F477000

General Info

Members Datasets Scaffolds Average Seq Length
715 283 1430 155

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0517561|Ga0395905_0517561_27_731
Length 181
Sequence MIGTGILKGMAVTARNFVGSYFDKERLITVQYPEERNPLPENYRNFPFLIYDGNDSHAGLRCVACKICEKECPPQCIYIVKSEDKKPDYMGKPQFYPKVFDIDISVKDFELSRRERFNALLMRKDDLAKSNDYYHKIHPIEATAVDKNLADALRHNEAGTEAAGSPSAPNEAPKPPANASS

Samples

Sample ID Description Type Environment
1 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
2 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
75 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
113 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
117 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
181 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
182 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
183 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
184 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
185 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
186 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
187 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
188 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
189 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
190 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
191 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
192 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
193 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
194 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
195 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
196 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
197 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
198 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
199 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
200 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
201 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
202 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
203 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
204 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
205 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
206 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
207 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
208 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
209 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
210 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
211 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
212 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
213 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
214 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
215 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
216 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
217 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
218 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
219 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
220 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
221 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
222 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
223 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
224 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
225 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
226 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
227 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
228 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
229 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
230 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
231 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
232 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
233 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
234 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
235 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
236 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
237 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
238 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
239 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
240 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
241 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
242 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
243 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
244 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
245 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
246 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
247 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
248 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
249 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
250 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
251 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
252 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
253 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
254 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
255 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
256 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
257 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
258 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
259 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
260 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
261 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
262 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
263 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
264 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
265 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
266 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
267 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
268 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
269 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
270 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
271 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
272 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
273 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
274 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
275 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
276 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
277 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
279 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
280 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
281 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
282 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
283 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.43
Rhizosphere 93.29
Stem 0
Stem Tuber 0
Unclassified 17.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395905_0517561 3300037471 Bacteria 1094
2 CNXas_1000059 3300000545 Bacteria 21595
3 JGI24737J22298_10033978 3300001990 Bacteria 1582
4 JGI24035J26624_1000988 3300002126 Bacteria 2680
5 JGI24035J26624_1011344 3300002126 Bacteria 892
6 JGI25406J46586_10000016 3300003203 Bacteria 91056
7 rootH2_10009122 3300003320 Bacteria 11891
8 JGI25405J52794_10000347 3300003911 Bacteria 6484
