F477022

General Info

Members Datasets Scaffolds Average Seq Length
715 352 1430 144

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8056447290|8056453216
Length 174
Sequence GIAPMAVRPYRPIAQHTFRGRRPGRFRHPLEDRMATTRTAHTVWEGELLKGSGTVTFDSSGIGSQPVSWPSRAEQANGKTSPEELIAAAHSSCFSMALSHGLTGAGTPPTRLETKADVTFQPGEGITGIHLWVRGEVPGLDEAGFAAAAEDAKKNCPVSQALAGTTITLSAELA

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
29 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
32 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
33 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
43 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
63 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
66 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
67 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
71 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
72 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
74 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
75 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
101 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
102 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
103 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
104 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
105 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
106 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
107 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
108 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
109 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
110 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
111 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
112 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
113 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
114 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
115 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
116 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
117 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
118 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
119 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
120 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
121 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
122 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
123 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
124 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
125 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
127 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
128 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
129 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
130 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
131 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
132 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
133 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
134 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
135 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
136 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
137 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
138 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
139 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
140 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
141 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
142 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
143 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
144 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
145 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
146 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
147 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
148 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
149 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
150 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
151 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
152 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
153 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
154 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
155 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
156 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
157 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
158 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
159 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
160 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
161 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
162 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
163 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
164 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
165 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
166 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
167 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
168 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
169 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
170 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
171 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
172 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
173 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
174 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
175 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
176 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
177 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
178 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
179 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
180 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
181 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
182 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
183 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
184 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
185 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
186 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
187 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
188 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
189 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
190 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
191 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
192 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
193 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
194 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
195 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
196 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
197 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
198 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
199 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
200 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
201 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
202 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
203 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
204 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
205 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
206 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
207 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
208 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
209 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
210 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
211 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
212 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
213 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
214 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
215 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
216 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
217 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
218 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
219 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
220 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
221 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
222 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
223 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
224 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
225 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
226 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
