F477035

General Info

Members Datasets Scaffolds Average Seq Length
716 345 1432 262

Family's Representative Sequence

Representative Sequence 3300005530|Ga0070679_100557253|Ga0070679_1005572531
Length 298
Sequence MSTIDFQAELTAAGANVRSRWGAVRFFIRRYPLGAAGAVIMTIFVFAAAFAPYITMYDPLSTNAAASLAKPSTAHWLGCDFMGRDMYSRIIYGARISLMVALGSMLLGSGIGVILGLLSXYLLGWFDLVTQRVLEMMQSLPLLVMAIIMAAALGPSLHNTILAIAIPLVPYVARVIRANTLSLREQPFVEAAKAIGMSEKRIALRHVLPNTLAPLIVLATAQIGSVILIEASLSFLGLGVPEPHPSWGRMLSESAAEYVRTAPWLVIFPGAAISFVVFGTNLLGDALRDTLDPRLRGS

Samples

Sample ID Description Type Environment
1 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
70 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
111 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
112 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
163 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
166 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
167 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
168 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
169 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
170 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
171 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
172 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
173 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
174 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
175 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
176 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
177 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
178 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
179 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
180 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
181 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
182 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
183 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
184 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
185 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
186 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
187 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
188 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
189 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
190 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
191 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
192 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
193 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
194 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
195 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
196 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
197 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
198 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
199 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
200 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
201 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
202 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
203 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
204 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
205 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
206 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
207 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
208 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
209 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
210 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
211 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
212 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
213 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
214 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
215 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
216 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
217 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
218 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
219 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
220 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
221 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
222 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
223 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
224 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
225 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
226 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
227 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
228 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
229 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
230 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
231 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
232 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
233 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
234 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
235 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
236 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
237 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
238 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
239 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
240 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
241 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
242 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
243 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
244 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
245 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
246 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
247 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
248 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
249 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
250 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
251 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
252 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
253 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
254 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
255 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
256 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
257 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
258 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
259 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
260 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
261 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
262 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
263 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
264 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
265 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
266 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
267 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
268 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
269 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
270 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
271 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
272 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
273 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
274 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
275 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
276 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
277 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
278 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
279 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
280 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
281 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
282 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
283 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
284 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