9 JGI25405J52794_10021128 3300003911 Unclassified 1315
10 Ga0065704_10079155 3300005289 Bacteria 4243
11 Ga0065704_10102297 3300005289 Bacteria 2210
12 Ga0065704_10373220 3300005289 Bacteria 763
13 Ga0065712_10003067 3300005290 Bacteria 3965
14 Ga0065712_10032399 3300005290 Bacteria 1375
15 Ga0065715_10015031 3300005293 Bacteria 2910
16 Ga0065715_10171439 3300005293 Unclassified 1474
17 Ga0065715_10216380 3300005293 Bacteria 1291
18 Ga0065707_10006567 3300005295 Bacteria 2536
19 Ga0065707_10147055 3300005295 Bacteria 1668
20 Ga0070676_10010421 3300005328 Bacteria 5042
21 Ga0070676_10017105 3300005328 Bacteria 4010
22 Ga0070676_10098353 3300005328 Unclassified 1804
23 Ga0070683_100004288 3300005329 Bacteria 11712
24 Ga0070683_100042793 3300005329 Bacteria 4171
25 Ga0070683_100137586 3300005329 Unclassified 2314
26 Ga0070683_100451539 3300005329 Bacteria 1226
27 Ga0070683_100753751 3300005329 Bacteria 933
28 Ga0070690_100210338 3300005330 Bacteria 1358
29 Ga0070690_100281948 3300005330 Bacteria 1185
30 Ga0070670_100114661 3300005331 Bacteria 2323
31 Ga0070670_100290771 3300005331 Bacteria 1428
32 Ga0070670_100591209 3300005331 Unclassified 993
33 Ga0070670_101106295 3300005331 Bacteria 723
34 Ga0068869_100028267 3300005334 Bacteria 3918
35 Ga0070666_10032419 3300005335 Bacteria 3451
36 Ga0070666_10049994 3300005335 Bacteria 2811
37 Ga0070666_10080321 3300005335 Bacteria 2228
38 Ga0070680_100757448 3300005336 Unclassified 836
39 Ga0068868_100051273 3300005338 Bacteria 3245
40 Ga0068868_100106418 3300005338 Unclassified 2275
41 Ga0068868_100174164 3300005338 Bacteria 1783
42 Ga0068868_100441846 3300005338 Unclassified 1130
43 Ga0068868_100756005 3300005338 Bacteria 874
44 Ga0070660_100003154 3300005339 Bacteria 11326
45 Ga0070660_100062327 3300005339 Bacteria 2897
46 Ga0070660_100431753 3300005339 Bacteria 1091
47 Ga0070689_100001811 3300005340 Bacteria 13740
48 Ga0070689_100002264 3300005340 Bacteria 12502
49 Ga0070689_100041277 3300005340 Viruses 3541
50 Ga0070689_100364005 3300005340 Bacteria 1216
51 Ga0070689_100402689 3300005340 Unclassified 1157
52 Ga0070689_100554050 3300005340 Bacteria 991
53 Ga0070689_101208218 3300005340 Unclassified 679
54 Ga0070687_100077469 3300005343 Bacteria 1804
55 Ga0070687_100119080 3300005343 Bacteria 1507
56 Ga0070661_100052959 3300005344 Bacteria 2969
57 Ga0070661_100317235 3300005344 Bacteria 1217
58 Ga0070668_100015886 3300005347 Bacteria 5632
59 Ga0070668_100017330 3300005347 Viruses 5394
60 Ga0070668_100024796 3300005347 Bacteria 4545
61 Ga0070668_100114176 3300005347 Unclassified 2152
62 Ga0070668_100159081 3300005347 Unclassified 1832
63 Ga0070668_100267195 3300005347 Bacteria 1424
64 Ga0070669_100001631 3300005353 Bacteria 16233
65 Ga0070669_100006376 3300005353 Bacteria 8499
66 Ga0070669_101082460 3300005353 Bacteria 690
67 Ga0070675_100001249 3300005354 Bacteria 18557
68 Ga0070675_100015899 3300005354 Bacteria 5959
69 Ga0070675_100111452 3300005354 Bacteria 2315
70 Ga0070675_100117137 3300005354 Bacteria 2260
71 Ga0070675_100154693 3300005354 Bacteria 1968
72 Ga0070675_100180732 3300005354 Unclassified 1824
73 Ga0070675_100315297 3300005354 Bacteria 1380
74 Ga0070675_100631826 3300005354 Viruses 972
75 Ga0070671_100037191 3300005355 Bacteria 4037
76 Ga0070671_100040675 3300005355 Bacteria 3862
77 Ga0070671_100196167 3300005355 Bacteria 1712
78 Ga0070671_100304592 3300005355 Bacteria 1357
79 Ga0070671_100577366 3300005355 Bacteria 971
80 Ga0070671_100676441 3300005355 Unclassified 894
81 Ga0070674_100005928 3300005356 Bacteria 7106
82 Ga0070674_100033581 3300005356 Bacteria 3417