227 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
228 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
229 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
230 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
231 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
232 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
233 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
234 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
235 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
236 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
237 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
238 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
239 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
240 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
241 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
242 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
243 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
244 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
245 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
246 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
247 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
248 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
249 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
250 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
251 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
252 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
253 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
254 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
255 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
256 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
257 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
258 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
259 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
260 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
261 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
262 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
263 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
264 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
265 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
266 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
267 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
283 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
284 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
285 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
286 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
287 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
288 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
289 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
290 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
291 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
292 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
293 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
294 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
295 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
296 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
297 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
298 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
299 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
302 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
303 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
304 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
305 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
306 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
307 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
308 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
309 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
310 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
311 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
312 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
313 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
314 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
315 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
316 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
317 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
318 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
319 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
320 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
321 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
322 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
323 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
324 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
325 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
326 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
327 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
328 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
329 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
330 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
331 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
332 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
333 2643221714 Streptomyces sp. Root264 Isolate Unclassified
334 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
335 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
336 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
337 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
338 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
339 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
340 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
341 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
342 2862574272 Streptomyces sp. AcE210 Isolate Nodule
343 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
344 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
345 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
346 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
347 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
348 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
349 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
350 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
351 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
352 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.69
Metatranscriptomes 1.82
Isolates 3.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.64
Nodule 0.14
Rhizoplane 3.92
Rhizosphere 83.92
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10018725 3300001989 Bacteria 2485
2 JGI24737J22298_10019421 3300001990 Bacteria 2173
3 JGI24735J21928_10036069 3300002067 Bacteria 1451
4 rootH1_10031179 3300003323 Bacteria 3995
5 rootH1_10094779 3300003323 Bacteria 3533
6 JGI25160J50197_1031211 3300003354 Bacteria 1376
7 Ga0006562J51391_1142362 3300003578 Bacteria 4020
8 Ga0006562J51391_1142363 3300003578 Bacteria 3480
9 Ga0070658_10006816 3300005327 Bacteria 9238
10 Ga0070658_11400518 3300005327 Bacteria 607
11 Ga0070682_100898267 3300005337 Bacteria 728
12 Ga0070660_100145701 3300005339 Bacteria 1902
13 Ga0070668_102267272 3300005347 Bacteria 502
14 Ga0070663_100006719 3300005455 Bacteria 6941
15 Ga0070678_100235924 3300005456 Bacteria 1527
16 Ga0070681_10249695 3300005458 Bacteria 1687
17 Ga0070679_100121308 3300005530 Bacteria 2599
18 Ga0070684_100456967 3300005535 Bacteria 1181
19 Ga0070672_100304735 3300005543 Bacteria 1351
20 Ga0070672_100431400 3300005543 Bacteria 1133
21 Ga0070665_100217143 3300005548 Bacteria 1913
22 Ga0068855_100011209 3300005563 Bacteria 10824
23 Ga0068855_100277355 3300005563 Bacteria 1863
24 Ga0068855_100476585 3300005563 Bacteria 1359
25 Ga0068857_100330486 3300005577 Bacteria 1409
26 Ga0068854_100278884 3300005578 Bacteria 1345
27 Ga0068854_101339888 3300005578 Bacteria 645
28 Ga0068856_100158735 3300005614 Bacteria 2272
29 Ga0068856_101992018 3300005614 Bacteria 591
30 Ga0070702_100539194 3300005615 Bacteria 864
31 Ga0068852_100038532 3300005616 Bacteria 4018
32 Ga0068852_100398373 3300005616 Bacteria 1354
33 Ga0068864_101518123 3300005618 Bacteria 673
34 Ga0068864_102146298 3300005618 Bacteria 565
35 Ga0068870_10716809 3300005840 Bacteria 692
36 Ga0068858_101063366 3300005842 Bacteria 794
37 Ga0081455_10003247 3300005937 Bacteria 18828
