
1227 Ga0495632_0142302
1228 Ga0495643_0191383
1229 Ga0495644_0117631
1230 Ga0495648_0179177
1231 Ga0495663_0135554
1232 Ga0495666_0050474
1233 Ga0495666_0086548
1234 Ga0495652_0036486
1235 Ga0495652_0060264
1236 Ga0495652_0307039
1237 Ga0495665_0000133
1238 Ga0495640_0021557
1239 Ga0495640_0061522
1240 Ga0495587_0224989
1241 Ga0495609_0135889
1242 Ga0495609_0340470
1243 Ga0495621_0189158
1244 Ga0495597_0232148
1245 Ga0495645_0019327
1246 Ga0495645_0066950
1247 Ga0495622_0038041
1248 Ga0495622_0218259
1249 Ga0495633_0430287
1250 Ga0495667_0740565
1251 Ga0495667_0813564
1252 Ga0495668_0093215
1253 Ga0495634_0000402
1254 Ga0495634_0021616
1255 Ga0495611_0366473
1256 Ga0495625_0120099
1257 Ga0495635_0002969
1258 Ga0495635_0088433
1259 Ga0495659_0359916
1260 Ga0495646_0021019
1261 Ga0495647_0000726
1262 Ga0495647_0042356
1263 Ga0495658_0003384
1264 Ga0495658_0043614
1265 Ga0495669_0127745
1266 Ga0495613_0011524
1267 Ga0495624_0004589
1268 Ga0495670_0341468
1269 Ga0495671_0376739
1270 Ga0495649_0243668
1271 Ga0495600_0103653
1272 Ga0495600_0398514
1273 Ga0495660_0146706
1274 Ga0495581_0000293
1275 Ga0495581_0120712
1276 Ga0495604_0134672
1277 Ga0495674_0108900
1278 Ga0495674_0409856
1279 Ga0495672_0210859
1280 Ga0495676_0071194
1281 Ga0495680_0176648
1282 Ga0495675_0258543
1283 Ga0495677_0028610
1284 Ga0495681_0122611
1285 Ga0495684_0038784
1286 Ga0495593_0002447
1287 Ga0496100_0034795
1288 Ga0496100_0126437
1289 Ga0496100_1000222
1290 Ga0496100_1154024
1291 Ga0496100_1545545
1292 Ga0496101_0123816
1293 Ga0496101_0191504
1294 Ga0496101_0643367
1295 Ga0496102_0007134
1296 Ga0496102_0738676
1297 Ga0496102_0836716
1298 Ga0496102_1433812
1299 Ga0496103_0008518
1300 Ga0496103_0173559
1301 Ga0496104_0023259
1302 Ga0496104_0402819
1303 Ga0496105_0004094
1304 Ga0496105_0166849
1305 Ga0496106_0052364
1306 Ga0496107_0001167
1307 Ga0496108_0011742
1308 Ga0496108_0755847
1309 Ga0496109_0076868
1310 Ga0496109_1156424
1311 Ga0496109_1567925
1312 Ga0496110_0006530
1313 Ga0496110_0052942
1314 Ga0496110_0207993
1315 Ga0496111_0017721
1316 Ga0496111_0260758
1317 Ga0496112_0014473
1318 Ga0496112_0245465
1319 Ga0496113_0004386
1320 Ga0496113_0034043
1321 Ga0496114_0017028
1322 Ga0496114_0085629
1323 Ga0496115_0001479
1324 Ga0496115_0098802
1325 Ga0496118_0131089
1326 Ga0496118_0290189
1327 Ga0496119_0099898
1328 Ga0496121_0000230
1329 Ga0496121_0059253
1330 Ga0496121_0090900
1331 Ga0496121_0166974
1332 Ga0496121_0184469
1333 Ga0496121_0473430
1334 Ga0496124_0040460
1335 Ga0496124_0385301
1336 Ga0496125_0193709
1337 Ga0496125_0375060
1338 Ga0496126_0008238
1339 Ga0496126_0017353
1340 Ga0496126_0053315
1341 Ga0496126_0145901
1342 Ga0496126_0190559
1343 Ga0496126_0690184
1344 Ga0495678_090514
1345 Ga0501041_0623714
1346 Ga0501048_0476304
1347 Ga0501067_0182817
1348 nmdc:mga03683_184706_c1
1349 nmdc:mga03683_226380_c1
1350 nmdc:mga03n38_129968_c1
1351 nmdc:mga03n38_343108_c1
1352 nmdc:mga03n38_887349_c1
1353 nmdc:mga00v17_113642_c1
1354 nmdc:mga00v17_39454_c1
1355 nmdc:mga0yw44_216033_c1
1356 nmdc:mga0yw44_499086_c1
1357 nmdc:mga0yw44_500926_c1
1358 nmdc:mga0yw44_562032_c1
1359 nmdc:mga0k408_497799_c1
1360 nmdc:mga0k408_569510_c1
1361 nmdc:mga06z11_1030292_c1
1362 nmdc:mga06z11_159561_c1
1363 nmdc:mga06z11_261259_c1
1364 nmdc:mga06z11_9769_c1
1365 nmdc:mga04h51_192384_c1
1366 nmdc:mga04h51_37502_c1
1367 nmdc:mga04h51_95417_c1
1368 nmdc:mga07m45_175021_c1
1369 nmdc:mga07m45_704661_c1
1370 nmdc:mga05p37_595524_c1
1371 nmdc:mga0n895_103606_c1
1372 nmdc:mga0n895_593495_c1
1373 nmdc:mga08x19_402363_c1
1374 nmdc:mga0sz30_172491_c1
1375 nmdc:mga0sz30_47850_c1
1376 Ga0495601_0020668
1377 Ga0495601_0031051
1378 Ga0495601_0555593
1379 Ga0495612_0015145
1380 Ga0495612_0039706
1381 Ga0495612_0224191
1382 Ga0495612_0510137
1383 Ga0495655_0029576
1384 Ga0495595_0035636
1385 Ga0495619_0056084
1386 Ga0495619_0186331
1387 Ga0500643_068527
1388 Ga0500566_0068961
1389 Ga0500641_0012688
1390 Ga0500562_072304
1391 Ga0500595_003276
1392 Ga0500595_004221
1393 Ga0500595_162204
1394 Ga0500614_187511
1395 Ga0500642_0180455
1396 Ga0500655_033567
1397 Ga0500561_0036289
1398 Ga0500588_0290716
1399 Ga0500604_0104496
1400 Ga0500638_000489
1401 Ga0500636_0447108
1402 Ga0500636_0494896
1403 Ga0500637_0000042
1404 Ga0500645_025118
1405 Ga0500609_011701
1406 Ga0500661_009657
1407 2513698107
1408 2513856849
1409 2524468480
1410 2671123859
1411 2874607410
1412 2876817706
1413 2879111867
1414 2885391394
1415 2889038011
1416 2903755290
1417 2903769728
1418 2904701276
1419 2906616515
1420 2906635286
1421 2906663012
1422 2922366013
1423 2922386825
1424 3005481259
1425 8006939451
1426 8006972114
1427 8006979201
1428 8006984432
1429 8019565326
1430 8019575426
1431 8056679831
1432 8056684752

