F477022
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 715 | 352 | 1430 | 144 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|8056447290|8056453216 |
| Length | 174 |
| Sequence | GIAPMAVRPYRPIAQHTFRGRRPGRFRHPLEDRMATTRTAHTVWEGELLKGSGTVTFDSSGIGSQPVSWPSRAEQANGKTSPEELIAAAHSSCFSMALSHGLTGAGTPPTRLETKADVTFQPGEGITGIHLWVRGEVPGLDEAGFAAAAEDAKKNCPVSQALAGTTITLSAELA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 2 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 3 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 4 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 5 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 6 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 19 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 20 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 21 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 22 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 24 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 25 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 26 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 27 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 28 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 29 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 30 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 31 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 32 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 33 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 34 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 35 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 36 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 37 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 38 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 39 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 40 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 41 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 42 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 63 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 66 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 67 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 68 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 69 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 70 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 71 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 72 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 73 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 102 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 103 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 104 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 105 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 106 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 107 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 108 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 109 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 110 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 111 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 112 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 113 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 114 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 115 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 116 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 117 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 118 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 119 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 120 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 121 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 122 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 123 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 124 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 125 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 126 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 127 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 128 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 129 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 130 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 131 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 132 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 133 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 134 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 135 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 136 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 137 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 138 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 139 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 140 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 141 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 142 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 143 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 144 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 145 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 146 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 147 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 148 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 149 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 150 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 151 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 152 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 153 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 154 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 155 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 156 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 157 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 158 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 159 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 160 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 161 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 162 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 163 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 164 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 165 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 166 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 167 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 168 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 169 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 170 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 171 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 172 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 173 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 174 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 175 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 247 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 248 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 249 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 250 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 251 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 252 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 253 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 254 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 255 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 256 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 257 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 258 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 259 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 260 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 263 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 264 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 265 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 266 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 267 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 294 | 3300049659 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control | Metagenome | Rhizosphere |
| 295 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 303 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 304 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 305 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 306 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 307 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 315 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 316 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 318 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 319 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 320 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 321 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 322 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 323 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 324 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 327 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 328 | 8056447290 | Streptomyces huiliensis SCA2-4 | Isolate | Rhizosphere |
| 329 | 2547132111 | Streptomyces sp. TOR3209 | Isolate | Rhizosphere |
| 330 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 331 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 332 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 333 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 334 | 2758568621 | Promicromonospora sukumoe SAI-064 | Isolate | Unclassified |
| 335 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 336 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 337 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 338 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 339 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 340 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 341 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 342 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 343 | 2866552031 | Saccharopolyspora rhizosphaerae H219 | Isolate | Unclassified |