38 Ga0081455_10041478 3300005937 Bacteria 4046
39 Ga0081538_10088414 3300005981 Bacteria 1613
40 Ga0081540_1253589 3300005983 Bacteria 613
41 Ga0075365_10079090 3300006038 Bacteria 2225
42 Ga0075365_10427871 3300006038 Bacteria 935
43 Ga0075368_10069160 3300006042 Bacteria 1424
44 Ga0075363_100015288 3300006048 Bacteria 3770
45 Ga0075367_10006132 3300006178 Bacteria 6047
46 Ga0097621_100560374 3300006237 Bacteria 1041
47 Ga0075370_10338190 3300006353 Bacteria 898
48 Ga0068871_101346987 3300006358 Bacteria 672
49 Ga0075428_100035302 3300006844 Bacteria 5512
50 Ga0075428_101014707 3300006844 Bacteria 878
51 Ga0075430_100675812 3300006846 Bacteria 851
52 Ga0075431_100089619 3300006847 Bacteria 3175
53 Ga0075431_100668612 3300006847 Bacteria 1018
54 Ga0075431_100773012 3300006847 Bacteria 935
55 Ga0075429_100011346 3300006880 Bacteria 7714
56 Ga0075429_100138821 3300006880 Bacteria 2128
57 Ga0075429_100304205 3300006880 Bacteria 1396
58 Ga0075435_101976435 3300007076 Bacteria 512
59 Ga0105251_10011492 3300009011 Bacteria 5055
60 Ga0105244_10525261 3300009036 Bacteria 545
61 Ga0105240_10019389 3300009093 Bacteria 9087
62 Ga0105240_10500753 3300009093 Bacteria 1351
63 Ga0111539_10706666 3300009094 Bacteria 1173
64 Ga0111539_12068344 3300009094 Bacteria 661
65 Ga0105245_10252623 3300009098 Bacteria 1713
66 Ga0105245_10423681 3300009098 Bacteria 1334
67 Ga0105247_10187324 3300009101 Bacteria 1384
68 Ga0114129_10052243 3300009147 Bacteria 5736
69 Ga0114129_10111674 3300009147 Bacteria 3771
70 Ga0114129_10289187 3300009147 Bacteria 2187
71 Ga0114129_11446791 3300009147 Bacteria 846
72 Ga0114129_12125084 3300009147 Bacteria 677
73 Ga0105243_10317925 3300009148 Bacteria 1417
74 Ga0105241_12142344 3300009174 Bacteria 553
75 Ga0105238_10125386 3300009551 Bacteria 2547
76 Ga0105238_10400724 3300009551 Bacteria 1365
77 Ga0105238_10767266 3300009551 Bacteria 979
78 Ga0105238_11212292 3300009551 Bacteria 779
79 Ga0105239_10495426 3300010375 Bacteria 1389
80 Ga0105239_10559483 3300010375 Bacteria 1303
81 Ga0105239_10635426 3300010375 Bacteria 1219
82 Ga0105239_12386531 3300010375 Bacteria 616
83 Ga0105246_11107875 3300011119 Bacteria 723
84 Ga0105246_11367457 3300011119 Bacteria 659
85 Ga0105246_11575935 3300011119 Bacteria 620
86 Ga0157370_10018850 3300013104 Bacteria 6940
87 Ga0157370_10654823 3300013104 Bacteria 960
88 Ga0157369_10003787 3300013105 Bacteria 17966
89 Ga0157369_10151246 3300013105 Bacteria 2453
90 Ga0157369_10164437 3300013105 Bacteria 2341
91 Ga0157369_10178579 3300013105 Bacteria 2234
92 Ga0157374_10772308 3300013296 Bacteria 976
93 Ga0163162_10744787 3300013306 Bacteria 1099
94 Ga0163162_12143626 3300013306 Bacteria 641
95 Ga0157372_11005931 3300013307 Bacteria 965
96 Ga0157375_10220469 3300013308 Bacteria 2055
97 Ga0157375_11846043 3300013308 Bacteria 717
98 Ga0163163_10007437 3300014325 Bacteria 9667
99 Ga0157380_11723682 3300014326 Bacteria 684
100 Ga0182008_10002907 3300014497 Bacteria 10604
101 Ga0157377_10465746 3300014745 Bacteria 876
102 Ga0157377_10768321 3300014745 Bacteria 707
103 Ga0157376_10946181 3300014969 Bacteria 882
104 Ga0182007_10000950 3300015262 Bacteria 15910
105 Ga0183367_1001 3300015688 Bacteria 1225545
106 Ga0206356_10164245 3300020070 Bacteria 818
107 Ga0206356_11140472 3300020070 Bacteria 738
108 Ga0206350_11633130 3300020080 Bacteria 961
109 Ga0206353_10286961 3300020082 Bacteria 641
110 Ga0213876_10005107 3300021384 Bacteria 7238
111 Ga0213875_10124131 3300021388 Bacteria 1206
112 Ga0224712_10140882 3300022467 Bacteria 1061
113 Ga0209758_1065708 3300025297 Bacteria 1169
114 Ga0207426_1039193 3300025302 Bacteria 1486
115 Ga0207426_1093605 3300025302 Bacteria 790
116 Ga0207692_10002711 3300025898 Bacteria 6826
117 Ga0207688_10241221 3300025901 Bacteria 1093
118 Ga0207647_10007299 3300025904 Bacteria 7999
119 Ga0207705_10017069 3300025909 Bacteria 5200
120 Ga0207705_10757886 3300025909 Bacteria 754
121 Ga0207707_10664077 3300025912 Bacteria 878
122 Ga0207695_10058844 3300025913 Bacteria 3988
123 Ga0207662_10719632 3300025918 Bacteria 700
124 Ga0207657_10105485 3300025919 Bacteria 2333
125 Ga0207652_10619898 3300025921 Bacteria 969
126 Ga0207650_11137412 3300025925 Bacteria 664
127 Ga0207650_11610834 3300025925 Bacteria 551
128 Ga0207687_10336008 3300025927 Bacteria 1227
129 Ga0207644_10153354 3300025931 Bacteria 1785
130 Ga0207704_10300518 3300025938 Bacteria 1229
131 Ga0207691_10797093 3300025940 Bacteria 794
132 Ga0207661_10552582 3300025944 Bacteria 1055
133 Ga0207679_10805011 3300025945 Bacteria 857
134 Ga0207667_10091857 3300025949 Bacteria 3135
135 Ga0207667_10256194 3300025949 Bacteria 1790
136 Ga0207640_10371360 3300025981 Bacteria 1156
137 Ga0207703_11486926 3300026035 Bacteria 652
138 Ga0207678_10402151 3300026067 Bacteria 1186
139 Ga0207678_10769500 3300026067 Bacteria 849
140 Ga0207678_11583745 3300026067 Bacteria 577
141 Ga0207702_10091854 3300026078 Bacteria 2659
142 Ga0207702_10715802 3300026078 Bacteria 987
143 Ga0207676_11276984 3300026095 Bacteria 729
144 Ga0207674_11272104 3300026116 Bacteria 705
145 Ga0207683_10081030 3300026121 Bacteria 2880
146 Ga0207698_10131439 3300026142 Bacteria 2140
147 Ga0209813_10034053 3300027866 Bacteria 1518
148 Ga0307517_10008570 3300028786 Bacteria 14644
149 Ga0307515_10000055 3300028794 Bacteria 264365
150 Ga0307515_10589765 3300028794 Bacteria 721
151 Ga0307511_10005039 3300030521 Bacteria 13473
152 Ga0307512_10001679 3300030522 Bacteria 30324
153 Ga0307512_10030025 3300030522 Bacteria 4736
154 Ga0265325_10031223 3300031241 Bacteria 2853
155 Ga0265316_10386244 3300031344 Bacteria 1010
156 Ga0265316_10432058 3300031344 Bacteria 946
157 Ga0265316_10820611 3300031344 Bacteria 652
158 Ga0307513_10063411 3300031456 Bacteria 3900
159 Ga0307513_10074197 3300031456 Bacteria 3539
160 Ga0307513_10117343 3300031456 Bacteria 2639
161 Ga0307509_10011445 3300031507 Bacteria 10739
162 Ga0307509_10062862 3300031507 Bacteria 3912
163 Ga0307509_10979956 3300031507 Bacteria 512
164 Ga0265313_10114539 3300031595 Bacteria 1182
165 Ga0307508_10005498 3300031616 Bacteria 12042
166 Ga0307508_10014620 3300031616 Bacteria 7162
167 Ga0307508_10044237 3300031616 Bacteria 3985
168 Ga0307508_10132527 3300031616 Bacteria 2095
169 Ga0307514_10003936 3300031649 Bacteria 13887
170 Ga0307514_10120205 3300031649 Bacteria 1835
171 Ga0307514_10232175 3300031649 Bacteria 1116
172 Ga0307514_10255439 3300031649 Bacteria 1032
173 Ga0307514_10554344 3300031649 Bacteria 529
174 Ga0265342_10030213 3300031712 Bacteria 3359
175 Ga0307516_10005424 3300031730 Bacteria 15271
176 Ga0307516_10057248 3300031730 Bacteria 3798
177 Ga0307405_10788739 3300031731 Bacteria 795
178 Ga0307518_10044734 3300031838 Bacteria 3220
179 Ga0307518_10122296 3300031838 Bacteria 1840
180 Ga0307518_10142690 3300031838 Bacteria 1668
181 Ga0307518_10229721 3300031838 Bacteria 1202
182 Ga0307410_10630621 3300031852 Bacteria 897
183 Ga0307410_10840635 3300031852 Bacteria 783
184 Ga0307410_10920252 3300031852 Bacteria 750
185 Ga0307406_11980453 3300031901 Bacteria 520
186 Ga0307407_10070745 3300031903 Bacteria 2075
187 Ga0307409_100411040 3300031995 Bacteria 1295
188 Ga0307409_102057347 3300031995 Bacteria 601
189 Ga0307409_102117920 3300031995 Bacteria 592
190 Ga0307416_100311642 3300032002 Bacteria 1571
191 Ga0307416_100404537 3300032002 Bacteria 1404
192 Ga0307416_100477534 3300032002 Bacteria 1306
193 Ga0307411_12190644 3300032005 Bacteria 518
194 Ga0307415_100492148 3300032126 Bacteria 1070
195 Ga0307415_100712123 3300032126 Bacteria 907
196 Ga0307415_101789127 3300032126 Bacteria 594
197 Ga0307507_10020179 3300033179 Bacteria 7474
198 Ga0307507_10099825 3300033179 Bacteria 2436
199 Ga0307507_10309809 3300033179 Bacteria 960
200 Ga0307507_10415078 3300033179 Bacteria 758
201 Ga0307510_10003883 3300033180 Bacteria 17512
202 Ga0307510_10037906 3300033180 Bacteria 5339
203 Ga0307510_10073467 3300033180 Bacteria 3387
204 Ga0373925_1695586 3300037068 Bacteria 516
205 Ga0395899_0116380 3300037312 Bacteria 1918
206 Ga0395899_0428144 3300037312 Bacteria 871
207 Ga0395900_0342142 3300037418 Bacteria 1471
208 Ga0395900_0626099 3300037418 Bacteria 1014
209 Ga0395898_0015607 3300037466 Bacteria 7786
210 Ga0395898_1259561 3300037466 Bacteria 670
211 Ga0395905_0442762 3300037471 Bacteria 1197
212 Ga0395905_1893072 3300037471 Bacteria 503