285 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
286 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
287 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
288 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
289 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
290 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
291 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
292 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
293 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
294 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
295 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
296 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
298 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
307 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
309 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
310 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
311 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
312 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
313 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
314 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
315 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
316 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
317 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
318 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
319 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
322 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
323 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
324 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
325 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
326 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
327 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
328 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
329 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
330 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
331 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
332 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
333 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
334 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
335 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
336 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
337 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
338 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
339 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
340 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
341 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
342 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
343 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
344 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
345 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.58
Metatranscriptomes 0.42
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.09
Nodule 0
Rhizoplane 3.07
Rhizosphere 92.04
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070679_100557253 3300005530 Bacteria 1090
2 JGI25405J52794_10026516 3300003911 Bacteria 1191
3 Ga0070658_10017198 3300005327 Bacteria 5787
4 Ga0070658_10171930 3300005327 Bacteria 1820
5 Ga0070676_10158414 3300005328 Bacteria 1455
6 Ga0070683_100029557 3300005329 Bacteria 4963
7 Ga0070683_100394748 3300005329 Bacteria 1319
8 Ga0070690_100197305 3300005330 Bacteria 1399
9 Ga0070690_100267384 3300005330 Bacteria 1215
10 Ga0070670_100040839 3300005331 Bacteria 3987
11 Ga0070677_10001609 3300005333 Bacteria 7141
12 Ga0068869_100136685 3300005334 Bacteria 1889
13 Ga0070680_100002886 3300005336 Bacteria 12781
14 Ga0070680_100011772 3300005336 Bacteria 6784
15 Ga0070680_100051806 3300005336 Bacteria 3350
16 Ga0070680_100096361 3300005336 Bacteria 2453
17 Ga0070682_100357013 3300005337 Bacteria 1091
18 Ga0070660_100074621 3300005339 Bacteria 2654
19 Ga0070660_100129486 3300005339 Bacteria 2018
20 Ga0070689_100013138 3300005340 Bacteria 5985
21 Ga0070689_100097445 3300005340 Bacteria 2325
22 Ga0070689_100098064 3300005340 Bacteria 2318
23 Ga0070689_100439219 3300005340 Bacteria 1109
24 Ga0070691_10065208 3300005341 Bacteria 1758
25 Ga0070691_10088336 3300005341 Bacteria 1525
26 Ga0070661_100232739 3300005344 Bacteria 1416
27 Ga0070668_100270541 3300005347 Bacteria 1416
28 Ga0070669_100152023 3300005353 Bacteria 1792
29 Ga0070669_100214859 3300005353 Bacteria 1518
30 Ga0070675_100260770 3300005354 Bacteria 1519
31 Ga0070671_100032209 3300005355 Bacteria 4335
32 Ga0070671_100089838 3300005355 Bacteria 2572
33 Ga0070674_100187799 3300005356 Bacteria 1587
34 Ga0070673_100018404 3300005364 Bacteria 4988
35 Ga0070673_100163667 3300005364 Bacteria 1894
36 Ga0070688_100141533 3300005365 Bacteria 1634
37 Ga0070667_100054564 3300005367 Bacteria 3374
38 Ga0070703_10000658 3300005406 Bacteria 11997
39 Ga0070709_10231397 3300005434 Bacteria 1322
40 Ga0070714_100012871 3300005435 Bacteria 6688
41 Ga0070714_100101401 3300005435 Bacteria 2536
42 Ga0070714_100210811 3300005435 Bacteria 1781
43 Ga0070714_100266767 3300005435 Bacteria 1587
44 Ga0070713_100037033 3300005436 Bacteria 3942
45 Ga0070710_10020297 3300005437 Bacteria 3445
46 Ga0070710_10043648 3300005437 Bacteria 2484
47 Ga0070711_100004964 3300005439 Bacteria 7903
48 Ga0070711_100034193 3300005439 Bacteria 3389
49 Ga0070711_100126099 3300005439 Bacteria 1901
50 Ga0070711_100330470 3300005439 Bacteria 1220
51 Ga0070711_100376070 3300005439 Bacteria 1147
52 Ga0070705_100001567 3300005440 Bacteria 11987
53 Ga0070700_100002835 3300005441 Bacteria 8892
54 Ga0070694_100001861 3300005444 Bacteria 12504
55 Ga0070694_100078343 3300005444 Bacteria 2292
56 Ga0070694_100101801 3300005444 Bacteria 2033
57 Ga0070708_100009609 3300005445 Bacteria 7799
58 Ga0070708_100059373 3300005445 Bacteria 3410
59 Ga0070708_100115184 3300005445 Bacteria 2474
60 Ga0070663_100010612 3300005455 Bacteria 5747
61 Ga0070662_100066354 3300005457 Bacteria 2647
62 Ga0070662_100283649 3300005457 Bacteria 1341
63 Ga0070681_10028221 3300005458 Bacteria 5642
64 Ga0070681_10079503 3300005458 Bacteria 3236
65 Ga0070681_10165438 3300005458 Bacteria 2134
66 Ga0070681_10212101 3300005458 Bacteria 1852
67 Ga0070681_10309555 3300005458 Bacteria 1489
68 Ga0068867_100495829 3300005459 Bacteria 1049
69 Ga0070685_10137839 3300005466 Bacteria 1532
70 Ga0070706_100015250 3300005467 Bacteria 7094
71 Ga0070706_100073305 3300005467 Bacteria 3169
72 Ga0070706_100450996 3300005467 Bacteria 1197
73 Ga0070707_100005247 3300005468 Bacteria 12124
74 Ga0070698_100010836 3300005471 Bacteria 9701
75 Ga0070698_100034391 3300005471 Bacteria 5245
76 Ga0070698_100103477 3300005471 Bacteria 2817
77 Ga0070699_100001809 3300005518 Bacteria 19434
78 Ga0070699_100035808 3300005518 Bacteria 4291
79 Ga0070679_100016104 3300005530 Bacteria 7203
80 Ga0070679_100065173 3300005530 Bacteria 3631
81 Ga0070679_100128428 3300005530 Bacteria 2516
82 Ga0070679_100154519 3300005530 Bacteria 2270
83 Ga0070679_100216724 3300005530 Bacteria 1876
84 Ga0070679_100236159 3300005530 Bacteria 1787
85 Ga0070679_100411213 3300005530 Bacteria 1298
86 Ga0070684_100128533 3300005535 Bacteria 2284
87 Ga0070684_100215451 3300005535 Bacteria 1751
88 Ga0070684_100255617 3300005535 Bacteria 1602
89 Ga0070697_100037104 3300005536 Bacteria 3937
90 Ga0070697_100548460 3300005536 Bacteria 1014
91 Ga0070672_100031006 3300005543 Bacteria 4021
92 Ga0070686_100022255 3300005544 Bacteria 3773
93 Ga0070695_100002503 3300005545 Bacteria 10586
94 Ga0070695_100002758 3300005545 Bacteria 10190
95 Ga0070695_100006285 3300005545 Bacteria 7018
96 Ga0070696_100000856 3300005546 Bacteria 19655
97 Ga0070696_100071663 3300005546 Bacteria 2439
98 Ga0070665_100096839 3300005548 Bacteria 2955
99 Ga0070665_100299408 3300005548 Bacteria 1611