| 344 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 345 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 346 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 347 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 348 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 349 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
| 350 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 351 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 352 | 8056579771 | Promicromonospora iranensis UTMC 00792 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.69 |
| Metatranscriptomes | 1.82 |
| Isolates | 3.5 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.64 |
| Nodule | 0.14 |
| Rhizoplane | 3.92 |
| Rhizosphere | 83.92 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10018725 | 3300001989 | Bacteria | 2485 |
| 2 | JGI24737J22298_10019421 | 3300001990 | Bacteria | 2173 |
| 3 | JGI24735J21928_10036069 | 3300002067 | Bacteria | 1451 |
| 4 | rootH1_10031179 | 3300003323 | Bacteria | 3995 |
| 5 | rootH1_10094779 | 3300003323 | Bacteria | 3533 |
| 6 | JGI25160J50197_1031211 | 3300003354 | Bacteria | 1376 |
| 7 | Ga0006562J51391_1142362 | 3300003578 | Bacteria | 4020 |
| 8 | Ga0006562J51391_1142363 | 3300003578 | Bacteria | 3480 |
| 9 | Ga0070658_10006816 | 3300005327 | Bacteria | 9238 |
| 10 | Ga0070658_11400518 | 3300005327 | Bacteria | 607 |
| 11 | Ga0070682_100898267 | 3300005337 | Bacteria | 728 |
| 12 | Ga0070660_100145701 | 3300005339 | Bacteria | 1902 |
| 13 | Ga0070668_102267272 | 3300005347 | Bacteria | 502 |
| 14 | Ga0070663_100006719 | 3300005455 | Bacteria | 6941 |
| 15 | Ga0070678_100235924 | 3300005456 | Bacteria | 1527 |
| 16 | Ga0070681_10249695 | 3300005458 | Bacteria | 1687 |
| 17 | Ga0070679_100121308 | 3300005530 | Bacteria | 2599 |
| 18 | Ga0070684_100456967 | 3300005535 | Bacteria | 1181 |
| 19 | Ga0070672_100304735 | 3300005543 | Bacteria | 1351 |
| 20 | Ga0070672_100431400 | 3300005543 | Bacteria | 1133 |
| 21 | Ga0070665_100217143 | 3300005548 | Bacteria | 1913 |
| 22 | Ga0068855_100011209 | 3300005563 | Bacteria | 10824 |
| 23 | Ga0068855_100277355 | 3300005563 | Bacteria | 1863 |
| 24 | Ga0068855_100476585 | 3300005563 | Bacteria | 1359 |
| 25 | Ga0068857_100330486 | 3300005577 | Bacteria | 1409 |
| 26 | Ga0068854_100278884 | 3300005578 | Bacteria | 1345 |
| 27 | Ga0068854_101339888 | 3300005578 | Bacteria | 645 |
| 28 | Ga0068856_100158735 | 3300005614 | Bacteria | 2272 |
| 29 | Ga0068856_101992018 | 3300005614 | Bacteria | 591 |
| 30 | Ga0070702_100539194 | 3300005615 | Bacteria | 864 |
| 31 | Ga0068852_100038532 | 3300005616 | Bacteria | 4018 |
| 32 | Ga0068852_100398373 | 3300005616 | Bacteria | 1354 |
| 33 | Ga0068864_101518123 | 3300005618 | Bacteria | 673 |
| 34 | Ga0068864_102146298 | 3300005618 | Bacteria | 565 |
| 35 | Ga0068870_10716809 | 3300005840 | Bacteria | 692 |
| 36 | Ga0068858_101063366 | 3300005842 | Bacteria | 794 |
| 37 | Ga0081455_10003247 | 3300005937 | Bacteria | 18828 |
| 38 | Ga0081455_10041478 | 3300005937 | Bacteria | 4046 |
| 39 | Ga0081538_10088414 | 3300005981 | Bacteria | 1613 |
| 40 | Ga0081540_1253589 | 3300005983 | Bacteria | 613 |
| 41 | Ga0075365_10079090 | 3300006038 | Bacteria | 2225 |
| 42 | Ga0075365_10427871 | 3300006038 | Bacteria | 935 |
| 43 | Ga0075368_10069160 | 3300006042 | Bacteria | 1424 |
| 44 | Ga0075363_100015288 | 3300006048 | Bacteria | 3770 |
| 45 | Ga0075367_10006132 | 3300006178 | Bacteria | 6047 |
| 46 | Ga0097621_100560374 | 3300006237 | Bacteria | 1041 |
| 47 | Ga0075370_10338190 | 3300006353 | Bacteria | 898 |
| 48 | Ga0068871_101346987 | 3300006358 | Bacteria | 672 |
| 49 | Ga0075428_100035302 | 3300006844 | Bacteria | 5512 |
| 50 | Ga0075428_101014707 | 3300006844 | Bacteria | 878 |
| 51 | Ga0075430_100675812 | 3300006846 | Bacteria | 851 |
| 52 | Ga0075431_100089619 | 3300006847 | Bacteria | 3175 |
| 53 | Ga0075431_100668612 | 3300006847 | Bacteria | 1018 |
| 54 | Ga0075431_100773012 | 3300006847 | Bacteria | 935 |
| 55 | Ga0075429_100011346 | 3300006880 | Bacteria | 7714 |
| 56 | Ga0075429_100138821 | 3300006880 | Bacteria | 2128 |
| 57 | Ga0075429_100304205 | 3300006880 | Bacteria | 1396 |
| 58 | Ga0075435_101976435 | 3300007076 | Bacteria | 512 |
| 59 | Ga0105251_10011492 | 3300009011 | Bacteria | 5055 |
| 60 | Ga0105244_10525261 | 3300009036 | Bacteria | 545 |
| 61 | Ga0105240_10019389 | 3300009093 | Bacteria | 9087 |
| 62 | Ga0105240_10500753 | 3300009093 | Bacteria | 1351 |
| 63 | Ga0111539_10706666 | 3300009094 | Bacteria | 1173 |
| 64 | Ga0111539_12068344 | 3300009094 | Bacteria | 661 |
| 65 | Ga0105245_10252623 | 3300009098 | Bacteria | 1713 |
| 66 | Ga0105245_10423681 | 3300009098 | Bacteria | 1334 |
| 67 | Ga0105247_10187324 | 3300009101 | Bacteria | 1384 |
| 68 | Ga0114129_10052243 | 3300009147 | Bacteria | 5736 |
| 69 | Ga0114129_10111674 | 3300009147 | Bacteria | 3771 |
| 70 | Ga0114129_10289187 | 3300009147 | Bacteria | 2187 |
| 71 | Ga0114129_11446791 | 3300009147 | Bacteria | 846 |
| 72 | Ga0114129_12125084 | 3300009147 | Bacteria | 677 |
| 73 | Ga0105243_10317925 | 3300009148 | Bacteria | 1417 |
| 74 | Ga0105241_12142344 | 3300009174 | Bacteria | 553 |
| 75 | Ga0105238_10125386 | 3300009551 | Bacteria | 2547 |
| 76 | Ga0105238_10400724 | 3300009551 | Bacteria | 1365 |
| 77 | Ga0105238_10767266 | 3300009551 | Bacteria | 979 |
| 78 | Ga0105238_11212292 | 3300009551 | Bacteria | 779 |
| 79 | Ga0105239_10495426 | 3300010375 | Bacteria | 1389 |
| 80 | Ga0105239_10559483 | 3300010375 | Bacteria | 1303 |
| 81 | Ga0105239_10635426 | 3300010375 | Bacteria | 1219 |
| 82 | Ga0105239_12386531 | 3300010375 | Bacteria | 616 |
| 83 | Ga0105246_11107875 | 3300011119 | Bacteria | 723 |
| 84 | Ga0105246_11367457 | 3300011119 | Bacteria | 659 |
| 85 | Ga0105246_11575935 | 3300011119 | Bacteria | 620 |
| 86 | Ga0157370_10018850 | 3300013104 | Bacteria | 6940 |
| 87 | Ga0157370_10654823 | 3300013104 | Bacteria | 960 |
| 88 | Ga0157369_10003787 | 3300013105 | Bacteria | 17966 |
| 89 | Ga0157369_10151246 | 3300013105 | Bacteria | 2453 |
| 90 | Ga0157369_10164437 | 3300013105 | Bacteria | 2341 |
| 91 | Ga0157369_10178579 | 3300013105 | Bacteria | 2234 |
| 92 | Ga0157374_10772308 | 3300013296 | Bacteria | 976 |
| 93 | Ga0163162_10744787 | 3300013306 | Bacteria | 1099 |
| 94 | Ga0163162_12143626 | 3300013306 | Bacteria | 641 |
| 95 | Ga0157372_11005931 | 3300013307 | Bacteria | 965 |
| 96 | Ga0157375_10220469 | 3300013308 | Bacteria | 2055 |
| 97 | Ga0157375_11846043 | 3300013308 | Bacteria | 717 |
| 98 | Ga0163163_10007437 | 3300014325 | Bacteria | 9667 |
| 99 | Ga0157380_11723682 | 3300014326 | Bacteria | 684 |
| 100 | Ga0182008_10002907 | 3300014497 | Bacteria | 10604 |
| 101 | Ga0157377_10465746 | 3300014745 | Bacteria | 876 |
| 102 | Ga0157377_10768321 | 3300014745 | Bacteria | 707 |
| 103 | Ga0157376_10946181 | 3300014969 | Bacteria | 882 |
| 104 | Ga0182007_10000950 | 3300015262 | Bacteria | 15910 |
| 105 | Ga0183367_1001 | 3300015688 | Bacteria | 1225545 |
| 106 | Ga0206356_10164245 | 3300020070 | Bacteria | 818 |
| 107 | Ga0206356_11140472 | 3300020070 | Bacteria | 738 |
| 108 | Ga0206350_11633130 | 3300020080 | Bacteria | 961 |
| 109 | Ga0206353_10286961 | 3300020082 | Bacteria | 641 |
| 110 | Ga0213876_10005107 | 3300021384 | Bacteria | 7238 |
| 111 | Ga0213875_10124131 | 3300021388 | Bacteria | 1206 |
| 112 | Ga0224712_10140882 | 3300022467 | Bacteria | 1061 |
| 113 | Ga0209758_1065708 | 3300025297 | Bacteria | 1169 |
| 114 | Ga0207426_1039193 | 3300025302 | Bacteria | 1486 |
| 115 | Ga0207426_1093605 | 3300025302 | Bacteria | 790 |
| 116 | Ga0207692_10002711 | 3300025898 | Bacteria | 6826 |
| 117 | Ga0207688_10241221 | 3300025901 | Bacteria | 1093 |
| 118 | Ga0207647_10007299 | 3300025904 | Bacteria | 7999 |
| 119 | Ga0207705_10017069 | 3300025909 | Bacteria | 5200 |
| 120 | Ga0207705_10757886 | 3300025909 | Bacteria | 754 |
| 121 | Ga0207707_10664077 | 3300025912 | Bacteria | 878 |
| 122 | Ga0207695_10058844 | 3300025913 | Bacteria | 3988 |
| 123 | Ga0207662_10719632 | 3300025918 | Bacteria | 700 |
| 124 | Ga0207657_10105485 | 3300025919 | Bacteria | 2333 |
| 125 | Ga0207652_10619898 | 3300025921 | Bacteria | 969 |
| 126 | Ga0207650_11137412 | 3300025925 | Bacteria | 664 |
| 127 | Ga0207650_11610834 | 3300025925 | Bacteria | 551 |
| 128 | Ga0207687_10336008 | 3300025927 | Bacteria | 1227 |
| 129 | Ga0207644_10153354 | 3300025931 | Bacteria | 1785 |
| 130 | Ga0207704_10300518 | 3300025938 | Bacteria | 1229 |
| 131 | Ga0207691_10797093 | 3300025940 | Bacteria | 794 |
| 132 | Ga0207661_10552582 | 3300025944 | Bacteria | 1055 |
| 133 | Ga0207679_10805011 | 3300025945 | Bacteria | 857 |
| 134 | Ga0207667_10091857 | 3300025949 | Bacteria | 3135 |
| 135 | Ga0207667_10256194 | 3300025949 | Bacteria | 1790 |
| 136 | Ga0207640_10371360 | 3300025981 | Bacteria | 1156 |
| 137 | Ga0207703_11486926 | 3300026035 | Bacteria | 652 |
| 138 | Ga0207678_10402151 | 3300026067 | Bacteria | 1186 |
| 139 | Ga0207678_10769500 | 3300026067 | Bacteria | 849 |
| 140 | Ga0207678_11583745 | 3300026067 | Bacteria | 577 |
| 141 | Ga0207702_10091854 | 3300026078 | Bacteria | 2659 |
| 142 | Ga0207702_10715802 | 3300026078 | Bacteria | 987 |
| 143 | Ga0207676_11276984 | 3300026095 | Bacteria | 729 |
| 144 | Ga0207674_11272104 | 3300026116 | Bacteria | 705 |
| 145 | Ga0207683_10081030 | 3300026121 | Bacteria | 2880 |
| 146 | Ga0207698_10131439 | 3300026142 | Bacteria | 2140 |
| 147 | Ga0209813_10034053 | 3300027866 | Bacteria | 1518 |
| 148 | Ga0307517_10008570 | 3300028786 | Bacteria | 14644 |