213 Ga0395901_0028755 3300038443 Bacteria 5718
214 Ga0395901_0113160 3300038443 Bacteria 2850
215 Ga0395901_0183602 3300038443 Bacteria 2194
216 Ga0436365_0198832 3300039437 Bacteria 16834
217 Ga0439436_0001664 3300041404 Bacteria 6490
218 Ga0439436_0013351 3300041404 Bacteria 2484
219 Ga0439439_0000277 3300041406 Bacteria 8106
220 Ga0451789_0678980 3300041443 Bacteria 675
221 Ga0451791_1483709 3300041451 Bacteria 3871
222 Ga0451793_0786765 3300041452 Bacteria 2766
223 Ga0451793_1110178 3300041452 Bacteria 770
224 Ga0451793_1528231 3300041452 Bacteria 802
225 Ga0451802_1453876 3300041460 Bacteria 1427
226 Ga0451807_0509614 3300041486 Bacteria 1061
227 Ga0451833_0326702 3300041491 Bacteria 1561
228 Ga0451837_0087430 3300041494 Bacteria 1403
229 Ga0451837_0817873 3300041494 Bacteria 1954
230 Ga0451843_0990492 3300041509 Bacteria 1488
231 Ga0451855_0094309 3300041511 Bacteria 611
232 Ga0451853_1236761 3300041512 Bacteria 1419
233 Ga0451853_1515807 3300041512 Bacteria 2335
234 Ga0451853_2584007 3300041512 Bacteria 2245
235 Ga0439431_0091602 3300041997 Bacteria 829
236 Ga0439433_0001898 3300041999 Bacteria 4374
237 Ga0439433_0052820 3300041999 Bacteria 960
238 Ga0439442_013660 3300042002 Bacteria 1667
239 Ga0439448_0140665 3300042005 Bacteria 835
240 Ga0439449_0006067 3300042007 Bacteria 4619
241 Ga0439449_0022466 3300042007 Bacteria 2362
242 Ga0439449_0379301 3300042007 Bacteria 536
243 Ga0439457_000624 3300042014 Bacteria 10457
244 Ga0439457_004423 3300042014 Bacteria 3661
245 Ga0439457_029313 3300042014 Bacteria 1219
246 Ga0439462_0020986 3300042015 Bacteria 1705
247 Ga0439462_0124966 3300042015 Bacteria 717
248 Ga0450894_000246 3300042131 Bacteria 9702
249 Ga0450895_001203 3300042132 Bacteria 1753
250 Ga0450896_001733 3300042133 Bacteria 2740
251 Ga0450898_001110 3300042134 Bacteria 3438
252 Ga0450899_002776 3300042135 Bacteria 1893
253 Ga0450900_004770 3300042136 Bacteria 1574
254 Ga0450900_005948 3300042136 Bacteria 1458
255 Ga0450903_027868 3300042138 Bacteria 858
256 Ga0450906_000846 3300042145 Bacteria 6746
257 Ga0450906_030310 3300042145 Bacteria 956
258 Ga0450908_036290 3300042184 Bacteria 854
259 Ga0439440_0194127 3300042993 Bacteria 600
260 Ga0466969_0214090 3300044656 Bacteria 877
261 Ga0466972_0001151 3300044658 Bacteria 12643
262 Ga0466972_0034261 3300044658 Bacteria 2488
263 Ga0466972_0110992 3300044658 Bacteria 1296
264 Ga0466965_0000638 3300044683 Bacteria 12848
265 Ga0466965_0012782 3300044683 Bacteria 3952
266 Ga0466965_0513654 3300044683 Bacteria 673
267 Ga0466966_0002173 3300044684 Bacteria 12732
268 Ga0466966_0013308 3300044684 Bacteria 5446
269 Ga0466961_0001217 3300044693 Bacteria 15827
270 Ga0466961_0129700 3300044693 Bacteria 1580
271 Ga0466961_0132332 3300044693 Bacteria 1563
272 Ga0466961_0543012 3300044693 Bacteria 700
273 Ga0466963_0000129 3300044694 Bacteria 28746
274 Ga0466971_0000778 3300044719 Bacteria 12815
275 Ga0466971_0319402 3300044719 Bacteria 748
276 Ga0466968_0014317 3300044735 Bacteria 3133
277 Ga0466968_0242224 3300044735 Bacteria 854
278 Ga0466970_0008329 3300044765 Bacteria 5215
279 Ga0466970_0036335 3300044765 Bacteria 2609
280 Ga0466970_0123191 3300044765 Bacteria 1421
281 Ga0466970_0154291 3300044765 Bacteria 1269
282 Ga0466957_0000368 3300044842 Bacteria 22096
283 Ga0466957_0050723 3300044842 Bacteria 2525
284 Ga0466957_1192520 3300044842 Bacteria 551
285 Ga0466960_0003070 3300044901 Bacteria 6382
286 Ga0466960_0041004 3300044901 Bacteria 2191
287 Ga0466960_0074533 3300044901 Bacteria 1696
288 Ga0466959_0002086 3300045049 Bacteria 12639
289 Ga0466959_0004621 3300045049 Bacteria 9253
290 Ga0466958_0010824 3300045836 Bacteria 5121
291 Ga0466958_0018698 3300045836 Bacteria 4026
292 Ga0466958_0951357 3300045836 Bacteria 560
293 Ga0466967_0001454 3300045976 Bacteria 13751
294 Ga0466967_0211306 3300045976 Bacteria 1840
295 Ga0466967_1851318 3300045976 Bacteria 600
296 Ga0466967_2369096 3300045976 Bacteria 526
297 Ga0495617_009899 3300046452 Bacteria 3268
298 Ga0495627_095387 3300046453 Bacteria 853
299 Ga0495627_180165 3300046453 Bacteria 585
300 Ga0495592_0004681 3300046454 Bacteria 10029
301 Ga0495592_0019703 3300046454 Bacteria 5131
302 Ga0495603_0000883 3300046455 Bacteria 17238
303 Ga0495603_0002066 3300046455 Bacteria 11801
304 Ga0495603_0127013 3300046455 Bacteria 1486
305 Ga0495603_0673520 3300046455 Bacteria 592
306 Ga0495590_0045820 3300046457 Bacteria 1525
307 Ga0495629_0004727 3300046459 Bacteria 10203
308 Ga0495629_0008787 3300046459 Bacteria 7429
309 Ga0495629_0015459 3300046459 Bacteria 5481
310 Ga0495629_0025163 3300046459 Bacteria 4234
311 Ga0495629_0032391 3300046459 Bacteria 3701
312 Ga0495629_0074786 3300046459 Bacteria 2365
313 Ga0495629_0101880 3300046459 Bacteria 2003
314 Ga0495629_0149975 3300046459 Bacteria 1621
315 Ga0495629_0379962 3300046459 Bacteria 961
316 Ga0495638_0055762 3300046460 Bacteria 2453
317 Ga0495638_0093666 3300046460 Bacteria 1806
318 Ga0495638_0179691 3300046460 Bacteria 1208
319 Ga0495651_0002968 3300046462 Bacteria 13097
320 Ga0495651_0040550 3300046462 Bacteria 3620
321 Ga0495582_0360594 3300046473 Bacteria 837
322 Ga0495582_0561320 3300046473 Bacteria 660
323 Ga0495605_0038106 3300046474 Bacteria 2414
324 Ga0495605_0203349 3300046474 Bacteria 862
325 Ga0495639_0356696 3300046475 Bacteria 735
326 Ga0495662_0002080 3300046476 Bacteria 10035
327 Ga0495662_0008434 3300046476 Bacteria 5068
328 Ga0495662_0022243 3300046476 Bacteria 3063
329 Ga0495662_0023392 3300046476 Bacteria 2983
330 Ga0495664_0002020 3300046477 Bacteria 10830
331 Ga0495664_0031613 3300046477 Bacteria 3104
332 Ga0495664_0098388 3300046477 Bacteria 1761
333 Ga0495584_0042402 3300046491 Bacteria 2297
334 Ga0495584_0474648 3300046491 Bacteria 637
335 Ga0495584_0661004 3300046491 Bacteria 533
336 Ga0495585_0023861 3300046492 Bacteria 3509
337 Ga0495585_0058374 3300046492 Bacteria 2129
338 Ga0495585_0073561 3300046492 Bacteria 1860
339 Ga0495594_0007673 3300046499 Bacteria 5550
340 Ga0495594_0011289 3300046499 Bacteria 4641
341 Ga0495594_0029462 3300046499 Bacteria 2967
342 Ga0495594_0218288 3300046499 Bacteria 1087
343 Ga0495594_0504159 3300046499 Bacteria 687
344 Ga0495596_0049844 3300046500 Bacteria 1641
345 Ga0495607_0057371 3300046501 Bacteria 2231
346 Ga0495607_0121337 3300046501 Bacteria 1371
347 Ga0495583_0101480 3300046506 Bacteria 1227
348 Ga0495606_0005584 3300046507 Bacteria 11974
349 Ga0495610_0100692 3300046512 Bacteria 1295
350 Ga0495616_0011610 3300046513 Bacteria 5040
351 Ga0495618_0862011 3300046514 Bacteria 525
352 Ga0495620_0016511 3300046515 Bacteria 3701
353 Ga0495620_0274894 3300046515 Bacteria 641
354 Ga0495628_0032667 3300046516 Bacteria 4199
355 Ga0495628_0088008 3300046516 Bacteria 2407
356 Ga0495631_0023616 3300046518 Bacteria 2848
357 Ga0495631_0126399 3300046518 Bacteria 1099
358 Ga0495666_0039688 3300046526 Bacteria 2284
359 Ga0495652_0006571 3300046529 Bacteria 10803
360 Ga0495654_0108745 3300046530 Bacteria 1267
361 Ga0495640_0008892 3300046533 Bacteria 7846
362 Ga0495640_0013078 3300046533 Bacteria 6321
363 Ga0495640_0109040 3300046533 Bacteria 1811
364 Ga0495586_0020653 3300046535 Bacteria 3508
365 Ga0495586_0557647 3300046535 Bacteria 662
366 Ga0495587_0001315 3300046536 Bacteria 16495
367 Ga0495609_0027039 3300046538 Bacteria 2623
368 Ga0495597_0136174 3300046542 Bacteria 1015
369 Ga0495645_0064905 3300046543 Bacteria 2641
370 Ga0495645_0086382 3300046543 Bacteria 2245
371 Ga0495622_0008887 3300046557 Bacteria 4654
372 Ga0495622_0019711 3300046557 Bacteria 3141
373 Ga0495622_0021710 3300046557 Bacteria 2988
374 Ga0495633_0034714 3300046558 Bacteria 2424
375 Ga0495667_0011894 3300046559 Bacteria 5896
376 Ga0495667_0103648 3300046559 Bacteria 1840
377 Ga0495656_0054646 3300046615 Bacteria 1719
378 Ga0495668_0005892 3300046616 Bacteria 8161
379 Ga0495634_0001504 3300046642 Bacteria 20635
380 Ga0495634_0008952 3300046642 Bacteria 7412
381 Ga0495611_0109177 3300046648 Bacteria 1287
382 Ga0495625_0102774 3300046660 Bacteria 1961
383 Ga0495625_0266251 3300046660 Bacteria 1107
384 Ga0495625_0353043 3300046660 Bacteria 929
385 Ga0495635_0002277 3300046663 Bacteria 13054
386 Ga0495661_0138994 3300046665 Bacteria 1323
387 Ga0495588_0014942 3300046674 Bacteria 3726
388 Ga0495588_0076233 3300046674 Bacteria 1747
389 Ga0495657_0001502 3300046675 Bacteria 20091