100 Ga0070704_100001546 3300005549 Bacteria 12419
101 Ga0068855_100060402 3300005563 Bacteria 4433
102 Ga0068855_100062919 3300005563 Bacteria 4331
103 Ga0068855_100075946 3300005563 Bacteria 3900
104 Ga0068855_100105233 3300005563 Bacteria 3244
105 Ga0068855_100116892 3300005563 Bacteria 3056
106 Ga0070664_100037187 3300005564 Bacteria 4091
107 Ga0068857_100014790 3300005577 Bacteria 6808
108 Ga0068856_100510236 3300005614 Bacteria 1223
109 Ga0068859_100010838 3300005617 Bacteria 9173
110 Ga0068859_100408400 3300005617 Bacteria 1454
111 Ga0068864_100061543 3300005618 Bacteria 3252
112 Ga0068861_100090836 3300005719 Bacteria 2410
113 Ga0068863_100105321 3300005841 Bacteria 2683
114 Ga0068863_100163612 3300005841 Bacteria 2133
115 Ga0068863_100564344 3300005841 Bacteria 1125
116 Ga0068858_100274109 3300005842 Bacteria 1606
117 Ga0068858_100589654 3300005842 Bacteria 1078
118 Ga0068860_100007974 3300005843 Bacteria 10563
119 Ga0068860_100453754 3300005843 Bacteria 1275
120 Ga0068862_100001949 3300005844 Bacteria 18707
121 Ga0081455_10000028 3300005937 Bacteria 155778
122 Ga0081455_10015266 3300005937 Bacteria 7469
123 Ga0081455_10021303 3300005937 Bacteria 6083
124 Ga0081455_10042620 3300005937 Bacteria 3979
125 Ga0081540_1000060 3300005983 Bacteria 119707
126 Ga0081540_1001601 3300005983 Bacteria 19299
127 Ga0081539_10001404 3300005985 Bacteria 41513
128 Ga0070717_10000126 3300006028 Bacteria 56422
129 Ga0070717_10236886 3300006028 Bacteria 1608
130 Ga0075365_10171005 3300006038 Bacteria 1517
131 Ga0070716_100172192 3300006173 Bacteria 1414
132 Ga0070712_100021092 3300006175 Bacteria 4273
133 Ga0070712_100054632 3300006175 Bacteria 2793
134 Ga0075367_10287722 3300006178 Bacteria 1034
135 Ga0075369_10008376 3300006186 Bacteria 3975
136 Ga0075369_10109248 3300006186 Bacteria 1246
137 Ga0075428_100004129 3300006844 Bacteria 15990
138 Ga0075428_100036965 3300006844 Bacteria 5377
139 Ga0075428_100040742 3300006844 Bacteria 5109
140 Ga0075428_100047986 3300006844 Bacteria 4689
141 Ga0075428_100073285 3300006844 Bacteria 3740
142 Ga0075428_100143626 3300006844 Bacteria 2594
143 Ga0075428_100265793 3300006844 Bacteria 1846
144 Ga0075430_100344675 3300006846 Bacteria 1230
145 Ga0075430_100344676 3300006846 Bacteria 1230
146 Ga0075431_100000892 3300006847 Bacteria 26338
147 Ga0075431_100002871 3300006847 Bacteria 16671
148 Ga0075431_100004613 3300006847 Bacteria 13528
149 Ga0075431_100023536 3300006847 Bacteria 6303
150 Ga0075431_100025814 3300006847 Bacteria 6022
151 Ga0075431_100474531 3300006847 Bacteria 1244
152 Ga0075431_100665970 3300006847 Bacteria 1020
153 Ga0075433_10006579 3300006852 Bacteria 9201
154 Ga0075433_10150318 3300006852 Bacteria 2071
155 Ga0075433_10258365 3300006852 Bacteria 1545
156 Ga0075434_100013013 3300006871 Bacteria 7901
157 Ga0075434_100047342 3300006871 Bacteria 4267
158 Ga0075429_100003443 3300006880 Bacteria 13503
159 Ga0075429_100004645 3300006880 Bacteria 11810
160 Ga0075429_100072356 3300006880 Bacteria 3002
161 Ga0075429_100356905 3300006880 Bacteria 1280
162 Ga0075436_100049389 3300006914 Bacteria 2903
163 Ga0075436_100071214 3300006914 Bacteria 2404
164 Ga0075436_100111442 3300006914 Bacteria 1910
165 Ga0097620_100010838 3300006931 Bacteria 9173
166 Ga0097620_100408432 3300006931 Bacteria 1454
167 Ga0075435_100044118 3300007076 Bacteria 3571
168 Ga0075435_100105807 3300007076 Bacteria 2335
169 Ga0099795_10009499 3300007788 Bacteria 2826
170 Ga0099795_10044212 3300007788 Bacteria 1597
171 Ga0105240_10051553 3300009093 Bacteria 5176
172 Ga0105240_10057145 3300009093 Bacteria 4878
173 Ga0105240_10175545 3300009093 Bacteria 2533
174 Ga0105240_10416355 3300009093 Bacteria 1511
175 Ga0111539_10001490 3300009094 Bacteria 31276
176 Ga0111539_10006873 3300009094 Bacteria 14615
177 Ga0111539_10039355 3300009094 Bacteria 5700
178 Ga0111539_10044084 3300009094 Bacteria 5345
179 Ga0111539_10186907 3300009094 Bacteria 2419
180 Ga0111539_10315069 3300009094 Bacteria 1821
181 Ga0105245_10035301 3300009098 Bacteria 4437
182 Ga0105247_10100077 3300009101 Bacteria 1852
183 Ga0114129_10000046 3300009147 Bacteria 105492
184 Ga0114129_10004882 3300009147 Bacteria 18919
185 Ga0114129_10033489 3300009147 Bacteria 7261
186 Ga0114129_10087093 3300009147 Bacteria 4332
187 Ga0114129_10245562 3300009147 Bacteria 2405
188 Ga0114129_10285273 3300009147 Bacteria 2205
189 Ga0114129_10503032 3300009147 Bacteria 1582
190 Ga0105241_10032060 3300009174 Bacteria 3936
191 Ga0105248_10771258 3300009177 Bacteria 1085
192 Ga0105237_10142393 3300009545 Bacteria 2392
193 Ga0105238_10006714 3300009551 Bacteria 11481
194 Ga0105238_10171943 3300009551 Bacteria 2143
195 Ga0105249_10447731 3300009553 Bacteria 1330
196 Ga0099796_10002121 3300010159 Bacteria 4262
197 Ga0099796_10008702 3300010159 Bacteria 2715
198 Ga0105239_10219668 3300010375 Bacteria 2131
199 Ga0105239_10286946 3300010375 Bacteria 1853
200 Ga0105239_10412366 3300010375 Bacteria 1530
201 Ga0105246_10118626 3300011119 Bacteria 1957
202 Ga0157373_10216730 3300013100 Bacteria 1350
203 Ga0157371_10270224 3300013102 Bacteria 1227
204 Ga0157370_10018308 3300013104 Bacteria 7046
205 Ga0157370_10092603 3300013104 Bacteria 2837
206 Ga0157370_10150409 3300013104 Bacteria 2166
207 Ga0157370_10157890 3300013104 Bacteria 2110
208 Ga0157370_10265901 3300013104 Bacteria 1585
209 Ga0157370_10471533 3300013104 Bacteria 1154
210 Ga0157369_10129327 3300013105 Bacteria 2676
211 Ga0157369_10150851 3300013105 Bacteria 2456
212 Ga0157369_10320355 3300013105 Bacteria 1612
213 Ga0157378_10174786 3300013297 Bacteria 2016
214 Ga0163162_10281632 3300013306 Bacteria 1795
215 Ga0163162_10894117 3300013306 Bacteria 1002
216 Ga0157372_10372732 3300013307 Bacteria 1663
217 Ga0157372_10515135 3300013307 Bacteria 1394
218 Ga0157372_10674887 3300013307 Bacteria 1203
219 Ga0157375_10186434 3300013308 Bacteria 2228
220 Ga0157375_10210251 3300013308 Bacteria 2103
221 Ga0157375_10401947 3300013308 Bacteria 1536
222 Ga0163163_10334880 3300014325 Bacteria 1568
223 Ga0182008_10093763 3300014497 Bacteria 1481
224 Ga0157379_10293723 3300014968 Bacteria 1480
225 Ga0157379_10322493 3300014968 Bacteria 1410
226 Ga0157376_10363028 3300014969 Bacteria 1389
227 Ga0157376_10427398 3300014969 Bacteria 1287
228 Ga0163161_10282008 3300017792 Bacteria 1303
229 Ga0206356_10212157 3300020070 Bacteria 1215
230 Ga0206354_10778312 3300020081 Bacteria 1476
231 Ga0206353_11570383 3300020082 Bacteria 1797
232 Ga0213876_10142876 3300021384 Bacteria 1273
233 Ga0213875_10000260 3300021388 Bacteria 53076
234 Ga0213875_10003886 3300021388 Bacteria 8360
235 Ga0213875_10007043 3300021388 Bacteria 5847
236 Ga0207697_10089337 3300025315 Bacteria 1305
237 Ga0207653_10002228 3300025885 Bacteria 6178
238 Ga0207682_10005344 3300025893 Bacteria 5243
239 Ga0207699_10170464 3300025906 Bacteria 1456
240 Ga0207643_10078653 3300025908 Bacteria 1908
241 Ga0207705_10015299 3300025909 Bacteria 5507
242 Ga0207705_10078802 3300025909 Bacteria 2398
243 Ga0207684_10060864 3300025910 Bacteria 3207
244 Ga0207684_10447792 3300025910 Bacteria 1109
245 Ga0207654_10143280 3300025911 Bacteria 1526
246 Ga0207707_10001319 3300025912 Bacteria 23057
247 Ga0207707_10025755 3300025912 Bacteria 5144
248 Ga0207707_10048433 3300025912 Bacteria 3702
249 Ga0207707_10234016 3300025912 Bacteria 1598
250 Ga0207695_10065982 3300025913 Bacteria 3719
251 Ga0207695_10097442 3300025913 Bacteria 2942
252 Ga0207693_10005806 3300025915 Bacteria 10238
253 Ga0207693_10010133 3300025915 Bacteria 7656
254 Ga0207693_10029340 3300025915 Bacteria 4346
255 Ga0207663_10086983 3300025916 Bacteria 2063
256 Ga0207663_10088905 3300025916 Bacteria 2044
257 Ga0207663_10198641 3300025916 Bacteria 1445
258 Ga0207660_10016253 3300025917 Bacteria 4925
259 Ga0207660_10034440 3300025917 Bacteria 3511