83 Ga0070674_100098178 3300005356 Bacteria 2129
84 Ga0070674_100113172 3300005356 Unclassified 1996
85 Ga0070674_100727232 3300005356 Bacteria 851
86 Ga0070673_100010203 3300005364 Bacteria 6346
87 Ga0070673_100014486 3300005364 Bacteria 5496
88 Ga0070673_100034620 3300005364 Bacteria 3823
89 Ga0070673_100081299 3300005364 Bacteria 2627
90 Ga0070673_100135330 3300005364 Viruses 2073
91 Ga0070688_100007000 3300005365 Bacteria 6062
92 Ga0070688_100009653 3300005365 Bacteria 5291
93 Ga0070688_100022114 3300005365 Bacteria 3722
94 Ga0070688_100043686 3300005365 Bacteria 2762
95 Ga0070659_100002955 3300005366 Bacteria 12119
96 Ga0070659_100032041 3300005366 Bacteria 4075
97 Ga0070659_100284546 3300005366 Bacteria 1376
98 Ga0070667_100016403 3300005367 Bacteria 6129
99 Ga0070667_100063311 3300005367 Bacteria 3134
100 Ga0070667_100154546 3300005367 Bacteria 2017
101 Ga0070667_100158759 3300005367 Bacteria 1990
102 Ga0070667_100299527 3300005367 Bacteria 1448
103 Ga0070667_100851308 3300005367 Unclassified 848
104 Ga0070709_10236557 3300005434 Unclassified 1309
105 Ga0070714_100028845 3300005435 Bacteria 4608
106 Ga0070714_100060373 3300005435 Bacteria 3253
107 Ga0070714_100328574 3300005435 Bacteria 1431
108 Ga0070714_100570408 3300005435 Bacteria 1085
109 Ga0070713_100194573 3300005436 Unclassified 1829
110 Ga0070713_100338376 3300005436 Bacteria 1394
111 Ga0070710_10033162 3300005437 Unclassified 2803
112 Ga0070710_10129189 3300005437 Bacteria 1538
113 Ga0070710_10283007 3300005437 Unclassified 1077
114 Ga0070711_100001814 3300005439 Bacteria 11907
115 Ga0070711_100355533 3300005439 Bacteria 1179
116 Ga0070705_100043127 3300005440 Bacteria 2583
117 Ga0070705_100473314 3300005440 Bacteria 945
118 Ga0070705_100644851 3300005440 Unclassified 825
119 Ga0070705_100746962 3300005440 Bacteria 773
120 Ga0070700_100032389 3300005441 Bacteria 3140
121 Ga0070694_100055935 3300005444 Bacteria 2678
122 Ga0070708_100064861 3300005445 Bacteria 3273
123 Ga0070708_100071619 3300005445 Bacteria 3121
124 Ga0070708_100141852 3300005445 Bacteria 2228
125 Ga0070708_100154294 3300005445 Unclassified 2137
126 Ga0070708_100176253 3300005445 Bacteria 1998
127 Ga0070708_100238934 3300005445 Bacteria 1706
128 Ga0070708_100305705 3300005445 Unclassified 1497
129 Ga0070678_100077203 3300005456 Bacteria 2512
130 Ga0070678_100149931 3300005456 Bacteria 1877
131 Ga0070678_100539116 3300005456 Bacteria 1034
132 Ga0070678_100752153 3300005456 Unclassified 882
133 Ga0070662_100000642 3300005457 Bacteria 21102
134 Ga0070662_100053487 3300005457 Unclassified 2923
135 Ga0070662_100107613 3300005457 Bacteria 2120
136 Ga0070662_100189901 3300005457 Bacteria 1624
137 Ga0070662_100664532 3300005457 Unclassified 880
138 Ga0070681_10234913 3300005458 Bacteria 1747
139 Ga0070685_10106478 3300005466 Bacteria 1720
140 Ga0070685_10261463 3300005466 Bacteria 1151
141 Ga0070685_10484017 3300005466 Bacteria 873
142 Ga0070706_100000159 3300005467 Bacteria 86016
143 Ga0070706_100006694 3300005467 Bacteria 10875
144 Ga0070706_100012745 3300005467 Bacteria 7778
145 Ga0070706_100018243 3300005467 Bacteria 6476
146 Ga0070706_100028784 3300005467 Bacteria 5117
147 Ga0070706_100068705 3300005467 Bacteria 3277
148 Ga0070706_100099230 3300005467 Bacteria 2706
149 Ga0070706_100111358 3300005467 Bacteria 2547
150 Ga0070706_100225009 3300005467 Bacteria 1751
151 Ga0070706_100415228 3300005467 Bacteria 1253
152 Ga0070706_100516732 3300005467 Bacteria 1111
153 Ga0070706_100956404 3300005467 Bacteria 790
154 Ga0070707_100000143 3300005468 Bacteria 67554
155 Ga0070707_100028288 3300005468 Bacteria 5334