390 Ga0495657_0002117 3300046675 Bacteria 16865
391 Ga0495657_0010589 3300046675 Bacteria 6930
392 Ga0495657_0055636 3300046675 Bacteria 2638
393 Ga0495623_0166931 3300046679 Bacteria 1289
394 Ga0495646_0002770 3300046680 Bacteria 10844
395 Ga0495646_0018961 3300046680 Bacteria 4356
396 Ga0495658_0252564 3300046683 Bacteria 1109
397 Ga0495613_0000504 3300046689 Bacteria 32987
398 Ga0495613_0006490 3300046689 Bacteria 8738
399 Ga0495613_0015763 3300046689 Bacteria 5626
400 Ga0495613_0026570 3300046689 Bacteria 4311
401 Ga0495624_0038983 3300046690 Bacteria 3049
402 Ga0495624_0245921 3300046690 Bacteria 1082
403 Ga0495670_0114759 3300046691 Bacteria 1396
404 Ga0495670_0732025 3300046691 Bacteria 539
405 Ga0495671_0031677 3300046692 Bacteria 2703
406 Ga0495649_0066862 3300046694 Bacteria 1928
407 Ga0495649_0076533 3300046694 Bacteria 1791
408 Ga0495649_0442738 3300046694 Bacteria 649
409 Ga0495589_0026365 3300046794 Bacteria 2945
410 Ga0495589_0027001 3300046794 Bacteria 2906
411 Ga0495589_0084206 3300046794 Bacteria 1545
412 Ga0495600_0062820 3300046809 Bacteria 2426
413 Ga0495600_0103587 3300046809 Bacteria 1854
414 Ga0495660_0164212 3300046810 Bacteria 1086
415 Ga0495581_0001340 3300047315 Bacteria 13605
416 Ga0495581_0053969 3300047315 Bacteria 2320
417 Ga0495581_0097233 3300047315 Bacteria 1710
418 Ga0495581_0229368 3300047315 Bacteria 1086
419 Ga0495604_0000224 3300047317 Bacteria 51653
420 Ga0495636_0000633 3300047318 Bacteria 12901
421 Ga0495636_0000901 3300047318 Bacteria 11037
422 Ga0495636_0014480 3300047318 Bacteria 3136
423 Ga0495636_0038743 3300047318 Bacteria 1973
424 Ga0495676_0001049 3300047321 Bacteria 23375
425 Ga0495676_0012880 3300047321 Bacteria 7523
426 Ga0495676_0069297 3300047321 Bacteria 2721
427 Ga0495680_0386063 3300047322 Bacteria 969
428 Ga0495683_0066444 3300047323 Bacteria 1777
429 Ga0495687_005384 3300047443 Bacteria 8171
430 Ga0495675_0025171 3300047444 Bacteria 3795
431 Ga0495675_0153415 3300047444 Bacteria 1422
432 Ga0495675_0253668 3300047444 Bacteria 1056
433 Ga0495675_0654691 3300047444 Bacteria 591
434 Ga0495685_003058 3300047447 Bacteria 5305
435 Ga0495685_010441 3300047447 Bacteria 3114
436 Ga0495685_015035 3300047447 Bacteria 2635
437 Ga0495685_052807 3300047447 Bacteria 1376
438 Ga0495685_258438 3300047447 Bacteria 551
439 Ga0495681_0000970 3300047470 Bacteria 21944
440 Ga0495681_0009462 3300047470 Bacteria 6000
441 Ga0495686_0033272 3300047472 Bacteria 3330
442 Ga0495686_0045072 3300047472 Bacteria 2791
443 Ga0495593_0004149 3300047673 Bacteria 8621
444 Ga0495593_0454803 3300047673 Bacteria 641
445 Ga0495614_0009644 3300048089 Bacteria 4266
446 Ga0495614_0020482 3300048089 Bacteria 2859
447 Ga0495614_0132366 3300048089 Bacteria 1104
448 Ga0496100_0147717 3300048903 Bacteria 1673
449 Ga0496101_0644271 3300048904 Bacteria 837
450 Ga0496101_0733515 3300048904 Bacteria 780
451 Ga0496102_0017905 3300048905 Bacteria 6214
452 Ga0496104_0082517 3300048907 Bacteria 3065
453 Ga0496104_0133586 3300048907 Bacteria 2384
454 Ga0496105_0036484 3300048908 Bacteria 4050
455 Ga0496106_0093410 3300048909 Bacteria 2325
456 Ga0496107_0270190 3300048910 Bacteria 1265
457 Ga0496108_0126703 3300048911 Bacteria 2192
458 Ga0496108_0291570 3300048911 Bacteria 1421
459 Ga0496108_0458515 3300048911 Bacteria 1113
460 Ga0496109_0043887 3300048912 Bacteria 4054
461 Ga0496109_0225992 3300048912 Bacteria 1760
462 Ga0496111_0170439 3300048914 Bacteria 1617
463 Ga0496111_0400997 3300048914 Bacteria 1013
464 Ga0496112_0021197 3300048915 Bacteria 6176
465 Ga0496113_0097084 3300048916 Bacteria 2279
466 Ga0496113_0183370 3300048916 Bacteria 1660
467 Ga0496113_0244033 3300048916 Bacteria 1433
468 Ga0496114_0033438 3300048917 Bacteria 4236
469 Ga0496126_0379622 3300048929 Bacteria 1151
470 Ga0495678_031590 3300049459 Bacteria 2206
471 Ga0495682_0230675 3300049460 Bacteria 655
472 Ga0501315_095244 3300049531 Bacteria 520
473 Ga0501317_030411 3300049533 Bacteria 781
474 Ga0501318_073324 3300049534 Bacteria 544
475 Ga0501318_089692 3300049534 Bacteria 508
476 Ga0501323_036861 3300049539 Bacteria 705
477 Ga0501325_016193 3300049541 Bacteria 743
478 Ga0501031_0015014 3300049568 Bacteria 5031
479 Ga0501031_0109839 3300049568 Bacteria 1801
480 Ga0501031_0116460 3300049568 Bacteria 1746
481 Ga0501031_0132976 3300049568 Bacteria 1625
482 Ga0501031_0158187 3300049568 Bacteria 1481
483 Ga0501032_0013917 3300049569 Bacteria 5707
484 Ga0501032_0018356 3300049569 Bacteria 4902
485 Ga0501032_0036251 3300049569 Bacteria 3368
486 Ga0501032_0039377 3300049569 Bacteria 3215
487 Ga0501032_0146077 3300049569 Bacteria 1557
488 Ga0501032_0219001 3300049569 Bacteria 1239
489 Ga0501032_0622688 3300049569 Bacteria 686
490 Ga0501033_0015677 3300049570 Bacteria 5746
491 Ga0501033_0022607 3300049570 Bacteria 4743
492 Ga0501033_0039312 3300049570 Bacteria 3533
493 Ga0501033_0044544 3300049570 Bacteria 3303
494 Ga0501033_0059535 3300049570 Bacteria 2820
495 Ga0501033_0093770 3300049570 Bacteria 2195
496 Ga0501033_0885680 3300049570 Bacteria 600
497 Ga0501034_0007629 3300049571 Bacteria 11509
498 Ga0501034_0012767 3300049571 Bacteria 8662
499 Ga0501034_0034559 3300049571 Bacteria 5125
500 Ga0501034_0036980 3300049571 Bacteria 4943
501 Ga0501034_0139109 3300049571 Bacteria 2408
502 Ga0501034_0155218 3300049571 Bacteria 2263
503 Ga0501034_0178907 3300049571 Bacteria 2086
504 Ga0501034_0595628 3300049571 Bacteria 1011
505 Ga0501036_0000646 3300049572 Bacteria 25504
506 Ga0501036_0002377 3300049572 Bacteria 14708
507 Ga0501036_0003261 3300049572 Bacteria 12944
508 Ga0501036_0026384 3300049572 Bacteria 4904
509 Ga0501036_0049459 3300049572 Bacteria 3560
510 Ga0501036_0157782 3300049572 Bacteria 1913
511 Ga0501036_0194958 3300049572 Bacteria 1704
512 Ga0501036_1190188 3300049572 Bacteria 621
513 Ga0501037_0003632 3300049573 Bacteria 11189
514 Ga0501037_0018008 3300049573 Bacteria 5200
515 Ga0501037_0045919 3300049573 Bacteria 3205
516 Ga0501037_0258354 3300049573 Bacteria 1217
517 Ga0501037_0585534 3300049573 Bacteria 750
518 Ga0501037_0714480 3300049573 Bacteria 666
519 Ga0501037_0802454 3300049573 Bacteria 621
520 Ga0501038_0007197 3300049574 Bacteria 10283
521 Ga0501038_0013826 3300049574 Bacteria 7354
522 Ga0501038_0022553 3300049574 Bacteria 5638
523 Ga0501038_0036215 3300049574 Bacteria 4331
524 Ga0501038_0114150 3300049574 Bacteria 2234
525 Ga0501038_0141801 3300049574 Bacteria 1965
526 Ga0501038_0159776 3300049574 Bacteria 1832
527 Ga0501038_0169883 3300049574 Bacteria 1766
528 Ga0501038_1216345 3300049574 Bacteria 546
529 Ga0501039_0007975 3300049575 Bacteria 8068
530 Ga0501039_0008978 3300049575 Bacteria 7616
531 Ga0501039_0034309 3300049575 Bacteria 3916
532 Ga0501039_0058172 3300049575 Bacteria 2994
533 Ga0501039_0299247 3300049575 Bacteria 1265
534 Ga0501039_0450613 3300049575 Bacteria 1010
535 Ga0501040_0002541 3300049576 Bacteria 11761
536 Ga0501040_0013708 3300049576 Bacteria 5332
537 Ga0501040_0086994 3300049576 Bacteria 2170
538 Ga0501041_0001751 3300049577 Bacteria 12172
539 Ga0501041_0147164 3300049577 Bacteria 1470
540 Ga0501041_0588504 3300049577 Bacteria 710
541 Ga0501042_0056661 3300049578 Bacteria 2796
542 Ga0501042_0078551 3300049578 Bacteria 2363
543 Ga0501043_0008976 3300049579 Bacteria 7868
544 Ga0501043_0013972 3300049579 Bacteria 6283
545 Ga0501043_0017493 3300049579 Bacteria 5620
546 Ga0501043_0020833 3300049579 Bacteria 5142
547 Ga0501043_0030131 3300049579 Bacteria 4262
548 Ga0501043_0046081 3300049579 Bacteria 3428
549 Ga0501043_0050912 3300049579 Bacteria 3255
550 Ga0501043_0171761 3300049579 Bacteria 1691
551 Ga0501043_0664780 3300049579 Bacteria 764
552 Ga0501046_0019522 3300049580 Bacteria 5620
553 Ga0501046_0057042 3300049580 Bacteria 3064
554 Ga0501046_0136659 3300049580 Bacteria 1856
555 Ga0501046_0425137 3300049580 Bacteria 957
556 Ga0501046_0499734 3300049580 Bacteria 871
557 Ga0501047_0002168 3300049581 Bacteria 18780
558 Ga0501047_0021536 3300049581 Bacteria 6190
559 Ga0501047_0044156 3300049581 Bacteria 4305
560 Ga0501047_0050033 3300049581 Bacteria 4035
561 Ga0501047_0050785 3300049581 Bacteria 4005
562 Ga0501047_0102940 3300049581 Bacteria 2735
563 Ga0501047_0159408 3300049581 Bacteria 2128
564 Ga0501047_0316684 3300049581 Bacteria 1400
565 Ga0501047_1236970 3300049581 Bacteria 560
566 Ga0501048_0010396 3300049582 Bacteria 6949