| 149 | Ga0307515_10000055 | 3300028794 | Bacteria | 264365 |
| 150 | Ga0307515_10589765 | 3300028794 | Bacteria | 721 |
| 151 | Ga0307511_10005039 | 3300030521 | Bacteria | 13473 |
| 152 | Ga0307512_10001679 | 3300030522 | Bacteria | 30324 |
| 153 | Ga0307512_10030025 | 3300030522 | Bacteria | 4736 |
| 154 | Ga0265325_10031223 | 3300031241 | Bacteria | 2853 |
| 155 | Ga0265316_10386244 | 3300031344 | Bacteria | 1010 |
| 156 | Ga0265316_10432058 | 3300031344 | Bacteria | 946 |
| 157 | Ga0265316_10820611 | 3300031344 | Bacteria | 652 |
| 158 | Ga0307513_10063411 | 3300031456 | Bacteria | 3900 |
| 159 | Ga0307513_10074197 | 3300031456 | Bacteria | 3539 |
| 160 | Ga0307513_10117343 | 3300031456 | Bacteria | 2639 |
| 161 | Ga0307509_10011445 | 3300031507 | Bacteria | 10739 |
| 162 | Ga0307509_10062862 | 3300031507 | Bacteria | 3912 |
| 163 | Ga0307509_10979956 | 3300031507 | Bacteria | 512 |
| 164 | Ga0265313_10114539 | 3300031595 | Bacteria | 1182 |
| 165 | Ga0307508_10005498 | 3300031616 | Bacteria | 12042 |
| 166 | Ga0307508_10014620 | 3300031616 | Bacteria | 7162 |
| 167 | Ga0307508_10044237 | 3300031616 | Bacteria | 3985 |
| 168 | Ga0307508_10132527 | 3300031616 | Bacteria | 2095 |
| 169 | Ga0307514_10003936 | 3300031649 | Bacteria | 13887 |
| 170 | Ga0307514_10120205 | 3300031649 | Bacteria | 1835 |
| 171 | Ga0307514_10232175 | 3300031649 | Bacteria | 1116 |
| 172 | Ga0307514_10255439 | 3300031649 | Bacteria | 1032 |
| 173 | Ga0307514_10554344 | 3300031649 | Bacteria | 529 |
| 174 | Ga0265342_10030213 | 3300031712 | Bacteria | 3359 |
| 175 | Ga0307516_10005424 | 3300031730 | Bacteria | 15271 |
| 176 | Ga0307516_10057248 | 3300031730 | Bacteria | 3798 |
| 177 | Ga0307405_10788739 | 3300031731 | Bacteria | 795 |
| 178 | Ga0307518_10044734 | 3300031838 | Bacteria | 3220 |
| 179 | Ga0307518_10122296 | 3300031838 | Bacteria | 1840 |
| 180 | Ga0307518_10142690 | 3300031838 | Bacteria | 1668 |
| 181 | Ga0307518_10229721 | 3300031838 | Bacteria | 1202 |
| 182 | Ga0307410_10630621 | 3300031852 | Bacteria | 897 |
| 183 | Ga0307410_10840635 | 3300031852 | Bacteria | 783 |
| 184 | Ga0307410_10920252 | 3300031852 | Bacteria | 750 |
| 185 | Ga0307406_11980453 | 3300031901 | Bacteria | 520 |
| 186 | Ga0307407_10070745 | 3300031903 | Bacteria | 2075 |
| 187 | Ga0307409_100411040 | 3300031995 | Bacteria | 1295 |
| 188 | Ga0307409_102057347 | 3300031995 | Bacteria | 601 |
| 189 | Ga0307409_102117920 | 3300031995 | Bacteria | 592 |
| 190 | Ga0307416_100311642 | 3300032002 | Bacteria | 1571 |
| 191 | Ga0307416_100404537 | 3300032002 | Bacteria | 1404 |
| 192 | Ga0307416_100477534 | 3300032002 | Bacteria | 1306 |
| 193 | Ga0307411_12190644 | 3300032005 | Bacteria | 518 |
| 194 | Ga0307415_100492148 | 3300032126 | Bacteria | 1070 |
| 195 | Ga0307415_100712123 | 3300032126 | Bacteria | 907 |
| 196 | Ga0307415_101789127 | 3300032126 | Bacteria | 594 |
| 197 | Ga0307507_10020179 | 3300033179 | Bacteria | 7474 |
| 198 | Ga0307507_10099825 | 3300033179 | Bacteria | 2436 |
| 199 | Ga0307507_10309809 | 3300033179 | Bacteria | 960 |
| 200 | Ga0307507_10415078 | 3300033179 | Bacteria | 758 |
| 201 | Ga0307510_10003883 | 3300033180 | Bacteria | 17512 |
| 202 | Ga0307510_10037906 | 3300033180 | Bacteria | 5339 |
| 203 | Ga0307510_10073467 | 3300033180 | Bacteria | 3387 |
| 204 | Ga0373925_1695586 | 3300037068 | Bacteria | 516 |
| 205 | Ga0395899_0116380 | 3300037312 | Bacteria | 1918 |
| 206 | Ga0395899_0428144 | 3300037312 | Bacteria | 871 |
| 207 | Ga0395900_0342142 | 3300037418 | Bacteria | 1471 |
| 208 | Ga0395900_0626099 | 3300037418 | Bacteria | 1014 |
| 209 | Ga0395898_0015607 | 3300037466 | Bacteria | 7786 |
| 210 | Ga0395898_1259561 | 3300037466 | Bacteria | 670 |
| 211 | Ga0395905_0442762 | 3300037471 | Bacteria | 1197 |
| 212 | Ga0395905_1893072 | 3300037471 | Bacteria | 503 |
| 213 | Ga0395901_0028755 | 3300038443 | Bacteria | 5718 |
| 214 | Ga0395901_0113160 | 3300038443 | Bacteria | 2850 |
| 215 | Ga0395901_0183602 | 3300038443 | Bacteria | 2194 |
| 216 | Ga0436365_0198832 | 3300039437 | Bacteria | 16834 |
| 217 | Ga0439436_0001664 | 3300041404 | Bacteria | 6490 |
| 218 | Ga0439436_0013351 | 3300041404 | Bacteria | 2484 |
| 219 | Ga0439439_0000277 | 3300041406 | Bacteria | 8106 |
| 220 | Ga0451789_0678980 | 3300041443 | Bacteria | 675 |
| 221 | Ga0451791_1483709 | 3300041451 | Bacteria | 3871 |
| 222 | Ga0451793_0786765 | 3300041452 | Bacteria | 2766 |
| 223 | Ga0451793_1110178 | 3300041452 | Bacteria | 770 |
| 224 | Ga0451793_1528231 | 3300041452 | Bacteria | 802 |
| 225 | Ga0451802_1453876 | 3300041460 | Bacteria | 1427 |
| 226 | Ga0451807_0509614 | 3300041486 | Bacteria | 1061 |
| 227 | Ga0451833_0326702 | 3300041491 | Bacteria | 1561 |
| 228 | Ga0451837_0087430 | 3300041494 | Bacteria | 1403 |
| 229 | Ga0451837_0817873 | 3300041494 | Bacteria | 1954 |
| 230 | Ga0451843_0990492 | 3300041509 | Bacteria | 1488 |
| 231 | Ga0451855_0094309 | 3300041511 | Bacteria | 611 |
| 232 | Ga0451853_1236761 | 3300041512 | Bacteria | 1419 |
| 233 | Ga0451853_1515807 | 3300041512 | Bacteria | 2335 |
| 234 | Ga0451853_2584007 | 3300041512 | Bacteria | 2245 |
| 235 | Ga0439431_0091602 | 3300041997 | Bacteria | 829 |
| 236 | Ga0439433_0001898 | 3300041999 | Bacteria | 4374 |
| 237 | Ga0439433_0052820 | 3300041999 | Bacteria | 960 |
| 238 | Ga0439442_013660 | 3300042002 | Bacteria | 1667 |
| 239 | Ga0439448_0140665 | 3300042005 | Bacteria | 835 |
| 240 | Ga0439449_0006067 | 3300042007 | Bacteria | 4619 |
| 241 | Ga0439449_0022466 | 3300042007 | Bacteria | 2362 |
| 242 | Ga0439449_0379301 | 3300042007 | Bacteria | 536 |
| 243 | Ga0439457_000624 | 3300042014 | Bacteria | 10457 |
| 244 | Ga0439457_004423 | 3300042014 | Bacteria | 3661 |
| 245 | Ga0439457_029313 | 3300042014 | Bacteria | 1219 |
| 246 | Ga0439462_0020986 | 3300042015 | Bacteria | 1705 |
| 247 | Ga0439462_0124966 | 3300042015 | Bacteria | 717 |
| 248 | Ga0450894_000246 | 3300042131 | Bacteria | 9702 |
| 249 | Ga0450895_001203 | 3300042132 | Bacteria | 1753 |
| 250 | Ga0450896_001733 | 3300042133 | Bacteria | 2740 |
| 251 | Ga0450898_001110 | 3300042134 | Bacteria | 3438 |
| 252 | Ga0450899_002776 | 3300042135 | Bacteria | 1893 |
| 253 | Ga0450900_004770 | 3300042136 | Bacteria | 1574 |
| 254 | Ga0450900_005948 | 3300042136 | Bacteria | 1458 |
| 255 | Ga0450903_027868 | 3300042138 | Bacteria | 858 |
| 256 | Ga0450906_000846 | 3300042145 | Bacteria | 6746 |
| 257 | Ga0450906_030310 | 3300042145 | Bacteria | 956 |
| 258 | Ga0450908_036290 | 3300042184 | Bacteria | 854 |
| 259 | Ga0439440_0194127 | 3300042993 | Bacteria | 600 |
| 260 | Ga0466969_0214090 | 3300044656 | Bacteria | 877 |
| 261 | Ga0466972_0001151 | 3300044658 | Bacteria | 12643 |
| 262 | Ga0466972_0034261 | 3300044658 | Bacteria | 2488 |
| 263 | Ga0466972_0110992 | 3300044658 | Bacteria | 1296 |
| 264 | Ga0466965_0000638 | 3300044683 | Bacteria | 12848 |
| 265 | Ga0466965_0012782 | 3300044683 | Bacteria | 3952 |
| 266 | Ga0466965_0513654 | 3300044683 | Bacteria | 673 |
| 267 | Ga0466966_0002173 | 3300044684 | Bacteria | 12732 |
| 268 | Ga0466966_0013308 | 3300044684 | Bacteria | 5446 |
| 269 | Ga0466961_0001217 | 3300044693 | Bacteria | 15827 |
| 270 | Ga0466961_0129700 | 3300044693 | Bacteria | 1580 |
| 271 | Ga0466961_0132332 | 3300044693 | Bacteria | 1563 |
| 272 | Ga0466961_0543012 | 3300044693 | Bacteria | 700 |
| 273 | Ga0466963_0000129 | 3300044694 | Bacteria | 28746 |
| 274 | Ga0466971_0000778 | 3300044719 | Bacteria | 12815 |
| 275 | Ga0466971_0319402 | 3300044719 | Bacteria | 748 |
| 276 | Ga0466968_0014317 | 3300044735 | Bacteria | 3133 |
| 277 | Ga0466968_0242224 | 3300044735 | Bacteria | 854 |
| 278 | Ga0466970_0008329 | 3300044765 | Bacteria | 5215 |
| 279 | Ga0466970_0036335 | 3300044765 | Bacteria | 2609 |
| 280 | Ga0466970_0123191 | 3300044765 | Bacteria | 1421 |
| 281 | Ga0466970_0154291 | 3300044765 | Bacteria | 1269 |
| 282 | Ga0466957_0000368 | 3300044842 | Bacteria | 22096 |
| 283 | Ga0466957_0050723 | 3300044842 | Bacteria | 2525 |
| 284 | Ga0466957_1192520 | 3300044842 | Bacteria | 551 |
| 285 | Ga0466960_0003070 | 3300044901 | Bacteria | 6382 |
| 286 | Ga0466960_0041004 | 3300044901 | Bacteria | 2191 |
| 287 | Ga0466960_0074533 | 3300044901 | Bacteria | 1696 |
| 288 | Ga0466959_0002086 | 3300045049 | Bacteria | 12639 |
| 289 | Ga0466959_0004621 | 3300045049 | Bacteria | 9253 |
| 290 | Ga0466958_0010824 | 3300045836 | Bacteria | 5121 |
| 291 | Ga0466958_0018698 | 3300045836 | Bacteria | 4026 |
| 292 | Ga0466958_0951357 | 3300045836 | Bacteria | 560 |
| 293 | Ga0466967_0001454 | 3300045976 | Bacteria | 13751 |
| 294 | Ga0466967_0211306 | 3300045976 | Bacteria | 1840 |
| 295 | Ga0466967_1851318 | 3300045976 | Bacteria | 600 |
| 296 | Ga0466967_2369096 | 3300045976 | Bacteria | 526 |
| 297 | Ga0495617_009899 | 3300046452 | Bacteria | 3268 |
| 298 | Ga0495627_095387 | 3300046453 | Bacteria | 853 |
| 299 | Ga0495627_180165 | 3300046453 | Bacteria | 585 |
| 300 | Ga0495592_0004681 | 3300046454 | Bacteria | 10029 |
| 301 | Ga0495592_0019703 | 3300046454 | Bacteria | 5131 |
| 302 | Ga0495603_0000883 | 3300046455 | Bacteria | 17238 |
| 303 | Ga0495603_0002066 | 3300046455 | Bacteria | 11801 |
| 304 | Ga0495603_0127013 | 3300046455 | Bacteria | 1486 |
| 305 | Ga0495603_0673520 | 3300046455 | Bacteria | 592 |
| 306 | Ga0495590_0045820 | 3300046457 | Bacteria | 1525 |
| 307 | Ga0495629_0004727 | 3300046459 | Bacteria | 10203 |
| 308 | Ga0495629_0008787 | 3300046459 | Bacteria | 7429 |
| 309 | Ga0495629_0015459 | 3300046459 | Bacteria | 5481 |
| 310 | Ga0495629_0025163 | 3300046459 | Bacteria | 4234 |
| 311 | Ga0495629_0032391 | 3300046459 | Bacteria | 3701 |
| 312 | Ga0495629_0074786 | 3300046459 | Bacteria | 2365 |
| 313 | Ga0495629_0101880 | 3300046459 | Bacteria | 2003 |