260 Ga0207660_10073853 3300025917 Bacteria 2487
261 Ga0207662_10122262 3300025918 Bacteria 1633
262 Ga0207657_10028916 3300025919 Bacteria 5049
263 Ga0207657_10056328 3300025919 Bacteria 3392
264 Ga0207657_10075427 3300025919 Bacteria 2846
265 Ga0207649_10026558 3300025920 Bacteria 3388
266 Ga0207649_10317354 3300025920 Bacteria 1144
267 Ga0207652_10019524 3300025921 Bacteria 5575
268 Ga0207652_10025307 3300025921 Bacteria 4932
269 Ga0207652_10101262 3300025921 Bacteria 2544
270 Ga0207652_10159665 3300025921 Bacteria 2021
271 Ga0207646_10007770 3300025922 Bacteria 10851
272 Ga0207681_10126780 3300025923 Bacteria 1881
273 Ga0207681_10261958 3300025923 Bacteria 1354
274 Ga0207694_10049729 3300025924 Bacteria 3245
275 Ga0207694_10393487 3300025924 Bacteria 1152
276 Ga0207659_10031731 3300025926 Bacteria 3620
277 Ga0207659_10191138 3300025926 Bacteria 1629
278 Ga0207687_10117198 3300025927 Bacteria 1986
279 Ga0207700_10034524 3300025928 Bacteria 3632
280 Ga0207700_10089284 3300025928 Bacteria 2429
281 Ga0207700_10438066 3300025928 Bacteria 1150
282 Ga0207664_10060741 3300025929 Bacteria 3013
283 Ga0207664_10074828 3300025929 Bacteria 2737
284 Ga0207644_10068537 3300025931 Bacteria 2588
285 Ga0207690_10138095 3300025932 Bacteria 1793
286 Ga0207690_10236262 3300025932 Bacteria 1406
287 Ga0207706_10060029 3300025933 Bacteria 3349
288 Ga0207706_10086524 3300025933 Bacteria 2755
289 Ga0207709_10232381 3300025935 Bacteria 1336
290 Ga0207670_10096607 3300025936 Bacteria 2102
291 Ga0207670_10209958 3300025936 Bacteria 1484
292 Ga0207670_10210626 3300025936 Bacteria 1482
293 Ga0207670_10230213 3300025936 Bacteria 1423
294 Ga0207704_10118707 3300025938 Bacteria 1805
295 Ga0207665_10221253 3300025939 Bacteria 1387
296 Ga0207691_10032447 3300025940 Bacteria 4868
297 Ga0207689_10152883 3300025942 Bacteria 1902
298 Ga0207661_10046503 3300025944 Bacteria 3441
299 Ga0207661_10411977 3300025944 Bacteria 1227
300 Ga0207667_10120004 3300025949 Bacteria 2709
301 Ga0207667_10283901 3300025949 Bacteria 1691
302 Ga0207651_10230369 3300025960 Bacteria 1503
303 Ga0207668_10208377 3300025972 Bacteria 1562
304 Ga0207668_10309179 3300025972 Bacteria 1307
305 Ga0207640_10058410 3300025981 Bacteria 2541
306 Ga0207640_10307018 3300025981 Bacteria 1258
307 Ga0207677_10187891 3300026023 Bacteria 1631
308 Ga0207703_10090284 3300026035 Bacteria 2575
309 Ga0207678_10001884 3300026067 Bacteria 19130
310 Ga0207708_10003739 3300026075 Bacteria 11224
311 Ga0207708_10120857 3300026075 Bacteria 2041
312 Ga0207702_10024445 3300026078 Bacteria 5013
313 Ga0207702_10300156 3300026078 Bacteria 1524
314 Ga0207641_10147575 3300026088 Bacteria 2128
315 Ga0207676_10088401 3300026095 Bacteria 2536
316 Ga0207676_10127142 3300026095 Bacteria 2160
317 Ga0207674_10022341 3300026116 Bacteria 6793
318 Ga0207674_10069658 3300026116 Bacteria 3537
319 Ga0207674_10241933 3300026116 Bacteria 1751
320 Ga0207674_10567984 3300026116 Bacteria 1096
321 Ga0207675_100192745 3300026118 Bacteria 1955
322 Ga0207675_100436581 3300026118 Bacteria 1295
323 Ga0207683_10012733 3300026121 Bacteria 7178
324 Ga0207683_10054469 3300026121 Bacteria 3508
325 Ga0207683_10287516 3300026121 Bacteria 1503
326 Ga0207698_10075731 3300026142 Bacteria 2691
327 Ga0209179_1023860 3300027512 Bacteria 1210
328 Ga0207428_10019322 3300027907 Bacteria 5810
329 Ga0207428_10028719 3300027907 Bacteria 4618
330 Ga0207428_10052928 3300027907 Bacteria 3239
331 Ga0207428_10114182 3300027907 Bacteria 2076
332 Ga0207428_10322617 3300027907 Bacteria 1140
333 Ga0268265_10028508 3300028380 Bacteria 3997
334 Ga0268264_10009399 3300028381 Bacteria 8096
335 Ga0265337_1001752 3300028556 Bacteria 10466
336 Ga0265334_10069707 3300028573 Bacteria 1312
337 Ga0265338_10036403 3300028800 Bacteria 4710
338 Ga0265338_10074399 3300028800 Bacteria 2890
339 Ga0265338_10238114 3300028800 Bacteria 1349
340 Ga0265330_10102927 3300031235 Bacteria 1222
341 Ga0265320_10015412 3300031240 Bacteria 4323
342 Ga0265325_10040517 3300031241 Bacteria 2446
343 Ga0265325_10049661 3300031241 Bacteria 2164
344 Ga0265340_10007536 3300031247 Bacteria 5905
345 Ga0265340_10025670 3300031247 Bacteria 2983
346 Ga0265340_10054530 3300031247 Bacteria 1927
347 Ga0265316_10129726 3300031344 Bacteria 1900
348 Ga0265313_10000072 3300031595 Bacteria 98635
349 Ga0265313_10019699 3300031595 Bacteria 3745
350 Ga0265313_10056521 3300031595 Bacteria 1856
351 Ga0265313_10082279 3300031595 Bacteria 1459
352 Ga0265314_10201341 3300031711 Bacteria 1177
353 Ga0265342_10000967 3300031712 Bacteria 28523
354 Ga0265342_10010383 3300031712 Bacteria 6467
355 Ga0316578_10126619 3300031728 Bacteria 1536
356 Ga0307516_10003435 3300031730 Bacteria 20328
357 Ga0307406_10162267 3300031901 Bacteria 1608
358 Ga0373938_0054500 3300034957 Bacteria 921
359 Ga0373926_0005171 3300035083 Bacteria 4294
360 Ga0373926_0037385 3300035083 Bacteria 1727
361 Ga0373926_0038503 3300035083 Bacteria 1703
362 Ga0373940_0004575 3300035088 Bacteria 2932
363 Ga0373944_0002817 3300035089 Bacteria 4449
364 Ga0373944_0033527 3300035089 Bacteria 1556
365 Ga0373951_0009973 3300035091 Bacteria 2133
366 Ga0373951_0010563 3300035091 Bacteria 2073
367 Ga0373923_0002586 3300035111 Bacteria 5611
368 Ga0373932_0019444 3300035112 Bacteria 1770
369 Ga0373936_0003046 3300035113 Bacteria 6266
370 Ga0373936_0004461 3300035113 Bacteria 5295
371 Ga0373936_0081654 3300035113 Bacteria 1346
372 Ga0373945_0003549 3300035116 Bacteria 4911
373 Ga0373953_0029970 3300035117 Bacteria 2107
374 Ga0373956_0053530 3300035119 Bacteria 1817
375 Ga0373960_0000695 3300035121 Bacteria 6976
376 Ga0373943_0001175 3300035170 Bacteria 11683
377 Ga0373943_0005962 3300035170 Bacteria 5466
378 Ga0373946_0001839 3300035171 Bacteria 7418
379 Ga0373946_0005047 3300035171 Bacteria 4754
380 Ga0373946_0103909 3300035171 Bacteria 1277
381 Ga0373955_0009829 3300035172 Bacteria 4499
382 Ga0373961_0004319 3300035241 Bacteria 3438
383 Ga0373961_0026344 3300035241 Bacteria 1588
384 Ga0373962_0001927 3300035242 Bacteria 4941
385 Ga0316574_0129562 3300035398 Bacteria 1623
386 Ga0373924_0004572 3300035410 Bacteria 4839
387 Ga0373924_0039008 3300035410 Bacteria 1939
388 Ga0373931_0002305 3300035691 Bacteria 8429
389 Ga0373931_0004386 3300035691 Bacteria 6442
390 Ga0373931_0132908 3300035691 Bacteria 1434
391 Ga0373931_0171358 3300035691 Bacteria 1279
392 Ga0373935_0009258 3300035692 Bacteria 5896
393 Ga0373927_0003390 3300035695 Bacteria 11473
394 Ga0373927_0015255 3300035695 Bacteria 5075
395 Ga0373927_0080454 3300035695 Bacteria 2111
396 Ga0373933_0020500 3300035724 Bacteria 3748
397 Ga0373933_0284552 3300035724 Bacteria 1069
398 Ga0373947_0002304 3300035725 Bacteria 11548
399 Ga0373947_0009093 3300035725 Bacteria 5709
400 Ga0373947_0028389 3300035725 Bacteria 3280
401 Ga0373947_0030011 3300035725 Bacteria 3192
402 Ga0373937_0020502 3300036401 Bacteria 5926
403 Ga0373937_0059136 3300036401 Bacteria 3522
404 Ga0373937_0073983 3300036401 Bacteria 3143
405 Ga0373937_0098834 3300036401 Bacteria 2707
406 Ga0373937_0197153 3300036401 Bacteria 1892
407 Ga0316584_0127547 3300036712 Bacteria 1900
408 Ga0373925_0004310 3300037068 Bacteria 10774
409 Ga0373925_0035922 3300037068 Bacteria 3657
410 Ga0373925_0045382 3300037068 Bacteria 3264
411 Ga0373925_0090664 3300037068 Bacteria 2337
412 Ga0373925_0418292 3300037068 Bacteria 1095
413 Ga0395899_0002731 3300037312 Bacteria 14226
414 Ga0395899_0006845 3300037312 Bacteria 8831
415 Ga0395899_0021301 3300037312 Bacteria 4917
416 Ga0395899_0062591 3300037312 Bacteria 2740
417 Ga0395899_0115862 3300037312 Bacteria 1923
418 Ga0395900_0001600 3300037418 Bacteria 26707
419 Ga0395900_0005733 3300037418 Bacteria 12982
420 Ga0395900_0022448 3300037418 Bacteria 6454
421 Ga0395900_0044347 3300037418 Bacteria 4582
422 Ga0395900_0266930 3300037418 Bacteria 1707