567 Ga0501048_0037284 3300049582 Bacteria 3491
568 Ga0501048_0049294 3300049582 Bacteria 3001
569 Ga0501048_0443511 3300049582 Bacteria 929
570 Ga0501048_1084327 3300049582 Bacteria 576
571 Ga0501067_0006655 3300049583 Bacteria 6412
572 Ga0501067_0020907 3300049583 Bacteria 3621
573 Ga0501067_0038586 3300049583 Bacteria 2652
574 Ga0501067_0175183 3300049583 Bacteria 1194
575 Ga0501067_0419001 3300049583 Bacteria 747
576 Ga0501068_0001171 3300049584 Bacteria 13934
577 Ga0501068_0215709 3300049584 Bacteria 1219
578 Ga0501068_0217055 3300049584 Bacteria 1215
579 Ga0501069_0008895 3300049585 Bacteria 5294
580 Ga0501069_0034515 3300049585 Bacteria 2786
581 Ga0501069_0082110 3300049585 Bacteria 1816
582 Ga0501069_0185919 3300049585 Bacteria 1202
583 Ga0501069_0284407 3300049585 Bacteria 968
584 Ga0501069_0591684 3300049585 Bacteria 665
585 Ga0501070_0004802 3300049586 Bacteria 11555
586 Ga0501070_0012556 3300049586 Bacteria 7144
587 Ga0501070_0028923 3300049586 Bacteria 4646
588 Ga0501070_0147189 3300049586 Bacteria 1944
589 Ga0501070_0841512 3300049586 Bacteria 718
590 Ga0501070_1413567 3300049586 Bacteria 528
591 Ga0501071_0000482 3300049587 Bacteria 20111
592 Ga0501071_0076775 3300049587 Bacteria 2440
593 Ga0501071_0623119 3300049587 Bacteria 830
594 Ga0501072_0003972 3300049588 Bacteria 11185
595 Ga0501072_0005647 3300049588 Bacteria 9524
596 Ga0501072_0031379 3300049588 Bacteria 4159
597 Ga0501072_0160405 3300049588 Bacteria 1794
598 Ga0501072_0176391 3300049588 Bacteria 1705
599 Ga0501072_0482470 3300049588 Bacteria 981
600 Ga0501073_0018390 3300049589 Bacteria 5050
601 Ga0501074_0002011 3300049590 Bacteria 14006
602 Ga0501074_0119151 3300049590 Bacteria 1887
603 Ga0501074_0199086 3300049590 Bacteria 1428
604 Ga0501074_0397625 3300049590 Bacteria 977
605 Ga0501075_0072038 3300049591 Bacteria 2612
606 Ga0501076_0017285 3300049592 Bacteria 5479
607 Ga0501076_0028989 3300049592 Bacteria 4302
608 Ga0501077_0030242 3300049593 Bacteria 3446
609 Ga0501077_0062707 3300049593 Bacteria 2358
610 Ga0501209_206176 3300049656 Bacteria 606
611 Ga0501214_025901 3300049659 Bacteria 777
612 Ga0501079_0007398 3300049741 Bacteria 8305
613 Ga0501079_0846870 3300049741 Bacteria 720
614 Ga0501080_0024714 3300049742 Bacteria 5571
615 Ga0501080_0128855 3300049742 Bacteria 2343
616 Ga0501080_0460955 3300049742 Bacteria 1138
617 Ga0501080_0906390 3300049742 Bacteria 768
618 Ga0501081_0905177 3300049743 Bacteria 665
619 Ga0501083_0001134 3300049744 Bacteria 17865
620 Ga0501083_0099889 3300049744 Bacteria 1914
621 Ga0501035_0004736 3300049822 Bacteria 12917
622 Ga0501035_0019427 3300049822 Bacteria 6249
623 Ga0501035_0021596 3300049822 Bacteria 5919
624 Ga0501035_0023699 3300049822 Bacteria 5631
625 Ga0501035_0028830 3300049822 Bacteria 5064
626 Ga0501035_0031773 3300049822 Bacteria 4808
627 Ga0501035_0058750 3300049822 Bacteria 3426
628 Ga0501035_0121238 3300049822 Bacteria 2286
629 Ga0501035_0124524 3300049822 Bacteria 2250
630 Ga0501035_0179842 3300049822 Bacteria 1822
631 Ga0501035_0199559 3300049822 Bacteria 1716
632 Ga0501035_0441671 3300049822 Bacteria 1077
633 Ga0501035_0482919 3300049822 Bacteria 1022
634 Ga0501044_0000976 3300049823 Bacteria 34361
635 Ga0501044_0009892 3300049823 Bacteria 10363
636 Ga0501044_0020298 3300049823 Bacteria 7091
637 Ga0501044_0031412 3300049823 Bacteria 5591
638 Ga0501044_0068718 3300049823 Bacteria 3608
639 Ga0501044_0110717 3300049823 Bacteria 2754
640 Ga0501044_0274396 3300049823 Bacteria 1621
641 Ga0501044_0333890 3300049823 Bacteria 1438
642 Ga0501044_1009585 3300049823 Bacteria 703
643 Ga0501044_1167216 3300049823 Bacteria 638
644 Ga0501045_0005054 3300049824 Bacteria 9133
645 Ga0501045_0005598 3300049824 Bacteria 8693
646 Ga0501045_0046124 3300049824 Bacteria 3174
647 Ga0501045_0166204 3300049824 Bacteria 1643
648 Ga0501045_0230674 3300049824 Bacteria 1378
649 Ga0501045_0442166 3300049824 Bacteria 967
650 nmdc:mga03n38_27987_c1 3300050490 Bacteria 2344
651 nmdc:mga0yw44_348455_c1 3300050492 Bacteria 997
652 nmdc:mga06z11_3487_c1 3300050494 Bacteria 6094
653 nmdc:mga06z11_910127_c1 3300050494 Bacteria 536
654 nmdc:mga04h51_40559_c1 3300050495 Bacteria 1518
655 nmdc:mga07m45_192830_c1 3300050496 Bacteria 1185
656 nmdc:mga05p37_100218_c2 3300050507 Bacteria 2587
657 nmdc:mga05p37_1373286_c1 3300050507 Bacteria 714
658 nmdc:mga05p37_227931_c1 3300050507 Bacteria 2246
659 nmdc:mga05p37_236167_c1 3300050507 Bacteria 2200
660 nmdc:mga09592_5580_c1 3300050508 Bacteria 10247
661 nmdc:mga0qj67_1051493_c1 3300050509 Bacteria 637
662 nmdc:mga0qj67_45155_c1 3300050509 Bacteria 3476
663 nmdc:mga06r32_1081904_c1 3300050510 Bacteria 751
664 nmdc:mga06r32_1897534_c1 3300050510 Bacteria 530
665 nmdc:mga06r32_6286_c1 3300050510 Bacteria 10667
666 nmdc:mga08y16_1352395_c1 3300050511 Bacteria 677
667 nmdc:mga0a205_820048_c1 3300050515 Bacteria 778
668 Ga0495601_0031520 3300053077 Bacteria 3295
669 Ga0500610_0042187 3300053079 Bacteria 2361
670 Ga0500635_0150044 3300053080 Bacteria 889
671 Ga0495655_0078114 3300053083 Bacteria 940
672 Ga0495655_0200208 3300053083 Bacteria 653
673 Ga0500583_0332878 3300053092 Bacteria 738
674 Ga0500640_112165 3300053095 Bacteria 1107
675 Ga0500650_0343647 3300053098 Bacteria 654
676 Ga0500560_026028 3300053107 Bacteria 1723
677 Ga0500608_219170 3300053122 Bacteria 770
678 Ga0500573_0145828 3300053140 Bacteria 1300
679 Ga0500600_0159501 3300053149 Bacteria 1111
680 Ga0501084_0105787 3300054114 Bacteria 2363
681 Ga0501084_0554106 3300054114 Bacteria 971
682 Ga0501082_0014792 3300060353 Bacteria 6719
683 Ga0501082_0992792 3300060353 Bacteria 734
684 Ga0501082_1620757 3300060353 Bacteria 565
685 Ga0466962_0173239 3300061719 Bacteria 1051
686 Ga0466962_0238865 3300061719 Bacteria 892
687 Ga0466962_0275704 3300061719 Bacteria 829
688 Ga0530510_0023169 3300061734 Bacteria 4422
689 Ga0530510_0206636 3300061734 Bacteria 1459
690 Ga0530510_0296000 3300061734 Bacteria 1211
691 8056453216 8056447290 Bacteria 7680491
692 2547410352 2547132111 Bacteria 8013147
693 2585314689 2582581314 Bacteria 11452267
694 2616698302 2616644814 Bacteria 11555299
695 2644438838 2643221678 Bacteria 9540101
696 2644631259 2643221714 Bacteria 9015452
697 2760621704 2758568621 Bacteria 5967089
698 2785340020 2784746763 Bacteria 9783172
699 2808845049 2808606359 Bacteria 9866990
700 2808914650 2808606375 Bacteria 9466072
701 2812354641 2811994879 Bacteria 9313447
702 2812477614 2811994917 Bacteria 7761064
703 2852636260 2852635781 Bacteria 8251373
704 2862283344 2862281513 Bacteria 9621493
705 2862576400 2862574272 Bacteria 10567477
706 2866552104 2866552031 Bacteria 5824618
707 2919471157 2919468124 Bacteria 9133025
708 2946071022 2946064051 Bacteria 8957905
709 2946078953 2946072368 Bacteria 8999607
710 2947225692 2947224130 Bacteria 9938529
711 2954009848 2954002825 Bacteria 9173742
712 3006490187 3006486233 Bacteria 8157040
713 3006494272 3006493962 Bacteria 8825450
714 8048407104 8048406513 Bacteria 8936924
715 8056583409 8056579771 Bacteria 5840325
716 JGI24739J22299_10018725
717 JGI24737J22298_10019421
718 JGI24735J21928_10036069
719 rootH1_10031179
720 rootH1_10094779
721 JGI25160J50197_1031211
722 Ga0006562J51391_1142362
723 Ga0006562J51391_1142363
724 Ga0070658_10006816
725 Ga0070658_11400518
726 Ga0070682_100898267
727 Ga0070660_100145701
728 Ga0070668_102267272
729 Ga0070663_100006719
730 Ga0070678_100235924
731 Ga0070681_10249695
732 Ga0070679_100121308
733 Ga0070684_100456967
734 Ga0070672_100304735
735 Ga0070672_100431400
736 Ga0070665_100217143
737 Ga0068855_100011209
738 Ga0068855_100277355
739 Ga0068855_100476585
740 Ga0068857_100330486
741 Ga0068854_100278884
742 Ga0068854_101339888
743 Ga0068856_100158735
744 Ga0068856_101992018
745 Ga0070702_100539194
746 Ga0068852_100038532
747 Ga0068852_100398373
748 Ga0068864_101518123
749 Ga0068864_102146298
750 Ga0068870_10716809
751 Ga0068858_101063366
752 Ga0081455_10003247
753 Ga0081455_10041478
754 Ga0081538_10088414
755 Ga0081540_1253589
756 Ga0075365_10079090
757 Ga0075365_10427871
758 Ga0075368_10069160
759 Ga0075363_100015288
760 Ga0075367_10006132
761 Ga0097621_100560374
762 Ga0075370_10338190
763 Ga0068871_101346987
764 Ga0075428_100035302
765 Ga0075428_101014707
766 Ga0075430_100675812
767 Ga0075431_100089619
768 Ga0075431_100668612