| 314 | Ga0495629_0149975 | 3300046459 | Bacteria | 1621 |
| 315 | Ga0495629_0379962 | 3300046459 | Bacteria | 961 |
| 316 | Ga0495638_0055762 | 3300046460 | Bacteria | 2453 |
| 317 | Ga0495638_0093666 | 3300046460 | Bacteria | 1806 |
| 318 | Ga0495638_0179691 | 3300046460 | Bacteria | 1208 |
| 319 | Ga0495651_0002968 | 3300046462 | Bacteria | 13097 |
| 320 | Ga0495651_0040550 | 3300046462 | Bacteria | 3620 |
| 321 | Ga0495582_0360594 | 3300046473 | Bacteria | 837 |
| 322 | Ga0495582_0561320 | 3300046473 | Bacteria | 660 |
| 323 | Ga0495605_0038106 | 3300046474 | Bacteria | 2414 |
| 324 | Ga0495605_0203349 | 3300046474 | Bacteria | 862 |
| 325 | Ga0495639_0356696 | 3300046475 | Bacteria | 735 |
| 326 | Ga0495662_0002080 | 3300046476 | Bacteria | 10035 |
| 327 | Ga0495662_0008434 | 3300046476 | Bacteria | 5068 |
| 328 | Ga0495662_0022243 | 3300046476 | Bacteria | 3063 |
| 329 | Ga0495662_0023392 | 3300046476 | Bacteria | 2983 |
| 330 | Ga0495664_0002020 | 3300046477 | Bacteria | 10830 |
| 331 | Ga0495664_0031613 | 3300046477 | Bacteria | 3104 |
| 332 | Ga0495664_0098388 | 3300046477 | Bacteria | 1761 |
| 333 | Ga0495584_0042402 | 3300046491 | Bacteria | 2297 |
| 334 | Ga0495584_0474648 | 3300046491 | Bacteria | 637 |
| 335 | Ga0495584_0661004 | 3300046491 | Bacteria | 533 |
| 336 | Ga0495585_0023861 | 3300046492 | Bacteria | 3509 |
| 337 | Ga0495585_0058374 | 3300046492 | Bacteria | 2129 |
| 338 | Ga0495585_0073561 | 3300046492 | Bacteria | 1860 |
| 339 | Ga0495594_0007673 | 3300046499 | Bacteria | 5550 |
| 340 | Ga0495594_0011289 | 3300046499 | Bacteria | 4641 |
| 341 | Ga0495594_0029462 | 3300046499 | Bacteria | 2967 |
| 342 | Ga0495594_0218288 | 3300046499 | Bacteria | 1087 |
| 343 | Ga0495594_0504159 | 3300046499 | Bacteria | 687 |
| 344 | Ga0495596_0049844 | 3300046500 | Bacteria | 1641 |
| 345 | Ga0495607_0057371 | 3300046501 | Bacteria | 2231 |
| 346 | Ga0495607_0121337 | 3300046501 | Bacteria | 1371 |
| 347 | Ga0495583_0101480 | 3300046506 | Bacteria | 1227 |
| 348 | Ga0495606_0005584 | 3300046507 | Bacteria | 11974 |
| 349 | Ga0495610_0100692 | 3300046512 | Bacteria | 1295 |
| 350 | Ga0495616_0011610 | 3300046513 | Bacteria | 5040 |
| 351 | Ga0495618_0862011 | 3300046514 | Bacteria | 525 |
| 352 | Ga0495620_0016511 | 3300046515 | Bacteria | 3701 |
| 353 | Ga0495620_0274894 | 3300046515 | Bacteria | 641 |
| 354 | Ga0495628_0032667 | 3300046516 | Bacteria | 4199 |
| 355 | Ga0495628_0088008 | 3300046516 | Bacteria | 2407 |
| 356 | Ga0495631_0023616 | 3300046518 | Bacteria | 2848 |
| 357 | Ga0495631_0126399 | 3300046518 | Bacteria | 1099 |
| 358 | Ga0495666_0039688 | 3300046526 | Bacteria | 2284 |
| 359 | Ga0495652_0006571 | 3300046529 | Bacteria | 10803 |
| 360 | Ga0495654_0108745 | 3300046530 | Bacteria | 1267 |
| 361 | Ga0495640_0008892 | 3300046533 | Bacteria | 7846 |
| 362 | Ga0495640_0013078 | 3300046533 | Bacteria | 6321 |
| 363 | Ga0495640_0109040 | 3300046533 | Bacteria | 1811 |
| 364 | Ga0495586_0020653 | 3300046535 | Bacteria | 3508 |
| 365 | Ga0495586_0557647 | 3300046535 | Bacteria | 662 |
| 366 | Ga0495587_0001315 | 3300046536 | Bacteria | 16495 |
| 367 | Ga0495609_0027039 | 3300046538 | Bacteria | 2623 |
| 368 | Ga0495597_0136174 | 3300046542 | Bacteria | 1015 |
| 369 | Ga0495645_0064905 | 3300046543 | Bacteria | 2641 |
| 370 | Ga0495645_0086382 | 3300046543 | Bacteria | 2245 |
| 371 | Ga0495622_0008887 | 3300046557 | Bacteria | 4654 |
| 372 | Ga0495622_0019711 | 3300046557 | Bacteria | 3141 |
| 373 | Ga0495622_0021710 | 3300046557 | Bacteria | 2988 |
| 374 | Ga0495633_0034714 | 3300046558 | Bacteria | 2424 |
| 375 | Ga0495667_0011894 | 3300046559 | Bacteria | 5896 |
| 376 | Ga0495667_0103648 | 3300046559 | Bacteria | 1840 |
| 377 | Ga0495656_0054646 | 3300046615 | Bacteria | 1719 |
| 378 | Ga0495668_0005892 | 3300046616 | Bacteria | 8161 |
| 379 | Ga0495634_0001504 | 3300046642 | Bacteria | 20635 |
| 380 | Ga0495634_0008952 | 3300046642 | Bacteria | 7412 |
| 381 | Ga0495611_0109177 | 3300046648 | Bacteria | 1287 |
| 382 | Ga0495625_0102774 | 3300046660 | Bacteria | 1961 |
| 383 | Ga0495625_0266251 | 3300046660 | Bacteria | 1107 |
| 384 | Ga0495625_0353043 | 3300046660 | Bacteria | 929 |
| 385 | Ga0495635_0002277 | 3300046663 | Bacteria | 13054 |
| 386 | Ga0495661_0138994 | 3300046665 | Bacteria | 1323 |
| 387 | Ga0495588_0014942 | 3300046674 | Bacteria | 3726 |
| 388 | Ga0495588_0076233 | 3300046674 | Bacteria | 1747 |
| 389 | Ga0495657_0001502 | 3300046675 | Bacteria | 20091 |
| 390 | Ga0495657_0002117 | 3300046675 | Bacteria | 16865 |
| 391 | Ga0495657_0010589 | 3300046675 | Bacteria | 6930 |
| 392 | Ga0495657_0055636 | 3300046675 | Bacteria | 2638 |
| 393 | Ga0495623_0166931 | 3300046679 | Bacteria | 1289 |
| 394 | Ga0495646_0002770 | 3300046680 | Bacteria | 10844 |
| 395 | Ga0495646_0018961 | 3300046680 | Bacteria | 4356 |
| 396 | Ga0495658_0252564 | 3300046683 | Bacteria | 1109 |
| 397 | Ga0495613_0000504 | 3300046689 | Bacteria | 32987 |
| 398 | Ga0495613_0006490 | 3300046689 | Bacteria | 8738 |
| 399 | Ga0495613_0015763 | 3300046689 | Bacteria | 5626 |
| 400 | Ga0495613_0026570 | 3300046689 | Bacteria | 4311 |
| 401 | Ga0495624_0038983 | 3300046690 | Bacteria | 3049 |
| 402 | Ga0495624_0245921 | 3300046690 | Bacteria | 1082 |
| 403 | Ga0495670_0114759 | 3300046691 | Bacteria | 1396 |
| 404 | Ga0495670_0732025 | 3300046691 | Bacteria | 539 |
| 405 | Ga0495671_0031677 | 3300046692 | Bacteria | 2703 |
| 406 | Ga0495649_0066862 | 3300046694 | Bacteria | 1928 |
| 407 | Ga0495649_0076533 | 3300046694 | Bacteria | 1791 |
| 408 | Ga0495649_0442738 | 3300046694 | Bacteria | 649 |
| 409 | Ga0495589_0026365 | 3300046794 | Bacteria | 2945 |
| 410 | Ga0495589_0027001 | 3300046794 | Bacteria | 2906 |
| 411 | Ga0495589_0084206 | 3300046794 | Bacteria | 1545 |
| 412 | Ga0495600_0062820 | 3300046809 | Bacteria | 2426 |
| 413 | Ga0495600_0103587 | 3300046809 | Bacteria | 1854 |
| 414 | Ga0495660_0164212 | 3300046810 | Bacteria | 1086 |
| 415 | Ga0495581_0001340 | 3300047315 | Bacteria | 13605 |
| 416 | Ga0495581_0053969 | 3300047315 | Bacteria | 2320 |
| 417 | Ga0495581_0097233 | 3300047315 | Bacteria | 1710 |
| 418 | Ga0495581_0229368 | 3300047315 | Bacteria | 1086 |
| 419 | Ga0495604_0000224 | 3300047317 | Bacteria | 51653 |
| 420 | Ga0495636_0000633 | 3300047318 | Bacteria | 12901 |
| 421 | Ga0495636_0000901 | 3300047318 | Bacteria | 11037 |
| 422 | Ga0495636_0014480 | 3300047318 | Bacteria | 3136 |
| 423 | Ga0495636_0038743 | 3300047318 | Bacteria | 1973 |
| 424 | Ga0495676_0001049 | 3300047321 | Bacteria | 23375 |
| 425 | Ga0495676_0012880 | 3300047321 | Bacteria | 7523 |
| 426 | Ga0495676_0069297 | 3300047321 | Bacteria | 2721 |
| 427 | Ga0495680_0386063 | 3300047322 | Bacteria | 969 |
| 428 | Ga0495683_0066444 | 3300047323 | Bacteria | 1777 |
| 429 | Ga0495687_005384 | 3300047443 | Bacteria | 8171 |
| 430 | Ga0495675_0025171 | 3300047444 | Bacteria | 3795 |
| 431 | Ga0495675_0153415 | 3300047444 | Bacteria | 1422 |
| 432 | Ga0495675_0253668 | 3300047444 | Bacteria | 1056 |
| 433 | Ga0495675_0654691 | 3300047444 | Bacteria | 591 |
| 434 | Ga0495685_003058 | 3300047447 | Bacteria | 5305 |
| 435 | Ga0495685_010441 | 3300047447 | Bacteria | 3114 |
| 436 | Ga0495685_015035 | 3300047447 | Bacteria | 2635 |
| 437 | Ga0495685_052807 | 3300047447 | Bacteria | 1376 |
| 438 | Ga0495685_258438 | 3300047447 | Bacteria | 551 |
| 439 | Ga0495681_0000970 | 3300047470 | Bacteria | 21944 |
| 440 | Ga0495681_0009462 | 3300047470 | Bacteria | 6000 |
| 441 | Ga0495686_0033272 | 3300047472 | Bacteria | 3330 |
| 442 | Ga0495686_0045072 | 3300047472 | Bacteria | 2791 |
| 443 | Ga0495593_0004149 | 3300047673 | Bacteria | 8621 |
| 444 | Ga0495593_0454803 | 3300047673 | Bacteria | 641 |
| 445 | Ga0495614_0009644 | 3300048089 | Bacteria | 4266 |
| 446 | Ga0495614_0020482 | 3300048089 | Bacteria | 2859 |
| 447 | Ga0495614_0132366 | 3300048089 | Bacteria | 1104 |
| 448 | Ga0496100_0147717 | 3300048903 | Bacteria | 1673 |
| 449 | Ga0496101_0644271 | 3300048904 | Bacteria | 837 |
| 450 | Ga0496101_0733515 | 3300048904 | Bacteria | 780 |
| 451 | Ga0496102_0017905 | 3300048905 | Bacteria | 6214 |
| 452 | Ga0496104_0082517 | 3300048907 | Bacteria | 3065 |
| 453 | Ga0496104_0133586 | 3300048907 | Bacteria | 2384 |
| 454 | Ga0496105_0036484 | 3300048908 | Bacteria | 4050 |
| 455 | Ga0496106_0093410 | 3300048909 | Bacteria | 2325 |
| 456 | Ga0496107_0270190 | 3300048910 | Bacteria | 1265 |
| 457 | Ga0496108_0126703 | 3300048911 | Bacteria | 2192 |
| 458 | Ga0496108_0291570 | 3300048911 | Bacteria | 1421 |
| 459 | Ga0496108_0458515 | 3300048911 | Bacteria | 1113 |
| 460 | Ga0496109_0043887 | 3300048912 | Bacteria | 4054 |
| 461 | Ga0496109_0225992 | 3300048912 | Bacteria | 1760 |
| 462 | Ga0496111_0170439 | 3300048914 | Bacteria | 1617 |
| 463 | Ga0496111_0400997 | 3300048914 | Bacteria | 1013 |
| 464 | Ga0496112_0021197 | 3300048915 | Bacteria | 6176 |
| 465 | Ga0496113_0097084 | 3300048916 | Bacteria | 2279 |
| 466 | Ga0496113_0183370 | 3300048916 | Bacteria | 1660 |
| 467 | Ga0496113_0244033 | 3300048916 | Bacteria | 1433 |
| 468 | Ga0496114_0033438 | 3300048917 | Bacteria | 4236 |
| 469 | Ga0496126_0379622 | 3300048929 | Bacteria | 1151 |
| 470 | Ga0495678_031590 | 3300049459 | Bacteria | 2206 |
| 471 | Ga0495682_0230675 | 3300049460 | Bacteria | 655 |
| 472 | Ga0501315_095244 | 3300049531 | Bacteria | 520 |
| 473 | Ga0501317_030411 | 3300049533 | Bacteria | 781 |
| 474 | Ga0501318_073324 | 3300049534 | Bacteria | 544 |
| 475 | Ga0501318_089692 | 3300049534 | Bacteria | 508 |
| 476 | Ga0501323_036861 | 3300049539 | Bacteria | 705 |
| 477 | Ga0501325_016193 | 3300049541 | Bacteria | 743 |
| 478 | Ga0501031_0015014 | 3300049568 | Bacteria | 5031 |
| 479 | Ga0501031_0109839 | 3300049568 | Bacteria | 1801 |