156 Ga0070707_100041053 3300005468 Bacteria 4427
157 Ga0070707_100082730 3300005468 Bacteria 3101
158 Ga0070707_100138327 3300005468 Bacteria 2369
159 Ga0070707_100144939 3300005468 Unclassified 2312
160 Ga0070707_100152444 3300005468 Bacteria 2251
161 Ga0070707_100274819 3300005468 Bacteria 1638
162 Ga0070707_101025271 3300005468 Unclassified 791
163 Ga0070698_100018927 3300005471 Bacteria 7243
164 Ga0070698_100166457 3300005471 Bacteria 2147
165 Ga0070698_100483711 3300005471 Bacteria 1175
166 Ga0070699_100219892 3300005518 Bacteria 1692
167 Ga0070699_100312101 3300005518 Bacteria 1412
168 Ga0070679_100092852 3300005530 Bacteria 3005
169 Ga0070684_100000179 3300005535 Bacteria 43838
170 Ga0070684_100040436 3300005535 Bacteria 4015
171 Ga0070684_100207605 3300005535 Viruses 1785
172 Ga0070684_100522238 3300005535 Bacteria 1100
173 Ga0070684_100554196 3300005535 Bacteria 1067
174 Ga0070684_100580944 3300005535 Unclassified 1041
175 Ga0070684_100625870 3300005535 Bacteria 1001
176 Ga0070697_100018542 3300005536 Bacteria 5487
177 Ga0070697_100035635 3300005536 Bacteria 4015
178 Ga0070697_100077373 3300005536 Bacteria 2736
179 Ga0070697_100123586 3300005536 Unclassified 2166
180 Ga0070697_100208411 3300005536 Bacteria 1663
181 Ga0070697_100269686 3300005536 Bacteria 1459
182 Ga0070697_100474736 3300005536 Bacteria 1092
183 Ga0070697_100864223 3300005536 Unclassified 802
184 Ga0068853_100256880 3300005539 Viruses 1605
185 Ga0068853_101040103 3300005539 Bacteria 789
186 Ga0070672_100006804 3300005543 Bacteria 7720
187 Ga0070672_100014164 3300005543 Viruses 5642
188 Ga0070672_100219748 3300005543 Bacteria 1593
189 Ga0070686_100049449 3300005544 Bacteria 2668
190 Ga0070686_100160828 3300005544 Unclassified 1581
191 Ga0070695_100031071 3300005545 Unclassified 3328
192 Ga0070696_100048750 3300005546 Bacteria 2941
193 Ga0070665_100102203 3300005548 Bacteria 2869
194 Ga0070665_100121258 3300005548 Bacteria 2616
195 Ga0070665_100125194 3300005548 Bacteria 2572
196 Ga0070665_100582841 3300005548 Bacteria 1131
197 Ga0070704_101060801 3300005549 Unclassified 735
198 Ga0068855_100349884 3300005563 Bacteria 1628
199 Ga0068855_100642797 3300005563 Unclassified 1140
200 Ga0068855_100690792 3300005563 Bacteria 1093
201 Ga0070664_100045734 3300005564 Bacteria 3697
202 Ga0070664_100087215 3300005564 Bacteria 2698
203 Ga0070664_100160815 3300005564 Bacteria 1987
204 Ga0070664_100221663 3300005564 Bacteria 1692
205 Ga0068856_100142538 3300005614 Bacteria 2403
206 Ga0068852_101133192 3300005616 Unclassified 803
207 Ga0068859_100009257 3300005617 Bacteria 9946
208 Ga0068859_100369945 3300005617 Unclassified 1529
209 Ga0068864_100150778 3300005618 Bacteria 2106
210 Ga0068864_101628506 3300005618 Unclassified 650
211 Ga0068866_10643625 3300005718 Unclassified 721
212 Ga0068863_100049523 3300005841 Bacteria 3984
213 Ga0068863_100345252 3300005841 Bacteria 1449
214 Ga0068863_100531493 3300005841 Unclassified 1160
215 Ga0068858_100008463 3300005842 Bacteria 9889
216 Ga0068858_100677572 3300005842 Bacteria 1003
217 Ga0068858_101030044 3300005842 Bacteria 807
218 Ga0068860_100001331 3300005843 Bacteria 26860
219 Ga0068860_100027665 3300005843 Bacteria 5460
220 Ga0068860_100109380 3300005843 Bacteria 2642
221 Ga0068860_100926309 3300005843 Unclassified 888
222 Ga0068860_101038195 3300005843 Bacteria 838
223 Ga0068862_100004080 3300005844 Bacteria 12384
224 Ga0081455_10000781 3300005937 Bacteria 40919
225 Ga0081455_10001020 3300005937 Bacteria 35311
226 Ga0081455_10012135 3300005937 Bacteria 8609