423 Ga0395898_0005925 3300037466 Bacteria 13130
424 Ga0395898_0020777 3300037466 Bacteria 6664
425 Ga0395898_0034553 3300037466 Bacteria 5036
426 Ga0395898_0227133 3300037466 Bacteria 1780
427 Ga0395905_0174455 3300037471 Bacteria 2019
428 Ga0436364_0116589 3300037853 Bacteria 2097
429 Ga0436364_0145275 3300037853 Bacteria 1752
430 Ga0436364_0385201 3300037853 Bacteria 1346
431 Ga0436364_0526342 3300037853 Bacteria 45576
432 Ga0436364_0895513 3300037853 Bacteria 11851
433 Ga0436364_0903421 3300037853 Bacteria 1357
434 Ga0436364_1520677 3300037853 Bacteria 72551
435 Ga0395901_0000429 3300038443 Bacteria 49524
436 Ga0395901_0007979 3300038443 Bacteria 10684
437 Ga0395901_0015180 3300038443 Bacteria 7834
438 Ga0395901_0018478 3300038443 Bacteria 7116
439 Ga0395901_0019992 3300038443 Bacteria 6850
440 Ga0395901_0029957 3300038443 Bacteria 5605
441 Ga0395901_0351507 3300038443 Bacteria 1521
442 Ga0436365_0104220 3300039437 Bacteria 1836
443 Ga0436365_0316081 3300039437 Bacteria 2436
444 Ga0436365_1137389 3300039437 Bacteria 2056
445 Ga0436365_1200977 3300039437 Bacteria 8243
446 Ga0436365_1842035 3300039437 Bacteria 966
447 Ga0436360_0402171 3300039438 Bacteria 4066
448 Ga0436360_0578941 3300039438 Bacteria 1587
449 Ga0436360_0676116 3300039438 Bacteria 1143
450 Ga0436360_0955080 3300039438 Bacteria 1059
451 Ga0436360_1116500 3300039438 Bacteria 1171
452 Ga0436361_0300329 3300039447 Bacteria 2489
453 Ga0436361_0692264 3300039447 Bacteria 1743
454 Ga0436363_1465631 3300039450 Bacteria 1310
455 Ga0436363_1625270 3300039450 Bacteria 2210
456 Ga0436362_0315726 3300039453 Bacteria 1084
457 Ga0436362_0352686 3300039453 Bacteria 1121
458 Ga0436362_0434479 3300039453 Bacteria 2172
459 Ga0436362_0827787 3300039453 Bacteria 4434
460 Ga0439453_0000107 3300041408 Bacteria 6744
461 Ga0451839_0145773 3300041496 Bacteria 904
462 Ga0439460_0015045 3300042461 Bacteria 2042
463 Ga0451577_0143505 3300042876 Bacteria 2146
464 Ga0466966_0136768 3300044684 Bacteria 1498
465 Ga0466963_0020935 3300044694 Bacteria 4120
466 Ga0466963_0196271 3300044694 Bacteria 1411
467 Ga0466963_0251266 3300044694 Bacteria 1241
468 Ga0466957_0199881 3300044842 Bacteria 1312
469 Ga0451576_0000675 3300045051 Bacteria 69506
470 Ga0466967_0019664 3300045976 Bacteria 5437
471 Ga0466967_0031303 3300045976 Bacteria 4477
472 Ga0466967_0335231 3300045976 Bacteria 1461
473 Ga0466967_0436123 3300045976 Bacteria 1279
474 Ga0495592_0010171 3300046454 Bacteria 7093
475 Ga0495592_0034722 3300046454 Bacteria 3800
476 Ga0495592_0056602 3300046454 Bacteria 2897
477 Ga0495603_0031780 3300046455 Bacteria 3178
478 Ga0495603_0215765 3300046455 Bacteria 1107
479 Ga0495629_0000638 3300046459 Bacteria 28357
480 Ga0495629_0072513 3300046459 Bacteria 2403
481 Ga0495641_0011397 3300046461 Bacteria 5069
482 Ga0495651_0016191 3300046462 Bacteria 5775
483 Ga0495653_0036470 3300046463 Bacteria 3872
484 Ga0495653_0049909 3300046463 Bacteria 3220
485 Ga0495580_0005536 3300046472 Bacteria 10420
486 Ga0495580_0077112 3300046472 Bacteria 2324
487 Ga0495580_0096801 3300046472 Bacteria 2052
488 Ga0495582_0001100 3300046473 Bacteria 15170
489 Ga0495582_0020019 3300046473 Bacteria 3660
490 Ga0495639_0008614 3300046475 Bacteria 4374
491 Ga0495639_0027027 3300046475 Bacteria 2539
492 Ga0495639_0029918 3300046475 Bacteria 2419
493 Ga0495662_0005027 3300046476 Bacteria 6627
494 Ga0495662_0005153 3300046476 Bacteria 6551
495 Ga0495664_0007641 3300046477 Bacteria 6009
496 Ga0495584_0015843 3300046491 Bacteria 3846
497 Ga0495585_0001523 3300046492 Bacteria 17996
498 Ga0495607_0007939 3300046501 Bacteria 7296
499 Ga0495583_0083302 3300046506 Bacteria 1387
500 Ga0495608_0068989 3300046511 Bacteria 2311
501 Ga0495608_0129558 3300046511 Bacteria 1615
502 Ga0495618_0006788 3300046514 Bacteria 6933
503 Ga0495618_0014503 3300046514 Bacteria 4802
504 Ga0495628_0046667 3300046516 Bacteria 3440
505 Ga0495644_0008962 3300046523 Bacteria 3847
506 Ga0495663_0001668 3300046525 Bacteria 6926
507 Ga0495666_0006603 3300046526 Bacteria 5834
508 Ga0495666_0024783 3300046526 Bacteria 2964
509 Ga0495652_0105567 3300046529 Bacteria 2276
510 Ga0495652_0155330 3300046529 Bacteria 1782
511 Ga0495640_0012186 3300046533 Bacteria 6582
512 Ga0495640_0041462 3300046533 Bacteria 3216
513 Ga0495640_0099513 3300046533 Bacteria 1910
514 Ga0495586_0016233 3300046535 Bacteria 3961
515 Ga0495586_0025220 3300046535 Bacteria 3180
516 Ga0495586_0078507 3300046535 Bacteria 1811
517 Ga0495586_0151567 3300046535 Bacteria 1304
518 Ga0495598_0039858 3300046537 Bacteria 1368
519 Ga0495645_0003081 3300046543 Bacteria 11294
520 Ga0495622_0006433 3300046557 Bacteria 5449
521 Ga0495633_0014253 3300046558 Bacteria 4163
522 Ga0495667_0011581 3300046559 Bacteria 5971
523 Ga0495667_0027963 3300046559 Bacteria 3797
524 Ga0495667_0132238 3300046559 Bacteria 1609
525 Ga0495667_0183272 3300046559 Bacteria 1343
526 Ga0495656_0000430 3300046615 Bacteria 13659
527 Ga0495634_0019946 3300046642 Bacteria 4757
528 Ga0495634_0090338 3300046642 Bacteria 1990
529 Ga0495611_0034083 3300046648 Bacteria 2249
530 Ga0495635_0003455 3300046663 Bacteria 10914
531 Ga0495635_0005343 3300046663 Bacteria 8938
532 Ga0495635_0007549 3300046663 Bacteria 7588
533 Ga0495659_0014163 3300046664 Bacteria 2607
534 Ga0495661_0033126 3300046665 Bacteria 3261
535 Ga0495588_0007713 3300046674 Bacteria 4913
536 Ga0495599_0009010 3300046678 Bacteria 6080
537 Ga0495599_0015691 3300046678 Bacteria 4701
538 Ga0495646_0006884 3300046680 Bacteria 7212
539 Ga0495647_0002996 3300046681 Bacteria 5372
540 Ga0495647_0014265 3300046681 Bacteria 2765
541 Ga0495647_0050416 3300046681 Bacteria 1615
542 Ga0495658_0018143 3300046683 Bacteria 3651
543 Ga0495658_0020954 3300046683 Bacteria 3440
544 Ga0495658_0076126 3300046683 Bacteria 1960
545 Ga0495613_0004141 3300046689 Bacteria 10852
546 Ga0495613_0060842 3300046689 Bacteria 2765
547 Ga0495624_0014159 3300046690 Bacteria 5421
548 Ga0495624_0050179 3300046690 Bacteria 2644
549 Ga0495670_0003322 3300046691 Bacteria 7925
550 Ga0495600_0010821 3300046809 Bacteria 5673
551 Ga0495600_0052826 3300046809 Bacteria 2653
552 Ga0495581_0007840 3300047315 Bacteria 6185
553 Ga0495604_0011540 3300047317 Bacteria 7021
554 Ga0495604_0109799 3300047317 Bacteria 2013
555 Ga0495604_0153766 3300047317 Bacteria 1632
556 Ga0495604_0211039 3300047317 Bacteria 1342
557 Ga0495636_0029917 3300047318 Bacteria 2225
558 Ga0495674_0181084 3300047319 Bacteria 1755
559 Ga0495676_0011097 3300047321 Bacteria 8139
560 Ga0495676_0316732 3300047321 Bacteria 1049
561 Ga0495680_0024913 3300047322 Bacteria 4955
562 Ga0495680_0036159 3300047322 Bacteria 3968
563 Ga0495680_0061060 3300047322 Bacteria 2901
564 Ga0495680_0165408 3300047322 Bacteria 1604
565 Ga0495675_0139276 3300047444 Bacteria 1505
566 Ga0495675_0201940 3300047444 Bacteria 1210
567 Ga0495685_014537 3300047447 Bacteria 2676
568 Ga0495684_0001718 3300047471 Bacteria 17625
569 Ga0495593_0020976 3300047673 Bacteria 3653
570 Ga0495593_0025825 3300047673 Bacteria 3250
571 Ga0495602_0027551 3300048088 Bacteria 5459
572 Ga0495602_0173718 3300048088 Bacteria 1670
573 Ga0495614_0019787 3300048089 Bacteria 2913
574 Ga0495614_0030805 3300048089 Bacteria 2309
575 Ga0495614_0157074 3300048089 Bacteria 1016
576 Ga0496101_0078596 3300048904 Bacteria 2434
577 Ga0496102_0014135 3300048905 Bacteria 6934
578 Ga0496103_0003279 3300048906 Bacteria 9916
579 Ga0496104_0004397 3300048907 Bacteria 12274
580 Ga0496106_0010010 3300048909 Bacteria 7003
581 Ga0496106_0100932 3300048909 Bacteria 2238
582 Ga0496107_0011687 3300048910 Bacteria 6120
583 Ga0496108_0031916 3300048911 Bacteria 4372
584 Ga0496108_0206649 3300048911 Bacteria 1704
585 Ga0496109_0039276 3300048912 Bacteria 4284
586 Ga0496109_0335941 3300048912 Bacteria 1427
587 Ga0496109_0339657 3300048912 Bacteria 1418