| 480 | Ga0501031_0116460 | 3300049568 | Bacteria | 1746 |
| 481 | Ga0501031_0132976 | 3300049568 | Bacteria | 1625 |
| 482 | Ga0501031_0158187 | 3300049568 | Bacteria | 1481 |
| 483 | Ga0501032_0013917 | 3300049569 | Bacteria | 5707 |
| 484 | Ga0501032_0018356 | 3300049569 | Bacteria | 4902 |
| 485 | Ga0501032_0036251 | 3300049569 | Bacteria | 3368 |
| 486 | Ga0501032_0039377 | 3300049569 | Bacteria | 3215 |
| 487 | Ga0501032_0146077 | 3300049569 | Bacteria | 1557 |
| 488 | Ga0501032_0219001 | 3300049569 | Bacteria | 1239 |
| 489 | Ga0501032_0622688 | 3300049569 | Bacteria | 686 |
| 490 | Ga0501033_0015677 | 3300049570 | Bacteria | 5746 |
| 491 | Ga0501033_0022607 | 3300049570 | Bacteria | 4743 |
| 492 | Ga0501033_0039312 | 3300049570 | Bacteria | 3533 |
| 493 | Ga0501033_0044544 | 3300049570 | Bacteria | 3303 |
| 494 | Ga0501033_0059535 | 3300049570 | Bacteria | 2820 |
| 495 | Ga0501033_0093770 | 3300049570 | Bacteria | 2195 |
| 496 | Ga0501033_0885680 | 3300049570 | Bacteria | 600 |
| 497 | Ga0501034_0007629 | 3300049571 | Bacteria | 11509 |
| 498 | Ga0501034_0012767 | 3300049571 | Bacteria | 8662 |
| 499 | Ga0501034_0034559 | 3300049571 | Bacteria | 5125 |
| 500 | Ga0501034_0036980 | 3300049571 | Bacteria | 4943 |
| 501 | Ga0501034_0139109 | 3300049571 | Bacteria | 2408 |
| 502 | Ga0501034_0155218 | 3300049571 | Bacteria | 2263 |
| 503 | Ga0501034_0178907 | 3300049571 | Bacteria | 2086 |
| 504 | Ga0501034_0595628 | 3300049571 | Bacteria | 1011 |
| 505 | Ga0501036_0000646 | 3300049572 | Bacteria | 25504 |
| 506 | Ga0501036_0002377 | 3300049572 | Bacteria | 14708 |
| 507 | Ga0501036_0003261 | 3300049572 | Bacteria | 12944 |
| 508 | Ga0501036_0026384 | 3300049572 | Bacteria | 4904 |
| 509 | Ga0501036_0049459 | 3300049572 | Bacteria | 3560 |
| 510 | Ga0501036_0157782 | 3300049572 | Bacteria | 1913 |
| 511 | Ga0501036_0194958 | 3300049572 | Bacteria | 1704 |
| 512 | Ga0501036_1190188 | 3300049572 | Bacteria | 621 |
| 513 | Ga0501037_0003632 | 3300049573 | Bacteria | 11189 |
| 514 | Ga0501037_0018008 | 3300049573 | Bacteria | 5200 |
| 515 | Ga0501037_0045919 | 3300049573 | Bacteria | 3205 |
| 516 | Ga0501037_0258354 | 3300049573 | Bacteria | 1217 |
| 517 | Ga0501037_0585534 | 3300049573 | Bacteria | 750 |
| 518 | Ga0501037_0714480 | 3300049573 | Bacteria | 666 |
| 519 | Ga0501037_0802454 | 3300049573 | Bacteria | 621 |
| 520 | Ga0501038_0007197 | 3300049574 | Bacteria | 10283 |
| 521 | Ga0501038_0013826 | 3300049574 | Bacteria | 7354 |
| 522 | Ga0501038_0022553 | 3300049574 | Bacteria | 5638 |
| 523 | Ga0501038_0036215 | 3300049574 | Bacteria | 4331 |
| 524 | Ga0501038_0114150 | 3300049574 | Bacteria | 2234 |
| 525 | Ga0501038_0141801 | 3300049574 | Bacteria | 1965 |
| 526 | Ga0501038_0159776 | 3300049574 | Bacteria | 1832 |
| 527 | Ga0501038_0169883 | 3300049574 | Bacteria | 1766 |
| 528 | Ga0501038_1216345 | 3300049574 | Bacteria | 546 |
| 529 | Ga0501039_0007975 | 3300049575 | Bacteria | 8068 |
| 530 | Ga0501039_0008978 | 3300049575 | Bacteria | 7616 |
| 531 | Ga0501039_0034309 | 3300049575 | Bacteria | 3916 |
| 532 | Ga0501039_0058172 | 3300049575 | Bacteria | 2994 |
| 533 | Ga0501039_0299247 | 3300049575 | Bacteria | 1265 |
| 534 | Ga0501039_0450613 | 3300049575 | Bacteria | 1010 |
| 535 | Ga0501040_0002541 | 3300049576 | Bacteria | 11761 |
| 536 | Ga0501040_0013708 | 3300049576 | Bacteria | 5332 |
| 537 | Ga0501040_0086994 | 3300049576 | Bacteria | 2170 |
| 538 | Ga0501041_0001751 | 3300049577 | Bacteria | 12172 |
| 539 | Ga0501041_0147164 | 3300049577 | Bacteria | 1470 |
| 540 | Ga0501041_0588504 | 3300049577 | Bacteria | 710 |
| 541 | Ga0501042_0056661 | 3300049578 | Bacteria | 2796 |
| 542 | Ga0501042_0078551 | 3300049578 | Bacteria | 2363 |
| 543 | Ga0501043_0008976 | 3300049579 | Bacteria | 7868 |
| 544 | Ga0501043_0013972 | 3300049579 | Bacteria | 6283 |
| 545 | Ga0501043_0017493 | 3300049579 | Bacteria | 5620 |
| 546 | Ga0501043_0020833 | 3300049579 | Bacteria | 5142 |
| 547 | Ga0501043_0030131 | 3300049579 | Bacteria | 4262 |
| 548 | Ga0501043_0046081 | 3300049579 | Bacteria | 3428 |
| 549 | Ga0501043_0050912 | 3300049579 | Bacteria | 3255 |
| 550 | Ga0501043_0171761 | 3300049579 | Bacteria | 1691 |
| 551 | Ga0501043_0664780 | 3300049579 | Bacteria | 764 |
| 552 | Ga0501046_0019522 | 3300049580 | Bacteria | 5620 |
| 553 | Ga0501046_0057042 | 3300049580 | Bacteria | 3064 |
| 554 | Ga0501046_0136659 | 3300049580 | Bacteria | 1856 |
| 555 | Ga0501046_0425137 | 3300049580 | Bacteria | 957 |
| 556 | Ga0501046_0499734 | 3300049580 | Bacteria | 871 |
| 557 | Ga0501047_0002168 | 3300049581 | Bacteria | 18780 |
| 558 | Ga0501047_0021536 | 3300049581 | Bacteria | 6190 |
| 559 | Ga0501047_0044156 | 3300049581 | Bacteria | 4305 |
| 560 | Ga0501047_0050033 | 3300049581 | Bacteria | 4035 |
| 561 | Ga0501047_0050785 | 3300049581 | Bacteria | 4005 |
| 562 | Ga0501047_0102940 | 3300049581 | Bacteria | 2735 |
| 563 | Ga0501047_0159408 | 3300049581 | Bacteria | 2128 |
| 564 | Ga0501047_0316684 | 3300049581 | Bacteria | 1400 |
| 565 | Ga0501047_1236970 | 3300049581 | Bacteria | 560 |
| 566 | Ga0501048_0010396 | 3300049582 | Bacteria | 6949 |
| 567 | Ga0501048_0037284 | 3300049582 | Bacteria | 3491 |
| 568 | Ga0501048_0049294 | 3300049582 | Bacteria | 3001 |
| 569 | Ga0501048_0443511 | 3300049582 | Bacteria | 929 |
| 570 | Ga0501048_1084327 | 3300049582 | Bacteria | 576 |
| 571 | Ga0501067_0006655 | 3300049583 | Bacteria | 6412 |
| 572 | Ga0501067_0020907 | 3300049583 | Bacteria | 3621 |
| 573 | Ga0501067_0038586 | 3300049583 | Bacteria | 2652 |
| 574 | Ga0501067_0175183 | 3300049583 | Bacteria | 1194 |
| 575 | Ga0501067_0419001 | 3300049583 | Bacteria | 747 |
| 576 | Ga0501068_0001171 | 3300049584 | Bacteria | 13934 |
| 577 | Ga0501068_0215709 | 3300049584 | Bacteria | 1219 |
| 578 | Ga0501068_0217055 | 3300049584 | Bacteria | 1215 |
| 579 | Ga0501069_0008895 | 3300049585 | Bacteria | 5294 |
| 580 | Ga0501069_0034515 | 3300049585 | Bacteria | 2786 |
| 581 | Ga0501069_0082110 | 3300049585 | Bacteria | 1816 |
| 582 | Ga0501069_0185919 | 3300049585 | Bacteria | 1202 |
| 583 | Ga0501069_0284407 | 3300049585 | Bacteria | 968 |
| 584 | Ga0501069_0591684 | 3300049585 | Bacteria | 665 |
| 585 | Ga0501070_0004802 | 3300049586 | Bacteria | 11555 |
| 586 | Ga0501070_0012556 | 3300049586 | Bacteria | 7144 |
| 587 | Ga0501070_0028923 | 3300049586 | Bacteria | 4646 |
| 588 | Ga0501070_0147189 | 3300049586 | Bacteria | 1944 |
| 589 | Ga0501070_0841512 | 3300049586 | Bacteria | 718 |
| 590 | Ga0501070_1413567 | 3300049586 | Bacteria | 528 |
| 591 | Ga0501071_0000482 | 3300049587 | Bacteria | 20111 |
| 592 | Ga0501071_0076775 | 3300049587 | Bacteria | 2440 |
| 593 | Ga0501071_0623119 | 3300049587 | Bacteria | 830 |
| 594 | Ga0501072_0003972 | 3300049588 | Bacteria | 11185 |
| 595 | Ga0501072_0005647 | 3300049588 | Bacteria | 9524 |
| 596 | Ga0501072_0031379 | 3300049588 | Bacteria | 4159 |
| 597 | Ga0501072_0160405 | 3300049588 | Bacteria | 1794 |
| 598 | Ga0501072_0176391 | 3300049588 | Bacteria | 1705 |
| 599 | Ga0501072_0482470 | 3300049588 | Bacteria | 981 |
| 600 | Ga0501073_0018390 | 3300049589 | Bacteria | 5050 |
| 601 | Ga0501074_0002011 | 3300049590 | Bacteria | 14006 |
| 602 | Ga0501074_0119151 | 3300049590 | Bacteria | 1887 |
| 603 | Ga0501074_0199086 | 3300049590 | Bacteria | 1428 |
| 604 | Ga0501074_0397625 | 3300049590 | Bacteria | 977 |
| 605 | Ga0501075_0072038 | 3300049591 | Bacteria | 2612 |
| 606 | Ga0501076_0017285 | 3300049592 | Bacteria | 5479 |
| 607 | Ga0501076_0028989 | 3300049592 | Bacteria | 4302 |
| 608 | Ga0501077_0030242 | 3300049593 | Bacteria | 3446 |
| 609 | Ga0501077_0062707 | 3300049593 | Bacteria | 2358 |
| 610 | Ga0501209_206176 | 3300049656 | Bacteria | 606 |
| 611 | Ga0501214_025901 | 3300049659 | Bacteria | 777 |
| 612 | Ga0501079_0007398 | 3300049741 | Bacteria | 8305 |
| 613 | Ga0501079_0846870 | 3300049741 | Bacteria | 720 |
| 614 | Ga0501080_0024714 | 3300049742 | Bacteria | 5571 |
| 615 | Ga0501080_0128855 | 3300049742 | Bacteria | 2343 |
| 616 | Ga0501080_0460955 | 3300049742 | Bacteria | 1138 |
| 617 | Ga0501080_0906390 | 3300049742 | Bacteria | 768 |
| 618 | Ga0501081_0905177 | 3300049743 | Bacteria | 665 |
| 619 | Ga0501083_0001134 | 3300049744 | Bacteria | 17865 |
| 620 | Ga0501083_0099889 | 3300049744 | Bacteria | 1914 |
| 621 | Ga0501035_0004736 | 3300049822 | Bacteria | 12917 |
| 622 | Ga0501035_0019427 | 3300049822 | Bacteria | 6249 |
| 623 | Ga0501035_0021596 | 3300049822 | Bacteria | 5919 |
| 624 | Ga0501035_0023699 | 3300049822 | Bacteria | 5631 |
| 625 | Ga0501035_0028830 | 3300049822 | Bacteria | 5064 |
| 626 | Ga0501035_0031773 | 3300049822 | Bacteria | 4808 |
| 627 | Ga0501035_0058750 | 3300049822 | Bacteria | 3426 |
| 628 | Ga0501035_0121238 | 3300049822 | Bacteria | 2286 |
| 629 | Ga0501035_0124524 | 3300049822 | Bacteria | 2250 |
| 630 | Ga0501035_0179842 | 3300049822 | Bacteria | 1822 |
| 631 | Ga0501035_0199559 | 3300049822 | Bacteria | 1716 |
| 632 | Ga0501035_0441671 | 3300049822 | Bacteria | 1077 |
| 633 | Ga0501035_0482919 | 3300049822 | Bacteria | 1022 |
| 634 | Ga0501044_0000976 | 3300049823 | Bacteria | 34361 |
| 635 | Ga0501044_0009892 | 3300049823 | Bacteria | 10363 |
| 636 | Ga0501044_0020298 | 3300049823 | Bacteria | 7091 |
| 637 | Ga0501044_0031412 | 3300049823 | Bacteria | 5591 |
| 638 | Ga0501044_0068718 | 3300049823 | Bacteria | 3608 |
| 639 | Ga0501044_0110717 | 3300049823 | Bacteria | 2754 |
| 640 | Ga0501044_0274396 | 3300049823 | Bacteria | 1621 |
| 641 | Ga0501044_0333890 | 3300049823 | Bacteria | 1438 |
| 642 | Ga0501044_1009585 | 3300049823 | Bacteria | 703 |
| 643 | Ga0501044_1167216 | 3300049823 | Bacteria | 638 |
| 644 | Ga0501045_0005054 | 3300049824 | Bacteria | 9133 |