227 Ga0081455_10038206 3300005937 Bacteria 4252
228 Ga0081455_10051539 3300005937 Bacteria 3530
229 Ga0081455_10105954 3300005937 Bacteria 2245
230 Ga0081455_10139109 3300005937 Bacteria 1888
231 Ga0081540_1000031 3300005983 Bacteria 147094
232 Ga0081540_1011395 3300005983 Bacteria 5944
233 Ga0081540_1121338 3300005983 Bacteria 1084
234 Ga0081540_1191235 3300005983 Bacteria 754
235 Ga0081539_10000383 3300005985 Bacteria 95995
236 Ga0081539_10015010 3300005985 Bacteria 5676
237 Ga0081539_10016822 3300005985 Bacteria 5188
238 Ga0081539_10085773 3300005985 Unclassified 1641
239 Ga0070717_10066598 3300006028 Bacteria 2996
240 Ga0070717_10129810 3300006028 Bacteria 2166
241 Ga0070717_10426329 3300006028 Bacteria 1193
242 Ga0070717_10673052 3300006028 Bacteria 940
243 Ga0070717_10775670 3300006028 Bacteria 872
244 Ga0070715_10006690 3300006163 Bacteria 3935
245 Ga0070715_10214617 3300006163 Bacteria 986
246 Ga0070716_100019890 3300006173 Bacteria 3516
247 Ga0070716_100026658 3300006173 Unclassified 3097
248 Ga0070716_100276912 3300006173 Bacteria 1156
249 Ga0070712_100039145 3300006175 Unclassified 3243
250 Ga0070712_100230652 3300006175 Bacteria 1470
251 Ga0097621_100306582 3300006237 Viruses 1404
252 Ga0097621_100457213 3300006237 Bacteria 1151
253 Ga0068871_100118221 3300006358 Bacteria 2236
254 Ga0068871_100136959 3300006358 Bacteria 2080
255 Ga0075434_100519011 3300006871 Bacteria 1212
256 Ga0075434_100644505 3300006871 Bacteria 1078
257 Ga0068865_100108664 3300006881 Bacteria 2042
258 Ga0068865_101401699 3300006881 Unclassified 624
259 Ga0075436_100041724 3300006914 Bacteria 3166
260 Ga0075436_100145039 3300006914 Unclassified 1669
261 Ga0097620_100009257 3300006931 Bacteria 9946
262 Ga0097620_100369931 3300006931 Unclassified 1529
263 Ga0075435_100098928 3300007076 Bacteria 2415
264 Ga0075435_100993080 3300007076 Unclassified 733
265 Ga0099794_10121759 3300007265 Bacteria 1313
266 Ga0099794_10420019 3300007265 Bacteria 699
267 Ga0105240_10555860 3300009093 Bacteria 1269
268 Ga0105240_10580343 3300009093 Bacteria 1237
269 Ga0111539_10539530 3300009094 Unclassified 1359
270 Ga0105245_10074701 3300009098 Unclassified 3085
271 Ga0105245_10085422 3300009098 Bacteria 2892
272 Ga0105245_10089962 3300009098 Bacteria 2823
273 Ga0105247_10100496 3300009101 Bacteria 1849
274 Ga0114129_10018230 3300009147 Bacteria 9996
275 Ga0114129_11306806 3300009147 Unclassified 899
276 Ga0105243_10025677 3300009148 Bacteria 4505
277 Ga0105242_10057522 3300009176 Bacteria 3185
278 Ga0105242_10671640 3300009176 Bacteria 1010
279 Ga0105242_10930173 3300009176 Unclassified 872
280 Ga0105248_10562184 3300009177 Bacteria 1287
281 Ga0105248_10749855 3300009177 Bacteria 1102
282 Ga0105237_10185750 3300009545 Bacteria 2079
283 Ga0105237_10418318 3300009545 Bacteria 1346
284 Ga0105249_10035706 3300009553 Bacteria 4507
285 Ga0099796_10011589 3300010159 Unclassified 2464
286 Ga0105239_10022580 3300010375 Bacteria 6937
287 Ga0105239_10082520 3300010375 Bacteria 3540
288 Ga0157314_1005213 3300012500 Bacteria 981
289 Ga0157371_10137270 3300013102 Bacteria 1741
290 Ga0157370_10036669 3300013104 Bacteria 4756
291 Ga0157369_10211105 3300013105 Bacteria 2035
292 Ga0157374_10043108 3300013296 Bacteria 4166
293 Ga0157374_10045219 3300013296 Bacteria 4075
294 Ga0157374_10122036 3300013296 Bacteria 2515
295 Ga0157374_10163004 3300013296 Bacteria 2172
296 Ga0157374_10192159 3300013296 Unclassified 1997
297 Ga0157374_10244083 3300013296 Bacteria 1766
298 Ga0157374_10265071 3300013296 Bacteria 1693
299 Ga0157374_10410454 3300013296 Bacteria 1352
300 Ga0157374_10799929 3300013296 Unclassified 959