588 Ga0496110_0015700 3300048913 Bacteria 6309
589 Ga0496110_0259011 3300048913 Bacteria 1583
590 Ga0496111_0042961 3300048914 Bacteria 3247
591 Ga0496111_0219923 3300048914 Bacteria 1411
592 Ga0496112_0055697 3300048915 Bacteria 3889
593 Ga0496112_0066526 3300048915 Bacteria 3556
594 Ga0496112_0092739 3300048915 Bacteria 2990
595 Ga0496113_0195580 3300048916 Bacteria 1606
596 Ga0496114_0187506 3300048917 Bacteria 1808
597 Ga0496115_0008543 3300048918 Bacteria 7578
598 Ga0501032_0180058 3300049569 Bacteria 1384
599 Ga0501033_0029001 3300049570 Bacteria 4158
600 Ga0501034_0003452 3300049571 Bacteria 18019
601 Ga0501034_0027189 3300049571 Bacteria 5820
602 Ga0501034_0042042 3300049571 Bacteria 4625
603 Ga0501034_0210238 3300049571 Bacteria 1901
604 Ga0501034_0232738 3300049571 Bacteria 1791
605 Ga0501034_0334565 3300049571 Bacteria 1445
606 Ga0501036_0232941 3300049572 Bacteria 1545
607 Ga0501036_0373634 3300049572 Bacteria 1190
608 Ga0501036_0483360 3300049572 Bacteria 1031
609 Ga0501037_0027842 3300049573 Bacteria 4176
610 Ga0501038_0027208 3300049574 Bacteria 5090
611 Ga0501040_0290414 3300049576 Bacteria 1168
612 Ga0501041_0151500 3300049577 Bacteria 1448
613 Ga0501042_0149949 3300049578 Bacteria 1681
614 Ga0501043_0071673 3300049579 Bacteria 2721
615 Ga0501043_0236165 3300049579 Bacteria 1411
616 Ga0501047_0009754 3300049581 Bacteria 9073
617 Ga0501047_0053270 3300049581 Bacteria 3912
618 Ga0501047_0109884 3300049581 Bacteria 2640
619 Ga0501047_0176078 3300049581 Bacteria 2006
620 Ga0501047_0356132 3300049581 Bacteria 1300
621 Ga0501048_0075508 3300049582 Bacteria 2378
622 Ga0501068_0125672 3300049584 Bacteria 1601
623 Ga0501070_0122015 3300049586 Bacteria 2154
624 Ga0501070_0186026 3300049586 Bacteria 1708
625 Ga0501072_0359913 3300049588 Bacteria 1155
626 Ga0501074_0029336 3300049590 Bacteria 3985
627 Ga0501075_0022440 3300049591 Bacteria 4611
628 Ga0501075_0043764 3300049591 Bacteria 3358
629 Ga0501076_0040238 3300049592 Bacteria 3673
630 Ga0501076_0094688 3300049592 Bacteria 2405
631 Ga0501077_0050610 3300049593 Bacteria 2640
632 Ga0501077_0052446 3300049593 Bacteria 2590
633 Ga0501077_0052689 3300049593 Bacteria 2584
634 Ga0501079_0019130 3300049741 Bacteria 5232
635 Ga0501079_0136768 3300049741 Bacteria 1908
636 Ga0501080_0002904 3300049742 Bacteria 15076
637 Ga0501080_0023639 3300049742 Bacteria 5695
638 Ga0501080_0386885 3300049742 Bacteria 1260
639 Ga0501081_0015181 3300049743 Bacteria 5081
640 Ga0501081_0034497 3300049743 Bacteria 3443
641 Ga0501081_0164499 3300049743 Bacteria 1600
642 Ga0501083_0032944 3300049744 Bacteria 3550
643 Ga0501083_0340059 3300049744 Bacteria 976
644 Ga0501035_0325278 3300049822 Bacteria 1291
645 Ga0501035_0353365 3300049822 Bacteria 1229
646 Ga0501035_0442981 3300049822 Bacteria 1075
647 Ga0501044_0007362 3300049823 Bacteria 12103
648 Ga0501044_0025295 3300049823 Bacteria 6291
649 Ga0501044_0086172 3300049823 Bacteria 3173
650 Ga0501044_0106491 3300049823 Bacteria 2816
651 Ga0501044_0118959 3300049823 Bacteria 2644
652 Ga0501044_0142245 3300049823 Bacteria 2387
653 Ga0501044_0547269 3300049823 Bacteria 1055
654 Ga0501045_0067320 3300049824 Bacteria 2630
655 Ga0501045_0105015 3300049824 Bacteria 2093
656 nmdc:mga0yw44_23515_c1 3300050492 Bacteria 3473
657 nmdc:mga06z11_180160_c1 3300050494 Bacteria 1218
658 nmdc:mga06z11_20011_c1 3300050494 Bacteria 3087
659 nmdc:mga07m45_77674_c1 3300050496 Bacteria 1894
660 nmdc:mga05p37_110140_c1 3300050507 Bacteria 3387
661 nmdc:mga05p37_117666_c1 3300050507 Bacteria 3266
662 nmdc:mga05p37_138_c1 3300050507 Bacteria 67838
663 nmdc:mga05p37_191846_c1 3300050507 Bacteria 2480
664 nmdc:mga05p37_230086_c1 3300050507 Bacteria 2234
665 nmdc:mga05p37_297041_c1 3300050507 Bacteria 1921
666 nmdc:mga05p37_4375_c1 3300050507 Bacteria 16496
667 nmdc:mga05p37_78_c1 3300050507 Bacteria 85760
668 nmdc:mga09592_163595_c1 3300050508 Bacteria 1923
669 nmdc:mga09592_354264_c1 3300050508 Bacteria 1270
670 nmdc:mga09592_3687_c1 3300050508 Bacteria 12351
671 nmdc:mga09592_53145_c1 3300050508 Bacteria 3420
672 nmdc:mga0qj67_99104_c1 3300050509 Bacteria 2348
673 nmdc:mga06r32_156193_c1 3300050510 Bacteria 2263
674 nmdc:mga06r32_2153_c1 3300050510 Bacteria 17616
675 nmdc:mga06r32_21789_c1 3300050510 Bacteria 5916
676 nmdc:mga06r32_2508_c1 3300050510 Bacteria 16424
677 nmdc:mga06r32_471617_c1 3300050510 Bacteria 1234
678 nmdc:mga06r32_52398_c1 3300050510 Bacteria 3908
679 nmdc:mga08y16_213_c1 3300050511 Bacteria 51950
680 nmdc:mga08y16_69001_c1 3300050511 Bacteria 3686
681 nmdc:mga0n895_105888_c1 3300050512 Bacteria 2825
682 nmdc:mga0n895_20973_c1 3300050512 Bacteria 6103
683 nmdc:mga0n895_380926_c1 3300050512 Bacteria 1427
684 nmdc:mga0n895_7191_c1 3300050512 Bacteria 9528
685 nmdc:mga0rr50_171716_c1 3300050513 Bacteria 1767
686 nmdc:mga0rr50_68804_c1 3300050513 Bacteria 2693
687 nmdc:mga0rr50_97712_c1 3300050513 Bacteria 2300
688 nmdc:mga0a205_110255_c1 3300050515 Bacteria 2651
689 nmdc:mga0a205_276909_c1 3300050515 Bacteria 1554
690 nmdc:mga0a205_6920_c1 3300050515 Bacteria 10254
691 nmdc:mga0sz30_36129_c1 3300050516 Bacteria 2064
692 nmdc:mga0sz30_5093_c1 3300050516 Bacteria 4807
693 Ga0495601_0003111 3300053077 Bacteria 9476
694 Ga0495601_0071954 3300053077 Bacteria 2208
695 Ga0495601_0077327 3300053077 Bacteria 2131
696 Ga0495612_0002292 3300053078 Bacteria 7882
697 Ga0495612_0004344 3300053078 Bacteria 5879
698 Ga0495595_0005714 3300053084 Bacteria 5036
699 Ga0495595_0008068 3300053084 Bacteria 4317
700 Ga0495595_0023633 3300053084 Bacteria 2708
701 Ga0495619_0000223 3300053085 Bacteria 41071
702 Ga0495619_0001729 3300053085 Bacteria 14480
703 Ga0495619_0064706 3300053085 Bacteria 2438
704 Ga0500651_0088400 3300053093 Bacteria 1911
705 Ga0500651_0166113 3300053093 Bacteria 1318
706 Ga0500658_0120425 3300053134 Bacteria 1163
707 Ga0500577_0064611 3300053142 Bacteria 1418
708 Ga0500552_000273 3300053733 Bacteria 4701
709 Ga0501084_0019613 3300054114 Bacteria 5634
710 Ga0501084_0274407 3300054114 Bacteria 1424
711 Ga0501082_0023575 3300060353 Bacteria 5309
712 Ga0501082_0068125 3300060353 Bacteria 3065
713 Ga0501082_0348559 3300060353 Bacteria 1291
714 Ga0466962_0071106 3300061719 Bacteria 1662
715 Ga0530510_0011545 3300061734 Bacteria 6199
716 Ga0530510_0035846 3300061734 Bacteria 3576
717 Ga0070679_100557253
718 JGI25405J52794_10026516
719 Ga0070658_10017198
720 Ga0070658_10171930
721 Ga0070676_10158414
722 Ga0070683_100029557
723 Ga0070683_100394748
724 Ga0070690_100197305
725 Ga0070690_100267384
726 Ga0070670_100040839
727 Ga0070677_10001609
728 Ga0068869_100136685
729 Ga0070680_100002886
730 Ga0070680_100011772
731 Ga0070680_100051806
732 Ga0070680_100096361
733 Ga0070682_100357013
734 Ga0070660_100074621
735 Ga0070660_100129486
736 Ga0070689_100013138
737 Ga0070689_100097445
738 Ga0070689_100098064
739 Ga0070689_100439219
740 Ga0070691_10065208
741 Ga0070691_10088336
742 Ga0070661_100232739
743 Ga0070668_100270541
744 Ga0070669_100152023
745 Ga0070669_100214859
746 Ga0070675_100260770
747 Ga0070671_100032209
748 Ga0070671_100089838
749 Ga0070674_100187799
750 Ga0070673_100018404
751 Ga0070673_100163667
752 Ga0070688_100141533
753 Ga0070667_100054564
754 Ga0070703_10000658
755 Ga0070709_10231397
756 Ga0070714_100012871
757 Ga0070714_100101401
758 Ga0070714_100210811
759 Ga0070714_100266767
760 Ga0070713_100037033
761 Ga0070710_10020297
762 Ga0070710_10043648
763 Ga0070711_100004964
764 Ga0070711_100034193
765 Ga0070711_100126099
766 Ga0070711_100330470
767 Ga0070711_100376070
768 Ga0070705_100001567
769 Ga0070700_100002835
770 Ga0070694_100001861
771 Ga0070694_100078343
772 Ga0070694_100101801
773 Ga0070708_100009609
774 Ga0070708_100059373
775 Ga0070708_100115184
776 Ga0070663_100010612
777 Ga0070662_100066354
778 Ga0070662_100283649
779 Ga0070681_10028221