| 645 | Ga0501045_0005598 | 3300049824 | Bacteria | 8693 |
| 646 | Ga0501045_0046124 | 3300049824 | Bacteria | 3174 |
| 647 | Ga0501045_0166204 | 3300049824 | Bacteria | 1643 |
| 648 | Ga0501045_0230674 | 3300049824 | Bacteria | 1378 |
| 649 | Ga0501045_0442166 | 3300049824 | Bacteria | 967 |
| 650 | nmdc:mga03n38_27987_c1 | 3300050490 | Bacteria | 2344 |
| 651 | nmdc:mga0yw44_348455_c1 | 3300050492 | Bacteria | 997 |
| 652 | nmdc:mga06z11_3487_c1 | 3300050494 | Bacteria | 6094 |
| 653 | nmdc:mga06z11_910127_c1 | 3300050494 | Bacteria | 536 |
| 654 | nmdc:mga04h51_40559_c1 | 3300050495 | Bacteria | 1518 |
| 655 | nmdc:mga07m45_192830_c1 | 3300050496 | Bacteria | 1185 |
| 656 | nmdc:mga05p37_100218_c2 | 3300050507 | Bacteria | 2587 |
| 657 | nmdc:mga05p37_1373286_c1 | 3300050507 | Bacteria | 714 |
| 658 | nmdc:mga05p37_227931_c1 | 3300050507 | Bacteria | 2246 |
| 659 | nmdc:mga05p37_236167_c1 | 3300050507 | Bacteria | 2200 |
| 660 | nmdc:mga09592_5580_c1 | 3300050508 | Bacteria | 10247 |
| 661 | nmdc:mga0qj67_1051493_c1 | 3300050509 | Bacteria | 637 |
| 662 | nmdc:mga0qj67_45155_c1 | 3300050509 | Bacteria | 3476 |
| 663 | nmdc:mga06r32_1081904_c1 | 3300050510 | Bacteria | 751 |
| 664 | nmdc:mga06r32_1897534_c1 | 3300050510 | Bacteria | 530 |
| 665 | nmdc:mga06r32_6286_c1 | 3300050510 | Bacteria | 10667 |
| 666 | nmdc:mga08y16_1352395_c1 | 3300050511 | Bacteria | 677 |
| 667 | nmdc:mga0a205_820048_c1 | 3300050515 | Bacteria | 778 |
| 668 | Ga0495601_0031520 | 3300053077 | Bacteria | 3295 |
| 669 | Ga0500610_0042187 | 3300053079 | Bacteria | 2361 |
| 670 | Ga0500635_0150044 | 3300053080 | Bacteria | 889 |
| 671 | Ga0495655_0078114 | 3300053083 | Bacteria | 940 |
| 672 | Ga0495655_0200208 | 3300053083 | Bacteria | 653 |
| 673 | Ga0500583_0332878 | 3300053092 | Bacteria | 738 |
| 674 | Ga0500640_112165 | 3300053095 | Bacteria | 1107 |
| 675 | Ga0500650_0343647 | 3300053098 | Bacteria | 654 |
| 676 | Ga0500560_026028 | 3300053107 | Bacteria | 1723 |
| 677 | Ga0500608_219170 | 3300053122 | Bacteria | 770 |
| 678 | Ga0500573_0145828 | 3300053140 | Bacteria | 1300 |
| 679 | Ga0500600_0159501 | 3300053149 | Bacteria | 1111 |
| 680 | Ga0501084_0105787 | 3300054114 | Bacteria | 2363 |
| 681 | Ga0501084_0554106 | 3300054114 | Bacteria | 971 |
| 682 | Ga0501082_0014792 | 3300060353 | Bacteria | 6719 |
| 683 | Ga0501082_0992792 | 3300060353 | Bacteria | 734 |
| 684 | Ga0501082_1620757 | 3300060353 | Bacteria | 565 |
| 685 | Ga0466962_0173239 | 3300061719 | Bacteria | 1051 |
| 686 | Ga0466962_0238865 | 3300061719 | Bacteria | 892 |
| 687 | Ga0466962_0275704 | 3300061719 | Bacteria | 829 |
| 688 | Ga0530510_0023169 | 3300061734 | Bacteria | 4422 |
| 689 | Ga0530510_0206636 | 3300061734 | Bacteria | 1459 |
| 690 | Ga0530510_0296000 | 3300061734 | Bacteria | 1211 |
| 691 | 8056453216 | 8056447290 | Bacteria | 7680491 |
| 692 | 2547410352 | 2547132111 | Bacteria | 8013147 |
| 693 | 2585314689 | 2582581314 | Bacteria | 11452267 |
| 694 | 2616698302 | 2616644814 | Bacteria | 11555299 |
| 695 | 2644438838 | 2643221678 | Bacteria | 9540101 |
| 696 | 2644631259 | 2643221714 | Bacteria | 9015452 |
| 697 | 2760621704 | 2758568621 | Bacteria | 5967089 |
| 698 | 2785340020 | 2784746763 | Bacteria | 9783172 |
| 699 | 2808845049 | 2808606359 | Bacteria | 9866990 |
| 700 | 2808914650 | 2808606375 | Bacteria | 9466072 |
| 701 | 2812354641 | 2811994879 | Bacteria | 9313447 |
| 702 | 2812477614 | 2811994917 | Bacteria | 7761064 |
| 703 | 2852636260 | 2852635781 | Bacteria | 8251373 |
| 704 | 2862283344 | 2862281513 | Bacteria | 9621493 |
| 705 | 2862576400 | 2862574272 | Bacteria | 10567477 |
| 706 | 2866552104 | 2866552031 | Bacteria | 5824618 |
| 707 | 2919471157 | 2919468124 | Bacteria | 9133025 |
| 708 | 2946071022 | 2946064051 | Bacteria | 8957905 |
| 709 | 2946078953 | 2946072368 | Bacteria | 8999607 |
| 710 | 2947225692 | 2947224130 | Bacteria | 9938529 |
| 711 | 2954009848 | 2954002825 | Bacteria | 9173742 |
| 712 | 3006490187 | 3006486233 | Bacteria | 8157040 |
| 713 | 3006494272 | 3006493962 | Bacteria | 8825450 |
| 714 | 8048407104 | 8048406513 | Bacteria | 8936924 |
| 715 | 8056583409 | 8056579771 | Bacteria | 5840325 |
| 716 | JGI24739J22299_10018725 | |||
| 717 | JGI24737J22298_10019421 | |||
| 718 | JGI24735J21928_10036069 | |||
| 719 | rootH1_10031179 | |||
| 720 | rootH1_10094779 | |||
| 721 | JGI25160J50197_1031211 | |||
| 722 | Ga0006562J51391_1142362 | |||
| 723 | Ga0006562J51391_1142363 | |||
| 724 | Ga0070658_10006816 | |||
| 725 | Ga0070658_11400518 | |||
| 726 | Ga0070682_100898267 | |||
| 727 | Ga0070660_100145701 | |||
| 728 | Ga0070668_102267272 | |||
| 729 | Ga0070663_100006719 | |||
| 730 | Ga0070678_100235924 | |||
| 731 | Ga0070681_10249695 | |||
| 732 | Ga0070679_100121308 | |||
| 733 | Ga0070684_100456967 | |||
| 734 | Ga0070672_100304735 | |||
| 735 | Ga0070672_100431400 | |||
| 736 | Ga0070665_100217143 | |||
| 737 | Ga0068855_100011209 | |||
| 738 | Ga0068855_100277355 | |||
| 739 | Ga0068855_100476585 | |||
| 740 | Ga0068857_100330486 | |||
| 741 | Ga0068854_100278884 | |||
| 742 | Ga0068854_101339888 | |||
| 743 | Ga0068856_100158735 | |||
| 744 | Ga0068856_101992018 | |||
| 745 | Ga0070702_100539194 | |||
| 746 | Ga0068852_100038532 | |||
| 747 | Ga0068852_100398373 | |||
| 748 | Ga0068864_101518123 | |||
| 749 | Ga0068864_102146298 | |||
| 750 | Ga0068870_10716809 | |||
| 751 | Ga0068858_101063366 | |||
| 752 | Ga0081455_10003247 | |||
| 753 | Ga0081455_10041478 | |||
| 754 | Ga0081538_10088414 | |||
| 755 | Ga0081540_1253589 | |||
| 756 | Ga0075365_10079090 | |||
| 757 | Ga0075365_10427871 | |||
| 758 | Ga0075368_10069160 | |||
| 759 | Ga0075363_100015288 | |||
| 760 | Ga0075367_10006132 | |||
| 761 | Ga0097621_100560374 | |||
| 762 | Ga0075370_10338190 | |||
| 763 | Ga0068871_101346987 | |||
| 764 | Ga0075428_100035302 | |||
| 765 | Ga0075428_101014707 | |||
| 766 | Ga0075430_100675812 | |||
| 767 | Ga0075431_100089619 | |||
| 768 | Ga0075431_100668612 | |||
| 769 | Ga0075431_100773012 | |||
| 770 | Ga0075429_100011346 | |||
| 771 | Ga0075429_100138821 | |||
| 772 | Ga0075429_100304205 | |||
| 773 | Ga0075435_101976435 | |||
| 774 | Ga0105251_10011492 | |||
| 775 | Ga0105244_10525261 | |||
| 776 | Ga0105240_10019389 | |||
| 777 | Ga0105240_10500753 | |||
| 778 | Ga0111539_10706666 | |||
| 779 | Ga0111539_12068344 | |||
| 780 | Ga0105245_10252623 | |||
| 781 | Ga0105245_10423681 | |||
| 782 | Ga0105247_10187324 | |||
| 783 | Ga0114129_10052243 | |||
| 784 | Ga0114129_10111674 | |||
| 785 | Ga0114129_10289187 | |||
| 786 | Ga0114129_11446791 | |||
| 787 | Ga0114129_12125084 | |||
| 788 | Ga0105243_10317925 | |||
| 789 | Ga0105241_12142344 | |||
| 790 | Ga0105238_10125386 | |||
| 791 | Ga0105238_10400724 | |||
| 792 | Ga0105238_10767266 | |||
| 793 | Ga0105238_11212292 | |||
| 794 | Ga0105239_10495426 | |||
| 795 | Ga0105239_10559483 | |||
| 796 | Ga0105239_10635426 | |||
| 797 | Ga0105239_12386531 | |||
| 798 | Ga0105246_11107875 | |||
| 799 | Ga0105246_11367457 | |||
| 800 | Ga0105246_11575935 | |||
| 801 | Ga0157370_10018850 | |||
| 802 | Ga0157370_10654823 | |||
| 803 | Ga0157369_10003787 | |||
| 804 | Ga0157369_10151246 | |||
| 805 | Ga0157369_10164437 | |||
| 806 | Ga0157369_10178579 | |||
| 807 | Ga0157374_10772308 | |||
| 808 | Ga0163162_10744787 | |||
| 809 | Ga0163162_12143626 | |||
| 810 | Ga0157372_11005931 | |||
| 811 | Ga0157375_10220469 | |||
| 812 | Ga0157375_11846043 | |||
| 813 | Ga0163163_10007437 | |||
| 814 | Ga0157380_11723682 | |||
| 815 | Ga0182008_10002907 | |||
| 816 | Ga0157377_10465746 | |||
| 817 | Ga0157377_10768321 | |||
| 818 | Ga0157376_10946181 | |||
| 819 | Ga0182007_10000950 | |||
| 820 | Ga0183367_1001 | |||
| 821 | Ga0206356_10164245 | |||
| 822 | Ga0206356_11140472 | |||
| 823 | Ga0206350_11633130 | |||
| 824 | Ga0206353_10286961 | |||
| 825 | Ga0213876_10005107 | |||
| 826 | Ga0213875_10124131 | |||
| 827 | Ga0224712_10140882 | |||
| 828 | Ga0209758_1065708 | |||
| 829 | Ga0207426_1039193 | |||
| 830 | Ga0207426_1093605 | |||
| 831 | Ga0207692_10002711 | |||
| 832 | Ga0207688_10241221 | |||
| 833 | Ga0207647_10007299 | |||
| 834 | Ga0207705_10017069 | |||
| 835 | Ga0207705_10757886 | |||
| 836 | Ga0207707_10664077 | |||
| 837 | Ga0207695_10058844 | |||
| 838 | Ga0207662_10719632 | |||
| 839 | Ga0207657_10105485 | |||
| 840 | Ga0207652_10619898 | |||
| 841 | Ga0207650_11137412 | |||
| 842 | Ga0207650_11610834 | |||
| 843 | Ga0207687_10336008 | |||
| 844 | Ga0207644_10153354 | |||
| 845 | Ga0207704_10300518 | |||
| 846 | Ga0207691_10797093 | |||
| 847 | Ga0207661_10552582 | |||
| 848 | Ga0207679_10805011 | |||
| 849 | Ga0207667_10091857 | |||
| 850 | Ga0207667_10256194 | |||
| 851 | Ga0207640_10371360 | |||
| 852 | Ga0207703_11486926 | |||
| 853 | Ga0207678_10402151 | |||
| 854 | Ga0207678_10769500 | |||
| 855 | Ga0207678_11583745 | |||
| 856 | Ga0207702_10091854 | |||
| 857 | Ga0207702_10715802 | |||
| 858 | Ga0207676_11276984 | |||
| 859 | Ga0207674_11272104 | |||
| 860 | Ga0207683_10081030 | |||
| 861 | Ga0207698_10131439 | |||
| 862 | Ga0209813_10034053 | |||
| 863 | Ga0307517_10008570 | |||
| 864 | Ga0307515_10000055 | |||
| 865 | Ga0307515_10589765 | |||
| 866 | Ga0307511_10005039 | |||
| 867 | Ga0307512_10001679 | |||
| 868 | Ga0307512_10030025 | |||
| 869 | Ga0265325_10031223 | |||
| 870 | Ga0265316_10386244 | |||
| 871 | Ga0265316_10432058 | |||
| 872 | Ga0265316_10820611 | |||
| 873 | Ga0307513_10063411 | |||
| 874 | Ga0307513_10074197 | |||
| 875 | Ga0307513_10117343 | |||
| 876 | Ga0307509_10011445 | |||
| 877 | Ga0307509_10062862 | |||
| 878 | Ga0307509_10979956 | |||
| 879 | Ga0265313_10114539 | |||
| 880 | Ga0307508_10005498 | |||
| 881 | Ga0307508_10014620 | |||
| 882 | Ga0307508_10044237 | |||
| 883 | Ga0307508_10132527 | |||