301 Ga0157378_10002650 3300013297 Bacteria 15941
302 Ga0157378_10030197 3300013297 Bacteria 4788
303 Ga0157378_10050099 3300013297 Bacteria 3716
304 Ga0157378_10073342 3300013297 Bacteria 3077
305 Ga0157378_10105855 3300013297 Unclassified 2573
306 Ga0157378_10126918 3300013297 Bacteria 2357
307 Ga0157378_10213771 3300013297 Bacteria 1830
308 Ga0157378_10217920 3300013297 Bacteria 1813
309 Ga0157378_10260718 3300013297 Bacteria 1663
310 Ga0157378_12027857 3300013297 Unclassified 625
311 Ga0163162_10063360 3300013306 Bacteria 3740
312 Ga0163162_10114657 3300013306 Bacteria 2794
313 Ga0163162_10149849 3300013306 Unclassified 2450
314 Ga0157372_10009600 3300013307 Bacteria 10285
315 Ga0157372_10067379 3300013307 Bacteria 4022
316 Ga0157372_10074586 3300013307 Bacteria 3826
317 Ga0157372_10239853 3300013307 Unclassified 2103
318 Ga0157372_10291826 3300013307 Bacteria 1897
319 Ga0157375_10002872 3300013308 Bacteria 14930
320 Ga0157375_10024560 3300013308 Bacteria 5580
321 Ga0157375_10025585 3300013308 Bacteria 5488
322 Ga0157375_10067172 3300013308 Bacteria 3582
323 Ga0163163_10144624 3300014325 Bacteria 2421
324 Ga0163163_10251183 3300014325 Bacteria 1819
325 Ga0163163_10275067 3300014325 Unclassified 1735
326 Ga0182008_10201107 3300014497 Unclassified 1014
327 Ga0157377_10090098 3300014745 Bacteria 1809
328 Ga0157379_10030679 3300014968 Bacteria 4788
329 Ga0157379_10962380 3300014968 Bacteria 812
330 Ga0157376_10004251 3300014969 Bacteria 9939
331 Ga0157376_10089002 3300014969 Bacteria 2668
332 Ga0157376_10157522 3300014969 Bacteria 2055
333 Ga0157376_10252892 3300014969 Bacteria 1647
334 Ga0157376_11243977 3300014969 Bacteria 773
335 Ga0182006_1051483 3300015261 Unclassified 1584
336 Ga0182005_1058506 3300015265 Bacteria 1052
337 Ga0163161_10016534 3300017792 Bacteria 5151
338 Ga0163161_10217481 3300017792 Bacteria 1478
339 Ga0207666_1000887 3300025271 Bacteria 3585
340 Ga0207666_1001531 3300025271 Unclassified 2728
341 Ga0207666_1012784 3300025271 Bacteria 1173
342 Ga0207673_1002731 3300025290 Bacteria 2031
343 Ga0207673_1006479 3300025290 Bacteria 1450
344 Ga0207697_10000626 3300025315 Bacteria 20087
345 Ga0207697_10000790 3300025315 Bacteria 17954
346 Ga0207697_10001407 3300025315 Bacteria 13171
347 Ga0207697_10001746 3300025315 Bacteria 11678
348 Ga0207697_10003875 3300025315 Bacteria 7294
349 Ga0207697_10009718 3300025315 Bacteria 4143
350 Ga0207697_10010084 3300025315 Unclassified 4056
351 Ga0207697_10035668 3300025315 Unclassified 2036
352 Ga0207697_10108170 3300025315 Bacteria 1189
353 Ga0207697_10248018 3300025315 Bacteria 787
354 Ga0207653_10023259 3300025885 Bacteria 1973
355 Ga0207682_10040316 3300025893 Bacteria 1902
356 Ga0207692_10178298 3300025898 Bacteria 1236
357 Ga0207642_10400118 3300025899 Unclassified 822
358 Ga0207710_10095248 3300025900 Bacteria 1398
359 Ga0207688_10004890 3300025901 Bacteria 7294
360 Ga0207688_10042397 3300025901 Bacteria 2534
361 Ga0207688_10214748 3300025901 Bacteria 1157
362 Ga0207680_10020476 3300025903 Bacteria 3561
363 Ga0207680_10110758 3300025903 Bacteria 1780
364 Ga0207680_10377060 3300025903 Unclassified 999
365 Ga0207647_10003329 3300025904 Bacteria 12071
366 Ga0207647_10289626 3300025904 Unclassified 934
367 Ga0207685_10062885 3300025905 Bacteria 1476
368 Ga0207685_10186046 3300025905 Bacteria 966
369 Ga0207699_10030004 3300025906 Unclassified 3039
370 Ga0207645_10001183 3300025907 Bacteria 21547
371 Ga0207645_10038169 3300025907 Viruses 3081
372 Ga0207645_10042786 3300025907 Bacteria 2898
373 Ga0207645_10046101 3300025907 Bacteria 2785