769 Ga0075431_100773012
770 Ga0075429_100011346
771 Ga0075429_100138821
772 Ga0075429_100304205
773 Ga0075435_101976435
774 Ga0105251_10011492
775 Ga0105244_10525261
776 Ga0105240_10019389
777 Ga0105240_10500753
778 Ga0111539_10706666
779 Ga0111539_12068344
780 Ga0105245_10252623
781 Ga0105245_10423681
782 Ga0105247_10187324
783 Ga0114129_10052243
784 Ga0114129_10111674
785 Ga0114129_10289187
786 Ga0114129_11446791
787 Ga0114129_12125084
788 Ga0105243_10317925
789 Ga0105241_12142344
790 Ga0105238_10125386
791 Ga0105238_10400724
792 Ga0105238_10767266
793 Ga0105238_11212292
794 Ga0105239_10495426
795 Ga0105239_10559483
796 Ga0105239_10635426
797 Ga0105239_12386531
798 Ga0105246_11107875
799 Ga0105246_11367457
800 Ga0105246_11575935
801 Ga0157370_10018850
802 Ga0157370_10654823
803 Ga0157369_10003787
804 Ga0157369_10151246
805 Ga0157369_10164437
806 Ga0157369_10178579
807 Ga0157374_10772308
808 Ga0163162_10744787
809 Ga0163162_12143626
810 Ga0157372_11005931
811 Ga0157375_10220469
812 Ga0157375_11846043
813 Ga0163163_10007437
814 Ga0157380_11723682
815 Ga0182008_10002907
816 Ga0157377_10465746
817 Ga0157377_10768321
818 Ga0157376_10946181
819 Ga0182007_10000950
820 Ga0183367_1001
821 Ga0206356_10164245
822 Ga0206356_11140472
823 Ga0206350_11633130
824 Ga0206353_10286961
825 Ga0213876_10005107
826 Ga0213875_10124131
827 Ga0224712_10140882
828 Ga0209758_1065708
829 Ga0207426_1039193
830 Ga0207426_1093605
831 Ga0207692_10002711
832 Ga0207688_10241221
833 Ga0207647_10007299
834 Ga0207705_10017069
835 Ga0207705_10757886
836 Ga0207707_10664077
837 Ga0207695_10058844
838 Ga0207662_10719632
839 Ga0207657_10105485
840 Ga0207652_10619898
841 Ga0207650_11137412
842 Ga0207650_11610834
843 Ga0207687_10336008
844 Ga0207644_10153354
845 Ga0207704_10300518
846 Ga0207691_10797093
847 Ga0207661_10552582
848 Ga0207679_10805011
849 Ga0207667_10091857
850 Ga0207667_10256194
851 Ga0207640_10371360
852 Ga0207703_11486926
853 Ga0207678_10402151
854 Ga0207678_10769500
855 Ga0207678_11583745
856 Ga0207702_10091854
857 Ga0207702_10715802
858 Ga0207676_11276984
859 Ga0207674_11272104
860 Ga0207683_10081030
861 Ga0207698_10131439
862 Ga0209813_10034053
863 Ga0307517_10008570
864 Ga0307515_10000055
865 Ga0307515_10589765
866 Ga0307511_10005039
867 Ga0307512_10001679
868 Ga0307512_10030025
869 Ga0265325_10031223
870 Ga0265316_10386244
871 Ga0265316_10432058
872 Ga0265316_10820611
873 Ga0307513_10063411
874 Ga0307513_10074197
875 Ga0307513_10117343
876 Ga0307509_10011445
877 Ga0307509_10062862
878 Ga0307509_10979956
879 Ga0265313_10114539
880 Ga0307508_10005498
881 Ga0307508_10014620
882 Ga0307508_10044237
883 Ga0307508_10132527
884 Ga0307514_10003936
885 Ga0307514_10120205
886 Ga0307514_10232175
887 Ga0307514_10255439
888 Ga0307514_10554344
889 Ga0265342_10030213
890 Ga0307516_10005424
891 Ga0307516_10057248
892 Ga0307405_10788739
893 Ga0307518_10044734
894 Ga0307518_10122296
895 Ga0307518_10142690
896 Ga0307518_10229721
897 Ga0307410_10630621
898 Ga0307410_10840635
899 Ga0307410_10920252
900 Ga0307406_11980453
901 Ga0307407_10070745
902 Ga0307409_100411040
903 Ga0307409_102057347
904 Ga0307409_102117920
905 Ga0307416_100311642
906 Ga0307416_100404537
907 Ga0307416_100477534
908 Ga0307411_12190644
909 Ga0307415_100492148
910 Ga0307415_100712123
911 Ga0307415_101789127
912 Ga0307507_10020179
913 Ga0307507_10099825
914 Ga0307507_10309809
915 Ga0307507_10415078
916 Ga0307510_10003883
917 Ga0307510_10037906
918 Ga0307510_10073467
919 Ga0373925_1695586
920 Ga0395899_0116380
921 Ga0395899_0428144
922 Ga0395900_0342142
923 Ga0395900_0626099
924 Ga0395898_0015607
925 Ga0395898_1259561
926 Ga0395905_0442762
927 Ga0395905_1893072
928 Ga0395901_0028755
929 Ga0395901_0113160
930 Ga0395901_0183602
931 Ga0436365_0198832
932 Ga0439436_0001664
933 Ga0439436_0013351
934 Ga0439439_0000277
935 Ga0451789_0678980
936 Ga0451791_1483709
937 Ga0451793_0786765
938 Ga0451793_1110178
939 Ga0451793_1528231
940 Ga0451802_1453876
941 Ga0451807_0509614
942 Ga0451833_0326702
943 Ga0451837_0087430
944 Ga0451837_0817873
945 Ga0451843_0990492
946 Ga0451855_0094309
947 Ga0451853_1236761
948 Ga0451853_1515807
949 Ga0451853_2584007
950 Ga0439431_0091602
951 Ga0439433_0001898
952 Ga0439433_0052820
953 Ga0439442_013660
954 Ga0439448_0140665
955 Ga0439449_0006067
956 Ga0439449_0022466
957 Ga0439449_0379301
958 Ga0439457_000624
959 Ga0439457_004423
960 Ga0439457_029313
961 Ga0439462_0020986
962 Ga0439462_0124966
963 Ga0450894_000246
964 Ga0450895_001203
965 Ga0450896_001733
966 Ga0450898_001110
967 Ga0450899_002776
968 Ga0450900_004770
969 Ga0450900_005948
970 Ga0450903_027868
971 Ga0450906_000846
972 Ga0450906_030310
973 Ga0450908_036290
974 Ga0439440_0194127
975 Ga0466969_0214090
976 Ga0466972_0001151
977 Ga0466972_0034261
978 Ga0466972_0110992
979 Ga0466965_0000638
980 Ga0466965_0012782
981 Ga0466965_0513654
982 Ga0466966_0002173
983 Ga0466966_0013308
984 Ga0466961_0001217
985 Ga0466961_0129700
986 Ga0466961_0132332
987 Ga0466961_0543012
988 Ga0466963_0000129
989 Ga0466971_0000778
990 Ga0466971_0319402
991 Ga0466968_0014317
992 Ga0466968_0242224
993 Ga0466970_0008329
994 Ga0466970_0036335
995 Ga0466970_0123191
996 Ga0466970_0154291
997 Ga0466957_0000368
998 Ga0466957_0050723
999 Ga0466957_1192520
1000 Ga0466960_0003070
1001 Ga0466960_0041004
1002 Ga0466960_0074533
1003 Ga0466959_0002086
1004 Ga0466959_0004621
1005 Ga0466958_0010824
1006 Ga0466958_0018698
1007 Ga0466958_0951357
1008 Ga0466967_0001454
1009 Ga0466967_0211306
1010 Ga0466967_1851318
1011 Ga0466967_2369096
1012 Ga0495617_009899
1013 Ga0495627_095387
1014 Ga0495627_180165
1015 Ga0495592_0004681
1016 Ga0495592_0019703
1017 Ga0495603_0000883
1018 Ga0495603_0002066
1019 Ga0495603_0127013
1020 Ga0495603_0673520
1021 Ga0495590_0045820
1022 Ga0495629_0004727
1023 Ga0495629_0008787
1024 Ga0495629_0015459
1025 Ga0495629_0025163
1026 Ga0495629_0032391
1027 Ga0495629_0074786
1028 Ga0495629_0101880
1029 Ga0495629_0149975
1030 Ga0495629_0379962
1031 Ga0495638_0055762
1032 Ga0495638_0093666
1033 Ga0495638_0179691
1034 Ga0495651_0002968
1035 Ga0495651_0040550
1036 Ga0495582_0360594
1037 Ga0495582_0561320
1038 Ga0495605_0038106
1039 Ga0495605_0203349
1040 Ga0495639_0356696
1041 Ga0495662_0002080
1042 Ga0495662_0008434
1043 Ga0495662_0022243
1044 Ga0495662_0023392
1045 Ga0495664_0002020
1046 Ga0495664_0031613
1047 Ga0495664_0098388
1048 Ga0495584_0042402
1049 Ga0495584_0474648
1050 Ga0495584_0661004
1051 Ga0495585_0023861
1052 Ga0495585_0058374
1053 Ga0495585_0073561
1054 Ga0495594_0007673
1055 Ga0495594_0011289
1056 Ga0495594_0029462
1057 Ga0495594_0218288
1058 Ga0495594_0504159
1059 Ga0495596_0049844
1060 Ga0495607_0057371
1061 Ga0495607_0121337
1062 Ga0495583_0101480
1063 Ga0495606_0005584
1064 Ga0495610_0100692
1065 Ga0495616_0011610
1066 Ga0495618_0862011
1067 Ga0495620_0016511
1068 Ga0495620_0274894
1069 Ga0495628_0032667
1070 Ga0495628_0088008
1071 Ga0495631_0023616
1072 Ga0495631_0126399
1073 Ga0495666_0039688
1074 Ga0495652_0006571
1075 Ga0495654_0108745
1076 Ga0495640_0008892
1077 Ga0495640_0013078
1078 Ga0495640_0109040
1079 Ga0495586_0020653
1080 Ga0495586_0557647
1081 Ga0495587_0001315
1082 Ga0495609_0027039
1083 Ga0495597_0136174
1084 Ga0495645_0064905
1085 Ga0495645_0086382
1086 Ga0495622_0008887
1087 Ga0495622_0019711
1088 Ga0495622_0021710
1089 Ga0495633_0034714
1090 Ga0495667_0011894
1091 Ga0495667_0103648
1092 Ga0495656_0054646
1093 Ga0495668_0005892
1094 Ga0495634_0001504
1095 Ga0495634_0008952
1096 Ga0495611_0109177
1097 Ga0495625_0102774
1098 Ga0495625_0266251
1099 Ga0495625_0353043
1100 Ga0495635_0002277
1101 Ga0495661_0138994
1102 Ga0495588_0014942
1103 Ga0495588_0076233
1104 Ga0495657_0001502
1105 Ga0495657_0002117
1106 Ga0495657_0010589
1107 Ga0495657_0055636
1108 Ga0495623_0166931
1109 Ga0495646_0002770
1110 Ga0495646_0018961
1111 Ga0495658_0252564
1112 Ga0495613_0000504
1113 Ga0495613_0006490
1114 Ga0495613_0015763
1115 Ga0495613_0026570
1116 Ga0495624_0038983
1117 Ga0495624_0245921
1118 Ga0495670_0114759
1119 Ga0495670_0732025
1120 Ga0495671_0031677
1121 Ga0495649_0066862
1122 Ga0495649_0076533
1123 Ga0495649_0442738
1124 Ga0495589_0026365
1125 Ga0495589_0027001
1126 Ga0495589_0084206
1127 Ga0495600_0062820
1128 Ga0495600_0103587
1129 Ga0495660_0164212
1130 Ga0495581_0001340
1131 Ga0495581_0053969
1132 Ga0495581_0097233
1133 Ga0495581_0229368