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19802

DUF6285

Domain of unknown function (DUF6285)

45

135

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5mgp-assembly1.cif.gz_z structural basis for arfa-rf2 mediated translation termination on stop-codon lacking mrnas 0.4813 9 85
7xdi-assembly1.cif.gz_A tail structure of bacteriophage ssv19 0.3853 7 53
5mgp-assembly1.cif.gz_z structural basis for arfa-rf2 mediated translation termination on stop-codon lacking mrnas 0.3386 9 85
7ane-assembly1.cif.gz_ai leishmania major mitochondrial ribosome 0.3239 5 106
7xdi-assembly1.cif.gz_A tail structure of bacteriophage ssv19 0.3144 7 53
ID Description Score Start End Superfamily
af_Q54TN6_1_527_3.90.1570.30 Alpha Beta;Alpha-Beta Complex;tt1808, chain A; 0.5705 4 87 3.90.1570.30
af_Q9M1Q5_8_83_1.10.287.110 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.5685 1 49 1.10.287.110
af_Q8N966_83_222_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.518 41 109 1.10.287.70
af_P47079_419_539_1.10.560.10 Mainly Alpha;Orthogonal Bundle;GROEL; domain 1;GroEL-like equatorial domain 0.4832 8 70 1.10.560.10
af_Q2R0D2_12_159_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.4818 8 60 1.20.140.150
ID Description Score Start End GO Terms
AF-A0A1Y5I9T8-F1-model_v4 DUF6285 domain-containing protein 0.9421 11 118
AF-A0A257JGI6-F1-model_v4 DUF6285 domain-containing protein 0.9299 1 95
AF-B4RDE0-F1-model_v4 DUF6285 domain-containing protein 0.9296 4 112
AF-A0A4Q5WU23-F1-model_v4 deleted 0.9294 2 99
AF-A0A6M2BQA9-F1-model_v4 Protein kinase 0.9278 1 112 GO:0016301

Map