| 884 | Ga0307514_10003936 | |||
| 885 | Ga0307514_10120205 | |||
| 886 | Ga0307514_10232175 | |||
| 887 | Ga0307514_10255439 | |||
| 888 | Ga0307514_10554344 | |||
| 889 | Ga0265342_10030213 | |||
| 890 | Ga0307516_10005424 | |||
| 891 | Ga0307516_10057248 | |||
| 892 | Ga0307405_10788739 | |||
| 893 | Ga0307518_10044734 | |||
| 894 | Ga0307518_10122296 | |||
| 895 | Ga0307518_10142690 | |||
| 896 | Ga0307518_10229721 | |||
| 897 | Ga0307410_10630621 | |||
| 898 | Ga0307410_10840635 | |||
| 899 | Ga0307410_10920252 | |||
| 900 | Ga0307406_11980453 | |||
| 901 | Ga0307407_10070745 | |||
| 902 | Ga0307409_100411040 | |||
| 903 | Ga0307409_102057347 | |||
| 904 | Ga0307409_102117920 | |||
| 905 | Ga0307416_100311642 | |||
| 906 | Ga0307416_100404537 | |||
| 907 | Ga0307416_100477534 | |||
| 908 | Ga0307411_12190644 | |||
| 909 | Ga0307415_100492148 | |||
| 910 | Ga0307415_100712123 | |||
| 911 | Ga0307415_101789127 | |||
| 912 | Ga0307507_10020179 | |||
| 913 | Ga0307507_10099825 | |||
| 914 | Ga0307507_10309809 | |||
| 915 | Ga0307507_10415078 | |||
| 916 | Ga0307510_10003883 | |||
| 917 | Ga0307510_10037906 | |||
| 918 | Ga0307510_10073467 | |||
| 919 | Ga0373925_1695586 | |||
| 920 | Ga0395899_0116380 | |||
| 921 | Ga0395899_0428144 | |||
| 922 | Ga0395900_0342142 | |||
| 923 | Ga0395900_0626099 | |||
| 924 | Ga0395898_0015607 | |||
| 925 | Ga0395898_1259561 | |||
| 926 | Ga0395905_0442762 | |||
| 927 | Ga0395905_1893072 | |||
| 928 | Ga0395901_0028755 | |||
| 929 | Ga0395901_0113160 | |||
| 930 | Ga0395901_0183602 | |||
| 931 | Ga0436365_0198832 | |||
| 932 | Ga0439436_0001664 | |||
| 933 | Ga0439436_0013351 | |||
| 934 | Ga0439439_0000277 | |||
| 935 | Ga0451789_0678980 | |||
| 936 | Ga0451791_1483709 | |||
| 937 | Ga0451793_0786765 | |||
| 938 | Ga0451793_1110178 | |||
| 939 | Ga0451793_1528231 | |||
| 940 | Ga0451802_1453876 | |||
| 941 | Ga0451807_0509614 | |||
| 942 | Ga0451833_0326702 | |||
| 943 | Ga0451837_0087430 | |||
| 944 | Ga0451837_0817873 | |||
| 945 | Ga0451843_0990492 | |||
| 946 | Ga0451855_0094309 | |||
| 947 | Ga0451853_1236761 | |||
| 948 | Ga0451853_1515807 | |||
| 949 | Ga0451853_2584007 | |||
| 950 | Ga0439431_0091602 | |||
| 951 | Ga0439433_0001898 | |||
| 952 | Ga0439433_0052820 | |||
| 953 | Ga0439442_013660 | |||
| 954 | Ga0439448_0140665 | |||
| 955 | Ga0439449_0006067 | |||
| 956 | Ga0439449_0022466 | |||
| 957 | Ga0439449_0379301 | |||
| 958 | Ga0439457_000624 | |||
| 959 | Ga0439457_004423 | |||
| 960 | Ga0439457_029313 | |||
| 961 | Ga0439462_0020986 | |||
| 962 | Ga0439462_0124966 | |||
| 963 | Ga0450894_000246 | |||
| 964 | Ga0450895_001203 | |||
| 965 | Ga0450896_001733 | |||
| 966 | Ga0450898_001110 | |||
| 967 | Ga0450899_002776 | |||
| 968 | Ga0450900_004770 | |||
| 969 | Ga0450900_005948 | |||
| 970 | Ga0450903_027868 | |||
| 971 | Ga0450906_000846 | |||
| 972 | Ga0450906_030310 | |||
| 973 | Ga0450908_036290 | |||
| 974 | Ga0439440_0194127 | |||
| 975 | Ga0466969_0214090 | |||
| 976 | Ga0466972_0001151 | |||
| 977 | Ga0466972_0034261 | |||
| 978 | Ga0466972_0110992 | |||
| 979 | Ga0466965_0000638 | |||
| 980 | Ga0466965_0012782 | |||
| 981 | Ga0466965_0513654 | |||
| 982 | Ga0466966_0002173 | |||
| 983 | Ga0466966_0013308 | |||
| 984 | Ga0466961_0001217 | |||
| 985 | Ga0466961_0129700 | |||
| 986 | Ga0466961_0132332 | |||
| 987 | Ga0466961_0543012 | |||
| 988 | Ga0466963_0000129 | |||
| 989 | Ga0466971_0000778 | |||
| 990 | Ga0466971_0319402 | |||
| 991 | Ga0466968_0014317 | |||
| 992 | Ga0466968_0242224 | |||
| 993 | Ga0466970_0008329 | |||
| 994 | Ga0466970_0036335 | |||
| 995 | Ga0466970_0123191 | |||
| 996 | Ga0466970_0154291 | |||
| 997 | Ga0466957_0000368 | |||
| 998 | Ga0466957_0050723 | |||
| 999 | Ga0466957_1192520 | |||
| 1000 | Ga0466960_0003070 | |||
| 1001 | Ga0466960_0041004 | |||
| 1002 | Ga0466960_0074533 | |||
| 1003 | Ga0466959_0002086 | |||
| 1004 | Ga0466959_0004621 | |||
| 1005 | Ga0466958_0010824 | |||
| 1006 | Ga0466958_0018698 | |||
| 1007 | Ga0466958_0951357 | |||
| 1008 | Ga0466967_0001454 | |||
| 1009 | Ga0466967_0211306 | |||
| 1010 | Ga0466967_1851318 | |||
| 1011 | Ga0466967_2369096 | |||
| 1012 | Ga0495617_009899 | |||
| 1013 | Ga0495627_095387 | |||
| 1014 | Ga0495627_180165 | |||
| 1015 | Ga0495592_0004681 | |||
| 1016 | Ga0495592_0019703 | |||
| 1017 | Ga0495603_0000883 | |||
| 1018 | Ga0495603_0002066 | |||
| 1019 | Ga0495603_0127013 | |||
| 1020 | Ga0495603_0673520 | |||
| 1021 | Ga0495590_0045820 | |||
| 1022 | Ga0495629_0004727 | |||
| 1023 | Ga0495629_0008787 | |||
| 1024 | Ga0495629_0015459 | |||
| 1025 | Ga0495629_0025163 | |||
| 1026 | Ga0495629_0032391 | |||
| 1027 | Ga0495629_0074786 | |||
| 1028 | Ga0495629_0101880 | |||
| 1029 | Ga0495629_0149975 | |||
| 1030 | Ga0495629_0379962 | |||
| 1031 | Ga0495638_0055762 | |||
| 1032 | Ga0495638_0093666 | |||
| 1033 | Ga0495638_0179691 | |||
| 1034 | Ga0495651_0002968 | |||
| 1035 | Ga0495651_0040550 | |||
| 1036 | Ga0495582_0360594 | |||
| 1037 | Ga0495582_0561320 | |||
| 1038 | Ga0495605_0038106 | |||
| 1039 | Ga0495605_0203349 | |||
| 1040 | Ga0495639_0356696 | |||
| 1041 | Ga0495662_0002080 | |||
| 1042 | Ga0495662_0008434 | |||
| 1043 | Ga0495662_0022243 | |||
| 1044 | Ga0495662_0023392 | |||
| 1045 | Ga0495664_0002020 | |||
| 1046 | Ga0495664_0031613 | |||
| 1047 | Ga0495664_0098388 | |||
| 1048 | Ga0495584_0042402 | |||
| 1049 | Ga0495584_0474648 | |||
| 1050 | Ga0495584_0661004 | |||
| 1051 | Ga0495585_0023861 | |||
| 1052 | Ga0495585_0058374 | |||
| 1053 | Ga0495585_0073561 | |||
| 1054 | Ga0495594_0007673 | |||
| 1055 | Ga0495594_0011289 | |||
| 1056 | Ga0495594_0029462 | |||
| 1057 | Ga0495594_0218288 | |||
| 1058 | Ga0495594_0504159 | |||
| 1059 | Ga0495596_0049844 | |||
| 1060 | Ga0495607_0057371 | |||
| 1061 | Ga0495607_0121337 | |||
| 1062 | Ga0495583_0101480 | |||
| 1063 | Ga0495606_0005584 | |||
| 1064 | Ga0495610_0100692 | |||
| 1065 | Ga0495616_0011610 | |||
| 1066 | Ga0495618_0862011 | |||
| 1067 | Ga0495620_0016511 | |||
| 1068 | Ga0495620_0274894 | |||
| 1069 | Ga0495628_0032667 | |||
| 1070 | Ga0495628_0088008 | |||
| 1071 | Ga0495631_0023616 | |||
| 1072 | Ga0495631_0126399 | |||
| 1073 | Ga0495666_0039688 | |||
| 1074 | Ga0495652_0006571 | |||
| 1075 | Ga0495654_0108745 | |||
| 1076 | Ga0495640_0008892 | |||
| 1077 | Ga0495640_0013078 | |||
| 1078 | Ga0495640_0109040 | |||
| 1079 | Ga0495586_0020653 | |||
| 1080 | Ga0495586_0557647 | |||
| 1081 | Ga0495587_0001315 | |||
| 1082 | Ga0495609_0027039 | |||
| 1083 | Ga0495597_0136174 | |||
| 1084 | Ga0495645_0064905 | |||
| 1085 | Ga0495645_0086382 | |||
| 1086 | Ga0495622_0008887 | |||
| 1087 | Ga0495622_0019711 | |||
| 1088 | Ga0495622_0021710 | |||
| 1089 | Ga0495633_0034714 | |||
| 1090 | Ga0495667_0011894 | |||
| 1091 | Ga0495667_0103648 | |||
| 1092 | Ga0495656_0054646 | |||
| 1093 | Ga0495668_0005892 | |||
| 1094 | Ga0495634_0001504 | |||
| 1095 | Ga0495634_0008952 | |||
| 1096 | Ga0495611_0109177 | |||
| 1097 | Ga0495625_0102774 | |||
| 1098 | Ga0495625_0266251 | |||
| 1099 | Ga0495625_0353043 | |||
| 1100 | Ga0495635_0002277 | |||
| 1101 | Ga0495661_0138994 | |||
| 1102 | Ga0495588_0014942 | |||
| 1103 | Ga0495588_0076233 | |||
| 1104 | Ga0495657_0001502 | |||
| 1105 | Ga0495657_0002117 | |||
| 1106 | Ga0495657_0010589 | |||
| 1107 | Ga0495657_0055636 | |||
| 1108 | Ga0495623_0166931 | |||
| 1109 | Ga0495646_0002770 | |||
| 1110 | Ga0495646_0018961 | |||
| 1111 | Ga0495658_0252564 | |||
| 1112 | Ga0495613_0000504 | |||
| 1113 | Ga0495613_0006490 | |||
| 1114 | Ga0495613_0015763 | |||
| 1115 | Ga0495613_0026570 | |||
| 1116 | Ga0495624_0038983 | |||
| 1117 | Ga0495624_0245921 | |||
| 1118 | Ga0495670_0114759 | |||
| 1119 | Ga0495670_0732025 | |||
| 1120 | Ga0495671_0031677 | |||
| 1121 | Ga0495649_0066862 | |||
| 1122 | Ga0495649_0076533 | |||
| 1123 | Ga0495649_0442738 | |||
| 1124 | Ga0495589_0026365 | |||
| 1125 | Ga0495589_0027001 | |||
| 1126 | Ga0495589_0084206 | |||
| 1127 | Ga0495600_0062820 | |||
| 1128 | Ga0495600_0103587 | |||
| 1129 | Ga0495660_0164212 | |||
| 1130 | Ga0495581_0001340 | |||
| 1131 | Ga0495581_0053969 | |||
| 1132 | Ga0495581_0097233 | |||
| 1133 | Ga0495581_0229368 | |||
| 1134 | Ga0495604_0000224 | |||
| 1135 | Ga0495636_0000633 | |||
| 1136 | Ga0495636_0000901 | |||
| 1137 | Ga0495636_0014480 | |||
| 1138 | Ga0495636_0038743 | |||
| 1139 | Ga0495676_0001049 | |||
| 1140 | Ga0495676_0012880 | |||
| 1141 | Ga0495676_0069297 | |||
| 1142 | Ga0495680_0386063 | |||
| 1143 | Ga0495683_0066444 | |||
| 1144 | Ga0495687_005384 | |||
| 1145 | Ga0495675_0025171 | |||
| 1146 | Ga0495675_0153415 | |||
| 1147 | Ga0495675_0253668 | |||
| 1148 | Ga0495675_0654691 | |||
| 1149 | Ga0495685_003058 | |||
| 1150 | Ga0495685_010441 | |||
| 1151 | Ga0495685_015035 | |||
| 1152 | Ga0495685_052807 | |||
| 1153 | Ga0495685_258438 | |||
| 1154 | Ga0495681_0000970 | |||
| 1155 | Ga0495681_0009462 | |||
| 1156 | Ga0495686_0033272 | |||
| 1157 | Ga0495686_0045072 | |||
| 1158 | Ga0495593_0004149 | |||
| 1159 | Ga0495593_0454803 | |||
| 1160 | Ga0495614_0009644 | |||
| 1161 | Ga0495614_0020482 | |||
| 1162 | Ga0495614_0132366 | |||
| 1163 | Ga0496100_0147717 | |||
| 1164 | Ga0496101_0644271 | |||
| 1165 | Ga0496101_0733515 | |||
| 1166 | Ga0496102_0017905 | |||
| 1167 | Ga0496104_0082517 | |||
| 1168 | Ga0496104_0133586 | |||
| 1169 | Ga0496105_0036484 | |||
| 1170 | Ga0496106_0093410 | |||
| 1171 | Ga0496107_0270190 | |||
| 1172 | Ga0496108_0126703 | |||
| 1173 | Ga0496108_0291570 | |||
| 1174 | Ga0496108_0458515 | |||
| 1175 | Ga0496109_0043887 | |||
| 1176 | Ga0496109_0225992 | |||
| 1177 | Ga0496111_0170439 | |||
| 1178 | Ga0496111_0400997 | |||
| 1179 | Ga0496112_0021197 | |||
| 1180 | Ga0496113_0097084 | |||
| 1181 | Ga0496113_0183370 | |||
| 1182 | Ga0496113_0244033 | |||