1134 Ga0495604_0000224
1135 Ga0495636_0000633
1136 Ga0495636_0000901
1137 Ga0495636_0014480
1138 Ga0495636_0038743
1139 Ga0495676_0001049
1140 Ga0495676_0012880
1141 Ga0495676_0069297
1142 Ga0495680_0386063
1143 Ga0495683_0066444
1144 Ga0495687_005384
1145 Ga0495675_0025171
1146 Ga0495675_0153415
1147 Ga0495675_0253668
1148 Ga0495675_0654691
1149 Ga0495685_003058
1150 Ga0495685_010441
1151 Ga0495685_015035
1152 Ga0495685_052807
1153 Ga0495685_258438
1154 Ga0495681_0000970
1155 Ga0495681_0009462
1156 Ga0495686_0033272
1157 Ga0495686_0045072
1158 Ga0495593_0004149
1159 Ga0495593_0454803
1160 Ga0495614_0009644
1161 Ga0495614_0020482
1162 Ga0495614_0132366
1163 Ga0496100_0147717
1164 Ga0496101_0644271
1165 Ga0496101_0733515
1166 Ga0496102_0017905
1167 Ga0496104_0082517
1168 Ga0496104_0133586
1169 Ga0496105_0036484
1170 Ga0496106_0093410
1171 Ga0496107_0270190
1172 Ga0496108_0126703
1173 Ga0496108_0291570
1174 Ga0496108_0458515
1175 Ga0496109_0043887
1176 Ga0496109_0225992
1177 Ga0496111_0170439
1178 Ga0496111_0400997
1179 Ga0496112_0021197
1180 Ga0496113_0097084
1181 Ga0496113_0183370
1182 Ga0496113_0244033
1183 Ga0496114_0033438
1184 Ga0496126_0379622
1185 Ga0495678_031590
1186 Ga0495682_0230675
1187 Ga0501315_095244
1188 Ga0501317_030411
1189 Ga0501318_073324
1190 Ga0501318_089692
1191 Ga0501323_036861
1192 Ga0501325_016193
1193 Ga0501031_0015014
1194 Ga0501031_0109839
1195 Ga0501031_0116460
1196 Ga0501031_0132976
1197 Ga0501031_0158187
1198 Ga0501032_0013917
1199 Ga0501032_0018356
1200 Ga0501032_0036251
1201 Ga0501032_0039377
1202 Ga0501032_0146077
1203 Ga0501032_0219001
1204 Ga0501032_0622688
1205 Ga0501033_0015677
1206 Ga0501033_0022607
1207 Ga0501033_0039312
1208 Ga0501033_0044544
1209 Ga0501033_0059535
1210 Ga0501033_0093770
1211 Ga0501033_0885680
1212 Ga0501034_0007629
1213 Ga0501034_0012767
1214 Ga0501034_0034559
1215 Ga0501034_0036980
1216 Ga0501034_0139109
1217 Ga0501034_0155218
1218 Ga0501034_0178907
1219 Ga0501034_0595628
1220 Ga0501036_0000646
1221 Ga0501036_0002377
1222 Ga0501036_0003261
1223 Ga0501036_0026384
1224 Ga0501036_0049459
1225 Ga0501036_0157782
1226 Ga0501036_0194958
1227 Ga0501036_1190188
1228 Ga0501037_0003632
1229 Ga0501037_0018008
1230 Ga0501037_0045919
1231 Ga0501037_0258354
1232 Ga0501037_0585534
1233 Ga0501037_0714480
1234 Ga0501037_0802454
1235 Ga0501038_0007197
1236 Ga0501038_0013826
1237 Ga0501038_0022553
1238 Ga0501038_0036215
1239 Ga0501038_0114150
1240 Ga0501038_0141801
1241 Ga0501038_0159776
1242 Ga0501038_0169883
1243 Ga0501038_1216345
1244 Ga0501039_0007975
1245 Ga0501039_0008978
1246 Ga0501039_0034309
1247 Ga0501039_0058172
1248 Ga0501039_0299247
1249 Ga0501039_0450613
1250 Ga0501040_0002541
1251 Ga0501040_0013708
1252 Ga0501040_0086994
1253 Ga0501041_0001751
1254 Ga0501041_0147164
1255 Ga0501041_0588504
1256 Ga0501042_0056661
1257 Ga0501042_0078551
1258 Ga0501043_0008976
1259 Ga0501043_0013972
1260 Ga0501043_0017493
1261 Ga0501043_0020833
1262 Ga0501043_0030131
1263 Ga0501043_0046081
1264 Ga0501043_0050912
1265 Ga0501043_0171761
1266 Ga0501043_0664780
1267 Ga0501046_0019522
1268 Ga0501046_0057042
1269 Ga0501046_0136659
1270 Ga0501046_0425137
1271 Ga0501046_0499734
1272 Ga0501047_0002168
1273 Ga0501047_0021536
1274 Ga0501047_0044156
1275 Ga0501047_0050033
1276 Ga0501047_0050785
1277 Ga0501047_0102940
1278 Ga0501047_0159408
1279 Ga0501047_0316684
1280 Ga0501047_1236970
1281 Ga0501048_0010396
1282 Ga0501048_0037284
1283 Ga0501048_0049294
1284 Ga0501048_0443511
1285 Ga0501048_1084327
1286 Ga0501067_0006655
1287 Ga0501067_0020907
1288 Ga0501067_0038586
1289 Ga0501067_0175183
1290 Ga0501067_0419001
1291 Ga0501068_0001171
1292 Ga0501068_0215709
1293 Ga0501068_0217055
1294 Ga0501069_0008895
1295 Ga0501069_0034515
1296 Ga0501069_0082110
1297 Ga0501069_0185919
1298 Ga0501069_0284407
1299 Ga0501069_0591684
1300 Ga0501070_0004802
1301 Ga0501070_0012556
1302 Ga0501070_0028923
1303 Ga0501070_0147189
1304 Ga0501070_0841512
1305 Ga0501070_1413567
1306 Ga0501071_0000482
1307 Ga0501071_0076775
1308 Ga0501071_0623119
1309 Ga0501072_0003972
1310 Ga0501072_0005647
1311 Ga0501072_0031379
1312 Ga0501072_0160405
1313 Ga0501072_0176391
1314 Ga0501072_0482470
1315 Ga0501073_0018390
1316 Ga0501074_0002011
1317 Ga0501074_0119151
1318 Ga0501074_0199086
1319 Ga0501074_0397625
1320 Ga0501075_0072038
1321 Ga0501076_0017285
1322 Ga0501076_0028989
1323 Ga0501077_0030242
1324 Ga0501077_0062707
1325 Ga0501209_206176
1326 Ga0501214_025901
1327 Ga0501079_0007398
1328 Ga0501079_0846870
1329 Ga0501080_0024714
1330 Ga0501080_0128855
1331 Ga0501080_0460955
1332 Ga0501080_0906390
1333 Ga0501081_0905177
1334 Ga0501083_0001134
1335 Ga0501083_0099889
1336 Ga0501035_0004736
1337 Ga0501035_0019427
1338 Ga0501035_0021596
1339 Ga0501035_0023699
1340 Ga0501035_0028830
1341 Ga0501035_0031773
1342 Ga0501035_0058750
1343 Ga0501035_0121238
1344 Ga0501035_0124524
1345 Ga0501035_0179842
1346 Ga0501035_0199559
1347 Ga0501035_0441671
1348 Ga0501035_0482919
1349 Ga0501044_0000976
1350 Ga0501044_0009892
1351 Ga0501044_0020298
1352 Ga0501044_0031412
1353 Ga0501044_0068718
1354 Ga0501044_0110717
1355 Ga0501044_0274396
1356 Ga0501044_0333890
1357 Ga0501044_1009585
1358 Ga0501044_1167216
1359 Ga0501045_0005054
1360 Ga0501045_0005598
1361 Ga0501045_0046124
1362 Ga0501045_0166204
1363 Ga0501045_0230674
1364 Ga0501045_0442166
1365 nmdc:mga03n38_27987_c1
1366 nmdc:mga0yw44_348455_c1
1367 nmdc:mga06z11_3487_c1
1368 nmdc:mga06z11_910127_c1
1369 nmdc:mga04h51_40559_c1
1370 nmdc:mga07m45_192830_c1
1371 nmdc:mga05p37_100218_c2
1372 nmdc:mga05p37_1373286_c1
1373 nmdc:mga05p37_227931_c1
1374 nmdc:mga05p37_236167_c1
1375 nmdc:mga09592_5580_c1
1376 nmdc:mga0qj67_1051493_c1
1377 nmdc:mga0qj67_45155_c1
1378 nmdc:mga06r32_1081904_c1
1379 nmdc:mga06r32_1897534_c1
1380 nmdc:mga06r32_6286_c1
1381 nmdc:mga08y16_1352395_c1
1382 nmdc:mga0a205_820048_c1
1383 Ga0495601_0031520
1384 Ga0500610_0042187
1385 Ga0500635_0150044
1386 Ga0495655_0078114
1387 Ga0495655_0200208
1388 Ga0500583_0332878
1389 Ga0500640_112165
1390 Ga0500650_0343647
1391 Ga0500560_026028
1392 Ga0500608_219170
1393 Ga0500573_0145828
1394 Ga0500600_0159501
1395 Ga0501084_0105787
1396 Ga0501084_0554106
1397 Ga0501082_0014792
1398 Ga0501082_0992792
1399 Ga0501082_1620757
1400 Ga0466962_0173239
1401 Ga0466962_0238865
1402 Ga0466962_0275704
1403 Ga0530510_0023169
1404 Ga0530510_0206636
1405 Ga0530510_0296000
1406 8056453216
1407 2547410352
1408 2585314689
1409 2616698302
1410 2644438838
1411 2644631259
1412 2760621704
1413 2785340020
1414 2808845049
1415 2808914650
1416 2812354641
1417 2812477614
1418 2852636260
1419 2862283344
1420 2862576400
1421 2866552104
1422 2919471157
1423 2946071022
1424 2946078953
1425 2947225692
1426 2954009848
1427 3006490187
1428 3006494272
1429 8048407104
1430 8056583409

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02566

OsmC

OsmC-like protein

75

170

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ukk-assembly1.cif.gz_B structure of osmotically inducible protein c from thermus thermophilus 0.9323 17 156
1ukk-assembly1.cif.gz_B structure of osmotically inducible protein c from thermus thermophilus 0.9196 17 156
1qwi-assembly1.cif.gz_B crystal structure of e. coli osmc 0.9056 16 155
1nye-assembly1.cif.gz_A crystal structure of osmc from e. coli 0.9004 15 156
1nye-assembly2.cif.gz_D crystal structure of osmc from e. coli 0.9001 15 155
ID Description Score Start End Superfamily
1ukkB00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9182 17 156 3.30.300.20
1ukkB00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9119 17 156 3.30.300.20
af_Q55E30_8_160_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8841 18 154 3.30.300.20
af_Q55EI4_11_156_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8833 20 156 3.30.300.20
1nyeE00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8822 10 155 3.30.300.20
ID Description Score Start End GO Terms
AF-A0A7W0QLY7-F1-model_v4 OsmC family peroxiredoxin 0.9986 69 156 GO:0004601
GO:0006979
AF-A0A6G3XRH8-F1-model_v4 OsmC family peroxiredoxin 0.998 75 156 GO:0004601
GO:0006979
AF-A0A7G1NTP2-F1-model_v4 Peroxiredoxin 0.995 15 156 GO:0004601
GO:0006979
AF-A0A3Q8VTH2-F1-model_v4 OsmC family peroxiredoxin 0.9949 15 156 GO:0004601
GO:0006979
AF-A0A0N0TAM5-F1-model_v4 Peroxiredoxin 0.9943 30 156 GO:0004601
GO:0006979

Map