780 Ga0070681_10079503
781 Ga0070681_10165438
782 Ga0070681_10212101
783 Ga0070681_10309555
784 Ga0068867_100495829
785 Ga0070685_10137839
786 Ga0070706_100015250
787 Ga0070706_100073305
788 Ga0070706_100450996
789 Ga0070707_100005247
790 Ga0070698_100010836
791 Ga0070698_100034391
792 Ga0070698_100103477
793 Ga0070699_100001809
794 Ga0070699_100035808
795 Ga0070679_100016104
796 Ga0070679_100065173
797 Ga0070679_100128428
798 Ga0070679_100154519
799 Ga0070679_100216724
800 Ga0070679_100236159
801 Ga0070679_100411213
802 Ga0070684_100128533
803 Ga0070684_100215451
804 Ga0070684_100255617
805 Ga0070697_100037104
806 Ga0070697_100548460
807 Ga0070672_100031006
808 Ga0070686_100022255
809 Ga0070695_100002503
810 Ga0070695_100002758
811 Ga0070695_100006285
812 Ga0070696_100000856
813 Ga0070696_100071663
814 Ga0070665_100096839
815 Ga0070665_100299408
816 Ga0070704_100001546
817 Ga0068855_100060402
818 Ga0068855_100062919
819 Ga0068855_100075946
820 Ga0068855_100105233
821 Ga0068855_100116892
822 Ga0070664_100037187
823 Ga0068857_100014790
824 Ga0068856_100510236
825 Ga0068859_100010838
826 Ga0068859_100408400
827 Ga0068864_100061543
828 Ga0068861_100090836
829 Ga0068863_100105321
830 Ga0068863_100163612
831 Ga0068863_100564344
832 Ga0068858_100274109
833 Ga0068858_100589654
834 Ga0068860_100007974
835 Ga0068860_100453754
836 Ga0068862_100001949
837 Ga0081455_10000028
838 Ga0081455_10015266
839 Ga0081455_10021303
840 Ga0081455_10042620
841 Ga0081540_1000060
842 Ga0081540_1001601
843 Ga0081539_10001404
844 Ga0070717_10000126
845 Ga0070717_10236886
846 Ga0075365_10171005
847 Ga0070716_100172192
848 Ga0070712_100021092
849 Ga0070712_100054632
850 Ga0075367_10287722
851 Ga0075369_10008376
852 Ga0075369_10109248
853 Ga0075428_100004129
854 Ga0075428_100036965
855 Ga0075428_100040742
856 Ga0075428_100047986
857 Ga0075428_100073285
858 Ga0075428_100143626
859 Ga0075428_100265793
860 Ga0075430_100344675
861 Ga0075430_100344676
862 Ga0075431_100000892
863 Ga0075431_100002871
864 Ga0075431_100004613
865 Ga0075431_100023536
866 Ga0075431_100025814
867 Ga0075431_100474531
868 Ga0075431_100665970
869 Ga0075433_10006579
870 Ga0075433_10150318
871 Ga0075433_10258365
872 Ga0075434_100013013
873 Ga0075434_100047342
874 Ga0075429_100003443
875 Ga0075429_100004645
876 Ga0075429_100072356
877 Ga0075429_100356905
878 Ga0075436_100049389
879 Ga0075436_100071214
880 Ga0075436_100111442
881 Ga0097620_100010838
882 Ga0097620_100408432
883 Ga0075435_100044118
884 Ga0075435_100105807
885 Ga0099795_10009499
886 Ga0099795_10044212
887 Ga0105240_10051553
888 Ga0105240_10057145
889 Ga0105240_10175545
890 Ga0105240_10416355
891 Ga0111539_10001490
892 Ga0111539_10006873
893 Ga0111539_10039355
894 Ga0111539_10044084
895 Ga0111539_10186907
896 Ga0111539_10315069
897 Ga0105245_10035301
898 Ga0105247_10100077
899 Ga0114129_10000046
900 Ga0114129_10004882
901 Ga0114129_10033489
902 Ga0114129_10087093
903 Ga0114129_10245562
904 Ga0114129_10285273
905 Ga0114129_10503032
906 Ga0105241_10032060
907 Ga0105248_10771258
908 Ga0105237_10142393
909 Ga0105238_10006714
910 Ga0105238_10171943
911 Ga0105249_10447731
912 Ga0099796_10002121
913 Ga0099796_10008702
914 Ga0105239_10219668
915 Ga0105239_10286946
916 Ga0105239_10412366
917 Ga0105246_10118626
918 Ga0157373_10216730
919 Ga0157371_10270224
920 Ga0157370_10018308
921 Ga0157370_10092603
922 Ga0157370_10150409
923 Ga0157370_10157890
924 Ga0157370_10265901
925 Ga0157370_10471533
926 Ga0157369_10129327
927 Ga0157369_10150851
928 Ga0157369_10320355
929 Ga0157378_10174786
930 Ga0163162_10281632
931 Ga0163162_10894117
932 Ga0157372_10372732
933 Ga0157372_10515135
934 Ga0157372_10674887
935 Ga0157375_10186434
936 Ga0157375_10210251
937 Ga0157375_10401947
938 Ga0163163_10334880
939 Ga0182008_10093763
940 Ga0157379_10293723
941 Ga0157379_10322493
942 Ga0157376_10363028
943 Ga0157376_10427398
944 Ga0163161_10282008
945 Ga0206356_10212157
946 Ga0206354_10778312
947 Ga0206353_11570383
948 Ga0213876_10142876
949 Ga0213875_10000260
950 Ga0213875_10003886
951 Ga0213875_10007043
952 Ga0207697_10089337
953 Ga0207653_10002228
954 Ga0207682_10005344
955 Ga0207699_10170464
956 Ga0207643_10078653
957 Ga0207705_10015299
958 Ga0207705_10078802
959 Ga0207684_10060864
960 Ga0207684_10447792
961 Ga0207654_10143280
962 Ga0207707_10001319
963 Ga0207707_10025755
964 Ga0207707_10048433
965 Ga0207707_10234016
966 Ga0207695_10065982
967 Ga0207695_10097442
968 Ga0207693_10005806
969 Ga0207693_10010133
970 Ga0207693_10029340
971 Ga0207663_10086983
972 Ga0207663_10088905
973 Ga0207663_10198641
974 Ga0207660_10016253
975 Ga0207660_10034440
976 Ga0207660_10073853
977 Ga0207662_10122262
978 Ga0207657_10028916
979 Ga0207657_10056328
980 Ga0207657_10075427
981 Ga0207649_10026558
982 Ga0207649_10317354
983 Ga0207652_10019524
984 Ga0207652_10025307
985 Ga0207652_10101262
986 Ga0207652_10159665
987 Ga0207646_10007770
988 Ga0207681_10126780
989 Ga0207681_10261958
990 Ga0207694_10049729
991 Ga0207694_10393487
992 Ga0207659_10031731
993 Ga0207659_10191138
994 Ga0207687_10117198
995 Ga0207700_10034524
996 Ga0207700_10089284
997 Ga0207700_10438066
998 Ga0207664_10060741
999 Ga0207664_10074828
1000 Ga0207644_10068537
1001 Ga0207690_10138095
1002 Ga0207690_10236262
1003 Ga0207706_10060029
1004 Ga0207706_10086524
1005 Ga0207709_10232381
1006 Ga0207670_10096607
1007 Ga0207670_10209958
1008 Ga0207670_10210626
1009 Ga0207670_10230213
1010 Ga0207704_10118707
1011 Ga0207665_10221253
1012 Ga0207691_10032447
1013 Ga0207689_10152883
1014 Ga0207661_10046503
1015 Ga0207661_10411977
1016 Ga0207667_10120004
1017 Ga0207667_10283901
1018 Ga0207651_10230369
1019 Ga0207668_10208377
1020 Ga0207668_10309179
1021 Ga0207640_10058410
1022 Ga0207640_10307018
1023 Ga0207677_10187891
1024 Ga0207703_10090284
1025 Ga0207678_10001884
1026 Ga0207708_10003739
1027 Ga0207708_10120857
1028 Ga0207702_10024445
1029 Ga0207702_10300156
1030 Ga0207641_10147575
1031 Ga0207676_10088401
1032 Ga0207676_10127142
1033 Ga0207674_10022341
1034 Ga0207674_10069658
1035 Ga0207674_10241933
1036 Ga0207674_10567984
1037 Ga0207675_100192745
1038 Ga0207675_100436581
1039 Ga0207683_10012733
1040 Ga0207683_10054469
1041 Ga0207683_10287516
1042 Ga0207698_10075731
1043 Ga0209179_1023860
1044 Ga0207428_10019322
1045 Ga0207428_10028719
1046 Ga0207428_10052928
1047 Ga0207428_10114182
1048 Ga0207428_10322617
1049 Ga0268265_10028508
1050 Ga0268264_10009399
1051 Ga0265337_1001752
1052 Ga0265334_10069707
1053 Ga0265338_10036403
1054 Ga0265338_10074399
1055 Ga0265338_10238114
1056 Ga0265330_10102927
1057 Ga0265320_10015412
1058 Ga0265325_10040517
1059 Ga0265325_10049661
1060 Ga0265340_10007536
1061 Ga0265340_10025670
1062 Ga0265340_10054530
1063 Ga0265316_10129726
1064 Ga0265313_10000072
1065 Ga0265313_10019699
1066 Ga0265313_10056521
1067 Ga0265313_10082279
1068 Ga0265314_10201341
1069 Ga0265342_10000967
1070 Ga0265342_10010383
1071 Ga0316578_10126619
1072 Ga0307516_10003435
1073 Ga0307406_10162267
1074 Ga0373938_0054500
1075 Ga0373926_0005171
1076 Ga0373926_0037385
1077 Ga0373926_0038503
1078 Ga0373940_0004575
1079 Ga0373944_0002817
1080 Ga0373944_0033527
1081 Ga0373951_0009973
1082 Ga0373951_0010563
1083 Ga0373923_0002586
1084 Ga0373932_0019444
1085 Ga0373936_0003046
1086 Ga0373936_0004461
1087 Ga0373936_0081654
1088 Ga0373945_0003549
1089 Ga0373953_0029970
1090 Ga0373956_0053530
1091 Ga0373960_0000695
1092 Ga0373943_0001175
1093 Ga0373943_0005962
1094 Ga0373946_0001839
1095 Ga0373946_0005047
1096 Ga0373946_0103909
1097 Ga0373955_0009829
1098 Ga0373961_0004319
1099 Ga0373961_0026344
1100 Ga0373962_0001927
1101 Ga0316574_0129562
1102 Ga0373924_0004572
1103 Ga0373924_0039008
1104 Ga0373931_0002305
1105 Ga0373931_0004386
1106 Ga0373931_0132908
1107 Ga0373931_0171358
1108 Ga0373935_0009258
1109 Ga0373927_0003390
1110 Ga0373927_0015255