| 1183 | Ga0496114_0033438 | |||
| 1184 | Ga0496126_0379622 | |||
| 1185 | Ga0495678_031590 | |||
| 1186 | Ga0495682_0230675 | |||
| 1187 | Ga0501315_095244 | |||
| 1188 | Ga0501317_030411 | |||
| 1189 | Ga0501318_073324 | |||
| 1190 | Ga0501318_089692 | |||
| 1191 | Ga0501323_036861 | |||
| 1192 | Ga0501325_016193 | |||
| 1193 | Ga0501031_0015014 | |||
| 1194 | Ga0501031_0109839 | |||
| 1195 | Ga0501031_0116460 | |||
| 1196 | Ga0501031_0132976 | |||
| 1197 | Ga0501031_0158187 | |||
| 1198 | Ga0501032_0013917 | |||
| 1199 | Ga0501032_0018356 | |||
| 1200 | Ga0501032_0036251 | |||
| 1201 | Ga0501032_0039377 | |||
| 1202 | Ga0501032_0146077 | |||
| 1203 | Ga0501032_0219001 | |||
| 1204 | Ga0501032_0622688 | |||
| 1205 | Ga0501033_0015677 | |||
| 1206 | Ga0501033_0022607 | |||
| 1207 | Ga0501033_0039312 | |||
| 1208 | Ga0501033_0044544 | |||
| 1209 | Ga0501033_0059535 | |||
| 1210 | Ga0501033_0093770 | |||
| 1211 | Ga0501033_0885680 | |||
| 1212 | Ga0501034_0007629 | |||
| 1213 | Ga0501034_0012767 | |||
| 1214 | Ga0501034_0034559 | |||
| 1215 | Ga0501034_0036980 | |||
| 1216 | Ga0501034_0139109 | |||
| 1217 | Ga0501034_0155218 | |||
| 1218 | Ga0501034_0178907 | |||
| 1219 | Ga0501034_0595628 | |||
| 1220 | Ga0501036_0000646 | |||
| 1221 | Ga0501036_0002377 | |||
| 1222 | Ga0501036_0003261 | |||
| 1223 | Ga0501036_0026384 | |||
| 1224 | Ga0501036_0049459 | |||
| 1225 | Ga0501036_0157782 | |||
| 1226 | Ga0501036_0194958 | |||
| 1227 | Ga0501036_1190188 | |||
| 1228 | Ga0501037_0003632 | |||
| 1229 | Ga0501037_0018008 | |||
| 1230 | Ga0501037_0045919 | |||
| 1231 | Ga0501037_0258354 | |||
| 1232 | Ga0501037_0585534 | |||
| 1233 | Ga0501037_0714480 | |||
| 1234 | Ga0501037_0802454 | |||
| 1235 | Ga0501038_0007197 | |||
| 1236 | Ga0501038_0013826 | |||
| 1237 | Ga0501038_0022553 | |||
| 1238 | Ga0501038_0036215 | |||
| 1239 | Ga0501038_0114150 | |||
| 1240 | Ga0501038_0141801 | |||
| 1241 | Ga0501038_0159776 | |||
| 1242 | Ga0501038_0169883 | |||
| 1243 | Ga0501038_1216345 | |||
| 1244 | Ga0501039_0007975 | |||
| 1245 | Ga0501039_0008978 | |||
| 1246 | Ga0501039_0034309 | |||
| 1247 | Ga0501039_0058172 | |||
| 1248 | Ga0501039_0299247 | |||
| 1249 | Ga0501039_0450613 | |||
| 1250 | Ga0501040_0002541 | |||
| 1251 | Ga0501040_0013708 | |||
| 1252 | Ga0501040_0086994 | |||
| 1253 | Ga0501041_0001751 | |||
| 1254 | Ga0501041_0147164 | |||
| 1255 | Ga0501041_0588504 | |||
| 1256 | Ga0501042_0056661 | |||
| 1257 | Ga0501042_0078551 | |||
| 1258 | Ga0501043_0008976 | |||
| 1259 | Ga0501043_0013972 | |||
| 1260 | Ga0501043_0017493 | |||
| 1261 | Ga0501043_0020833 | |||
| 1262 | Ga0501043_0030131 | |||
| 1263 | Ga0501043_0046081 | |||
| 1264 | Ga0501043_0050912 | |||
| 1265 | Ga0501043_0171761 | |||
| 1266 | Ga0501043_0664780 | |||
| 1267 | Ga0501046_0019522 | |||
| 1268 | Ga0501046_0057042 | |||
| 1269 | Ga0501046_0136659 | |||
| 1270 | Ga0501046_0425137 | |||
| 1271 | Ga0501046_0499734 | |||
| 1272 | Ga0501047_0002168 | |||
| 1273 | Ga0501047_0021536 | |||
| 1274 | Ga0501047_0044156 | |||
| 1275 | Ga0501047_0050033 | |||
| 1276 | Ga0501047_0050785 | |||
| 1277 | Ga0501047_0102940 | |||
| 1278 | Ga0501047_0159408 | |||
| 1279 | Ga0501047_0316684 | |||
| 1280 | Ga0501047_1236970 | |||
| 1281 | Ga0501048_0010396 | |||
| 1282 | Ga0501048_0037284 | |||
| 1283 | Ga0501048_0049294 | |||
| 1284 | Ga0501048_0443511 | |||
| 1285 | Ga0501048_1084327 | |||
| 1286 | Ga0501067_0006655 | |||
| 1287 | Ga0501067_0020907 | |||
| 1288 | Ga0501067_0038586 | |||
| 1289 | Ga0501067_0175183 | |||
| 1290 | Ga0501067_0419001 | |||
| 1291 | Ga0501068_0001171 | |||
| 1292 | Ga0501068_0215709 | |||
| 1293 | Ga0501068_0217055 | |||
| 1294 | Ga0501069_0008895 | |||
| 1295 | Ga0501069_0034515 | |||
| 1296 | Ga0501069_0082110 | |||
| 1297 | Ga0501069_0185919 | |||
| 1298 | Ga0501069_0284407 | |||
| 1299 | Ga0501069_0591684 | |||
| 1300 | Ga0501070_0004802 | |||
| 1301 | Ga0501070_0012556 | |||
| 1302 | Ga0501070_0028923 | |||
| 1303 | Ga0501070_0147189 | |||
| 1304 | Ga0501070_0841512 | |||
| 1305 | Ga0501070_1413567 | |||
| 1306 | Ga0501071_0000482 | |||
| 1307 | Ga0501071_0076775 | |||
| 1308 | Ga0501071_0623119 | |||
| 1309 | Ga0501072_0003972 | |||
| 1310 | Ga0501072_0005647 | |||
| 1311 | Ga0501072_0031379 | |||
| 1312 | Ga0501072_0160405 | |||
| 1313 | Ga0501072_0176391 | |||
| 1314 | Ga0501072_0482470 | |||
| 1315 | Ga0501073_0018390 | |||
| 1316 | Ga0501074_0002011 | |||
| 1317 | Ga0501074_0119151 | |||
| 1318 | Ga0501074_0199086 | |||
| 1319 | Ga0501074_0397625 | |||
| 1320 | Ga0501075_0072038 | |||
| 1321 | Ga0501076_0017285 | |||
| 1322 | Ga0501076_0028989 | |||
| 1323 | Ga0501077_0030242 | |||
| 1324 | Ga0501077_0062707 | |||
| 1325 | Ga0501209_206176 | |||
| 1326 | Ga0501214_025901 | |||
| 1327 | Ga0501079_0007398 | |||
| 1328 | Ga0501079_0846870 | |||
| 1329 | Ga0501080_0024714 | |||
| 1330 | Ga0501080_0128855 | |||
| 1331 | Ga0501080_0460955 | |||
| 1332 | Ga0501080_0906390 | |||
| 1333 | Ga0501081_0905177 | |||
| 1334 | Ga0501083_0001134 | |||
| 1335 | Ga0501083_0099889 | |||
| 1336 | Ga0501035_0004736 | |||
| 1337 | Ga0501035_0019427 | |||
| 1338 | Ga0501035_0021596 | |||
| 1339 | Ga0501035_0023699 | |||
| 1340 | Ga0501035_0028830 | |||
| 1341 | Ga0501035_0031773 | |||
| 1342 | Ga0501035_0058750 | |||
| 1343 | Ga0501035_0121238 | |||
| 1344 | Ga0501035_0124524 | |||
| 1345 | Ga0501035_0179842 | |||
| 1346 | Ga0501035_0199559 | |||
| 1347 | Ga0501035_0441671 | |||
| 1348 | Ga0501035_0482919 | |||
| 1349 | Ga0501044_0000976 | |||
| 1350 | Ga0501044_0009892 | |||
| 1351 | Ga0501044_0020298 | |||
| 1352 | Ga0501044_0031412 | |||
| 1353 | Ga0501044_0068718 | |||
| 1354 | Ga0501044_0110717 | |||
| 1355 | Ga0501044_0274396 | |||
| 1356 | Ga0501044_0333890 | |||
| 1357 | Ga0501044_1009585 | |||
| 1358 | Ga0501044_1167216 | |||
| 1359 | Ga0501045_0005054 | |||
| 1360 | Ga0501045_0005598 | |||
| 1361 | Ga0501045_0046124 | |||
| 1362 | Ga0501045_0166204 | |||
| 1363 | Ga0501045_0230674 | |||
| 1364 | Ga0501045_0442166 | |||
| 1365 | nmdc:mga03n38_27987_c1 | |||
| 1366 | nmdc:mga0yw44_348455_c1 | |||
| 1367 | nmdc:mga06z11_3487_c1 | |||
| 1368 | nmdc:mga06z11_910127_c1 | |||
| 1369 | nmdc:mga04h51_40559_c1 | |||
| 1370 | nmdc:mga07m45_192830_c1 | |||
| 1371 | nmdc:mga05p37_100218_c2 | |||
| 1372 | nmdc:mga05p37_1373286_c1 | |||
| 1373 | nmdc:mga05p37_227931_c1 | |||
| 1374 | nmdc:mga05p37_236167_c1 | |||
| 1375 | nmdc:mga09592_5580_c1 | |||
| 1376 | nmdc:mga0qj67_1051493_c1 | |||
| 1377 | nmdc:mga0qj67_45155_c1 | |||
| 1378 | nmdc:mga06r32_1081904_c1 | |||
| 1379 | nmdc:mga06r32_1897534_c1 | |||
| 1380 | nmdc:mga06r32_6286_c1 | |||
| 1381 | nmdc:mga08y16_1352395_c1 | |||
| 1382 | nmdc:mga0a205_820048_c1 | |||
| 1383 | Ga0495601_0031520 | |||
| 1384 | Ga0500610_0042187 | |||
| 1385 | Ga0500635_0150044 | |||
| 1386 | Ga0495655_0078114 | |||
| 1387 | Ga0495655_0200208 | |||
| 1388 | Ga0500583_0332878 | |||
| 1389 | Ga0500640_112165 | |||
| 1390 | Ga0500650_0343647 | |||
| 1391 | Ga0500560_026028 | |||
| 1392 | Ga0500608_219170 | |||
| 1393 | Ga0500573_0145828 | |||
| 1394 | Ga0500600_0159501 | |||
| 1395 | Ga0501084_0105787 | |||
| 1396 | Ga0501084_0554106 | |||
| 1397 | Ga0501082_0014792 | |||
| 1398 | Ga0501082_0992792 | |||
| 1399 | Ga0501082_1620757 | |||
| 1400 | Ga0466962_0173239 | |||
| 1401 | Ga0466962_0238865 | |||
| 1402 | Ga0466962_0275704 | |||
| 1403 | Ga0530510_0023169 | |||
| 1404 | Ga0530510_0206636 | |||
| 1405 | Ga0530510_0296000 | |||
| 1406 | 8056453216 | |||
| 1407 | 2547410352 | |||
| 1408 | 2585314689 | |||
| 1409 | 2616698302 | |||
| 1410 | 2644438838 | |||
| 1411 | 2644631259 | |||
| 1412 | 2760621704 | |||
| 1413 | 2785340020 | |||
| 1414 | 2808845049 | |||
| 1415 | 2808914650 | |||
| 1416 | 2812354641 | |||
| 1417 | 2812477614 | |||
| 1418 | 2852636260 | |||
| 1419 | 2862283344 | |||
| 1420 | 2862576400 | |||
| 1421 | 2866552104 | |||
| 1422 | 2919471157 | |||
| 1423 | 2946071022 | |||
| 1424 | 2946078953 | |||
| 1425 | 2947225692 | |||
| 1426 | 2954009848 | |||
| 1427 | 3006490187 | |||
| 1428 | 3006494272 | |||
| 1429 | 8048407104 | |||
| 1430 | 8056583409 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1ukk-assembly1.cif.gz_B | structure of osmotically inducible protein c from thermus thermophilus | 0.9323 | 17 | 156 |
| 1ukk-assembly1.cif.gz_B | structure of osmotically inducible protein c from thermus thermophilus | 0.9196 | 17 | 156 |
| 1qwi-assembly1.cif.gz_B | crystal structure of e. coli osmc | 0.9056 | 16 | 155 |
| 1nye-assembly1.cif.gz_A | crystal structure of osmc from e. coli | 0.9004 | 15 | 156 |
| 1nye-assembly2.cif.gz_D | crystal structure of osmc from e. coli | 0.9001 | 15 | 155 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1ukkB00 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.9182 | 17 | 156 | 3.30.300.20 |
| 1ukkB00 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.9119 | 17 | 156 | 3.30.300.20 |
| af_Q55E30_8_160_3.30.300.20 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.8841 | 18 | 154 | 3.30.300.20 |
| af_Q55EI4_11_156_3.30.300.20 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.8833 | 20 | 156 | 3.30.300.20 |
| 1nyeE00 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.8822 | 10 | 155 | 3.30.300.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W0QLY7-F1-model_v4 | OsmC family peroxiredoxin | 0.9986 | 69 | 156 |
GO:0004601
GO:0006979 |
| AF-A0A6G3XRH8-F1-model_v4 | OsmC family peroxiredoxin | 0.998 | 75 | 156 |
GO:0004601
GO:0006979 |
| AF-A0A7G1NTP2-F1-model_v4 | Peroxiredoxin | 0.995 | 15 | 156 |
GO:0004601
GO:0006979 |
| AF-A0A3Q8VTH2-F1-model_v4 | OsmC family peroxiredoxin | 0.9949 | 15 | 156 |
GO:0004601
GO:0006979 |
| AF-A0A0N0TAM5-F1-model_v4 | Peroxiredoxin | 0.9943 | 30 | 156 |
GO:0004601
GO:0006979 |