1111 Ga0373927_0080454
1112 Ga0373933_0020500
1113 Ga0373933_0284552
1114 Ga0373947_0002304
1115 Ga0373947_0009093
1116 Ga0373947_0028389
1117 Ga0373947_0030011
1118 Ga0373937_0020502
1119 Ga0373937_0059136
1120 Ga0373937_0073983
1121 Ga0373937_0098834
1122 Ga0373937_0197153
1123 Ga0316584_0127547
1124 Ga0373925_0004310
1125 Ga0373925_0035922
1126 Ga0373925_0045382
1127 Ga0373925_0090664
1128 Ga0373925_0418292
1129 Ga0395899_0002731
1130 Ga0395899_0006845
1131 Ga0395899_0021301
1132 Ga0395899_0062591
1133 Ga0395899_0115862
1134 Ga0395900_0001600
1135 Ga0395900_0005733
1136 Ga0395900_0022448
1137 Ga0395900_0044347
1138 Ga0395900_0266930
1139 Ga0395898_0005925
1140 Ga0395898_0020777
1141 Ga0395898_0034553
1142 Ga0395898_0227133
1143 Ga0395905_0174455
1144 Ga0436364_0116589
1145 Ga0436364_0145275
1146 Ga0436364_0385201
1147 Ga0436364_0526342
1148 Ga0436364_0895513
1149 Ga0436364_0903421
1150 Ga0436364_1520677
1151 Ga0395901_0000429
1152 Ga0395901_0007979
1153 Ga0395901_0015180
1154 Ga0395901_0018478
1155 Ga0395901_0019992
1156 Ga0395901_0029957
1157 Ga0395901_0351507
1158 Ga0436365_0104220
1159 Ga0436365_0316081
1160 Ga0436365_1137389
1161 Ga0436365_1200977
1162 Ga0436365_1842035
1163 Ga0436360_0402171
1164 Ga0436360_0578941
1165 Ga0436360_0676116
1166 Ga0436360_0955080
1167 Ga0436360_1116500
1168 Ga0436361_0300329
1169 Ga0436361_0692264
1170 Ga0436363_1465631
1171 Ga0436363_1625270
1172 Ga0436362_0315726
1173 Ga0436362_0352686
1174 Ga0436362_0434479
1175 Ga0436362_0827787
1176 Ga0439453_0000107
1177 Ga0451839_0145773
1178 Ga0439460_0015045
1179 Ga0451577_0143505
1180 Ga0466966_0136768
1181 Ga0466963_0020935
1182 Ga0466963_0196271
1183 Ga0466963_0251266
1184 Ga0466957_0199881
1185 Ga0451576_0000675
1186 Ga0466967_0019664
1187 Ga0466967_0031303
1188 Ga0466967_0335231
1189 Ga0466967_0436123
1190 Ga0495592_0010171
1191 Ga0495592_0034722
1192 Ga0495592_0056602
1193 Ga0495603_0031780
1194 Ga0495603_0215765
1195 Ga0495629_0000638
1196 Ga0495629_0072513
1197 Ga0495641_0011397
1198 Ga0495651_0016191
1199 Ga0495653_0036470
1200 Ga0495653_0049909
1201 Ga0495580_0005536
1202 Ga0495580_0077112
1203 Ga0495580_0096801
1204 Ga0495582_0001100
1205 Ga0495582_0020019
1206 Ga0495639_0008614
1207 Ga0495639_0027027
1208 Ga0495639_0029918
1209 Ga0495662_0005027
1210 Ga0495662_0005153
1211 Ga0495664_0007641
1212 Ga0495584_0015843
1213 Ga0495585_0001523
1214 Ga0495607_0007939
1215 Ga0495583_0083302
1216 Ga0495608_0068989
1217 Ga0495608_0129558
1218 Ga0495618_0006788
1219 Ga0495618_0014503
1220 Ga0495628_0046667
1221 Ga0495644_0008962
1222 Ga0495663_0001668
1223 Ga0495666_0006603
1224 Ga0495666_0024783
1225 Ga0495652_0105567
1226 Ga0495652_0155330
1227 Ga0495640_0012186
1228 Ga0495640_0041462
1229 Ga0495640_0099513
1230 Ga0495586_0016233
1231 Ga0495586_0025220
1232 Ga0495586_0078507
1233 Ga0495586_0151567
1234 Ga0495598_0039858
1235 Ga0495645_0003081
1236 Ga0495622_0006433
1237 Ga0495633_0014253
1238 Ga0495667_0011581
1239 Ga0495667_0027963
1240 Ga0495667_0132238
1241 Ga0495667_0183272
1242 Ga0495656_0000430
1243 Ga0495634_0019946
1244 Ga0495634_0090338
1245 Ga0495611_0034083
1246 Ga0495635_0003455
1247 Ga0495635_0005343
1248 Ga0495635_0007549
1249 Ga0495659_0014163
1250 Ga0495661_0033126
1251 Ga0495588_0007713
1252 Ga0495599_0009010
1253 Ga0495599_0015691
1254 Ga0495646_0006884
1255 Ga0495647_0002996
1256 Ga0495647_0014265
1257 Ga0495647_0050416
1258 Ga0495658_0018143
1259 Ga0495658_0020954
1260 Ga0495658_0076126
1261 Ga0495613_0004141
1262 Ga0495613_0060842
1263 Ga0495624_0014159
1264 Ga0495624_0050179
1265 Ga0495670_0003322
1266 Ga0495600_0010821
1267 Ga0495600_0052826
1268 Ga0495581_0007840
1269 Ga0495604_0011540
1270 Ga0495604_0109799
1271 Ga0495604_0153766
1272 Ga0495604_0211039
1273 Ga0495636_0029917
1274 Ga0495674_0181084
1275 Ga0495676_0011097
1276 Ga0495676_0316732
1277 Ga0495680_0024913
1278 Ga0495680_0036159
1279 Ga0495680_0061060
1280 Ga0495680_0165408
1281 Ga0495675_0139276
1282 Ga0495675_0201940
1283 Ga0495685_014537
1284 Ga0495684_0001718
1285 Ga0495593_0020976
1286 Ga0495593_0025825
1287 Ga0495602_0027551
1288 Ga0495602_0173718
1289 Ga0495614_0019787
1290 Ga0495614_0030805
1291 Ga0495614_0157074
1292 Ga0496101_0078596
1293 Ga0496102_0014135
1294 Ga0496103_0003279
1295 Ga0496104_0004397
1296 Ga0496106_0010010
1297 Ga0496106_0100932
1298 Ga0496107_0011687
1299 Ga0496108_0031916
1300 Ga0496108_0206649
1301 Ga0496109_0039276
1302 Ga0496109_0335941
1303 Ga0496109_0339657
1304 Ga0496110_0015700
1305 Ga0496110_0259011
1306 Ga0496111_0042961
1307 Ga0496111_0219923
1308 Ga0496112_0055697
1309 Ga0496112_0066526
1310 Ga0496112_0092739
1311 Ga0496113_0195580
1312 Ga0496114_0187506
1313 Ga0496115_0008543
1314 Ga0501032_0180058
1315 Ga0501033_0029001
1316 Ga0501034_0003452
1317 Ga0501034_0027189
1318 Ga0501034_0042042
1319 Ga0501034_0210238
1320 Ga0501034_0232738
1321 Ga0501034_0334565
1322 Ga0501036_0232941
1323 Ga0501036_0373634
1324 Ga0501036_0483360
1325 Ga0501037_0027842
1326 Ga0501038_0027208
1327 Ga0501040_0290414
1328 Ga0501041_0151500
1329 Ga0501042_0149949
1330 Ga0501043_0071673
1331 Ga0501043_0236165
1332 Ga0501047_0009754
1333 Ga0501047_0053270
1334 Ga0501047_0109884
1335 Ga0501047_0176078
1336 Ga0501047_0356132
1337 Ga0501048_0075508
1338 Ga0501068_0125672
1339 Ga0501070_0122015
1340 Ga0501070_0186026
1341 Ga0501072_0359913
1342 Ga0501074_0029336
1343 Ga0501075_0022440
1344 Ga0501075_0043764
1345 Ga0501076_0040238
1346 Ga0501076_0094688
1347 Ga0501077_0050610
1348 Ga0501077_0052446
1349 Ga0501077_0052689
1350 Ga0501079_0019130
1351 Ga0501079_0136768
1352 Ga0501080_0002904
1353 Ga0501080_0023639
1354 Ga0501080_0386885
1355 Ga0501081_0015181
1356 Ga0501081_0034497
1357 Ga0501081_0164499
1358 Ga0501083_0032944
1359 Ga0501083_0340059
1360 Ga0501035_0325278
1361 Ga0501035_0353365
1362 Ga0501035_0442981
1363 Ga0501044_0007362
1364 Ga0501044_0025295
1365 Ga0501044_0086172
1366 Ga0501044_0106491
1367 Ga0501044_0118959
1368 Ga0501044_0142245
1369 Ga0501044_0547269
1370 Ga0501045_0067320
1371 Ga0501045_0105015
1372 nmdc:mga0yw44_23515_c1
1373 nmdc:mga06z11_180160_c1
1374 nmdc:mga06z11_20011_c1
1375 nmdc:mga07m45_77674_c1
1376 nmdc:mga05p37_110140_c1
1377 nmdc:mga05p37_117666_c1
1378 nmdc:mga05p37_138_c1
1379 nmdc:mga05p37_191846_c1
1380 nmdc:mga05p37_230086_c1
1381 nmdc:mga05p37_297041_c1
1382 nmdc:mga05p37_4375_c1
1383 nmdc:mga05p37_78_c1
1384 nmdc:mga09592_163595_c1
1385 nmdc:mga09592_354264_c1
1386 nmdc:mga09592_3687_c1
1387 nmdc:mga09592_53145_c1
1388 nmdc:mga0qj67_99104_c1
1389 nmdc:mga06r32_156193_c1
1390 nmdc:mga06r32_2153_c1
1391 nmdc:mga06r32_21789_c1
1392 nmdc:mga06r32_2508_c1
1393 nmdc:mga06r32_471617_c1
1394 nmdc:mga06r32_52398_c1
1395 nmdc:mga08y16_213_c1
1396 nmdc:mga08y16_69001_c1
1397 nmdc:mga0n895_105888_c1
1398 nmdc:mga0n895_20973_c1
1399 nmdc:mga0n895_380926_c1
1400 nmdc:mga0n895_7191_c1
1401 nmdc:mga0rr50_171716_c1
1402 nmdc:mga0rr50_68804_c1
1403 nmdc:mga0rr50_97712_c1
1404 nmdc:mga0a205_110255_c1
1405 nmdc:mga0a205_276909_c1
1406 nmdc:mga0a205_6920_c1
1407 nmdc:mga0sz30_36129_c1
1408 nmdc:mga0sz30_5093_c1
1409 Ga0495601_0003111
1410 Ga0495601_0071954
1411 Ga0495601_0077327
1412 Ga0495612_0002292
1413 Ga0495612_0004344
1414 Ga0495595_0005714
1415 Ga0495595_0008068
1416 Ga0495595_0023633
1417 Ga0495619_0000223
1418 Ga0495619_0001729
1419 Ga0495619_0064706
1420 Ga0500651_0088400
1421 Ga0500651_0166113
1422 Ga0500658_0120425
1423 Ga0500577_0064611
1424 Ga0500552_000273
1425 Ga0501084_0019613
1426 Ga0501084_0274407
1427 Ga0501082_0023575
1428 Ga0501082_0068125
1429 Ga0501082_0348559
1430 Ga0466962_0071106
1431 Ga0530510_0011545
1432 Ga0530510_0035846

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

108

297

0.95

PF12911

OppC_N

N-terminal TM domain of oligopeptide transport permease C

19

71

0.87

Map