374 Ga0207645_10136848 3300025907 Unclassified 1595
375 Ga0207645_10525646 3300025907 Bacteria 802
376 Ga0207684_10000208 3300025910 Bacteria 91185
377 Ga0207684_10009053 3300025910 Bacteria 8819
378 Ga0207684_10018908 3300025910 Bacteria 5893
379 Ga0207684_10072635 3300025910 Unclassified 2922
380 Ga0207684_10096312 3300025910 Bacteria 2526
381 Ga0207684_10126877 3300025910 Bacteria 2190
382 Ga0207684_10137948 3300025910 Bacteria 2095
383 Ga0207684_10148420 3300025910 Bacteria 2017
384 Ga0207684_10202512 3300025910 Bacteria 1712
385 Ga0207684_10202704 3300025910 Bacteria 1711
386 Ga0207684_10387300 3300025910 Unclassified 1202
387 Ga0207684_10446524 3300025910 Bacteria 1110
388 Ga0207684_10507617 3300025910 Bacteria 1033
389 Ga0207684_10534125 3300025910 Bacteria 1004
390 Ga0207707_10047916 3300025912 Bacteria 3722
391 Ga0207671_10729467 3300025914 Bacteria 787
392 Ga0207693_10005761 3300025915 Bacteria 10279
393 Ga0207693_10082646 3300025915 Unclassified 2515
394 Ga0207693_10291406 3300025915 Bacteria 1279
395 Ga0207693_10395926 3300025915 Bacteria 1080
396 Ga0207693_10639790 3300025915 Unclassified 827
397 Ga0207663_10017214 3300025916 Bacteria 4022
398 Ga0207663_10281356 3300025916 Bacteria 1236
399 Ga0207663_10397159 3300025916 Unclassified 1054
400 Ga0207660_10324408 3300025917 Bacteria 1230
401 Ga0207660_10626794 3300025917 Unclassified 876
402 Ga0207662_10000409 3300025918 Bacteria 18985
403 Ga0207662_10108009 3300025918 Bacteria 1732
404 Ga0207662_10225431 3300025918 Unclassified 1222
405 Ga0207657_10007021 3300025919 Bacteria 11585
406 Ga0207657_10046052 3300025919 Bacteria 3822
407 Ga0207657_10099102 3300025919 Unclassified 2421
408 Ga0207657_10334277 3300025919 Unclassified 1196
409 Ga0207649_10031361 3300025920 Bacteria 3158
410 Ga0207649_10168810 3300025920 Bacteria 1522
411 Ga0207652_10178022 3300025921 Bacteria 1910
412 Ga0207646_10000183 3300025922 Bacteria 85731
413 Ga0207646_10000631 3300025922 Bacteria 45798
414 Ga0207646_10028560 3300025922 Bacteria 5075
415 Ga0207646_10038639 3300025922 Bacteria 4298
416 Ga0207646_10101185 3300025922 Bacteria 2583
417 Ga0207646_10111676 3300025922 Bacteria 2453
418 Ga0207646_10115681 3300025922 Bacteria 2409
419 Ga0207646_10218548 3300025922 Bacteria 1721
420 Ga0207646_11027915 3300025922 Unclassified 727
421 Ga0207681_10004167 3300025923 Bacteria 8952
422 Ga0207681_10005359 3300025923 Bacteria 7882
423 Ga0207681_10064328 3300025923 Unclassified 2533
424 Ga0207681_10100284 3300025923 Bacteria 2087
425 Ga0207650_10026570 3300025925 Bacteria 4131
426 Ga0207650_10296260 3300025925 Bacteria 1320
427 Ga0207659_10002134 3300025926 Bacteria 11726
428 Ga0207659_10004521 3300025926 Bacteria 8415
429 Ga0207659_10129366 3300025926 Bacteria 1946
430 Ga0207659_10528065 3300025926 Viruses 1001
431 Ga0207659_10866942 3300025926 Bacteria 776
432 Ga0207687_10072299 3300025927 Bacteria 2467
433 Ga0207700_10061383 3300025928 Unclassified 2851
434 Ga0207700_10378033 3300025928 Unclassified 1238
435 Ga0207664_10664085 3300025929 Bacteria 937
436 Ga0207644_10029919 3300025931 Bacteria 3781
437 Ga0207644_10039776 3300025931 Bacteria 3320
438 Ga0207644_10148476 3300025931 Bacteria 1812
439 Ga0207644_10163009 3300025931 Bacteria 1734
440 Ga0207644_10193770 3300025931 Bacteria 1599
441 Ga0207644_10475377 3300025931 Bacteria 1029
442 Ga0207644_10646268 3300025931 Bacteria 880
443 Ga0207706_10002682 3300025933 Bacteria 17347
444 Ga0207706_10013334 3300025933 Bacteria 7476
445 Ga0207706_10088201 3300025933 Bacteria 2727
446 Ga0207706_10157209 3300025933 Bacteria 1999
447 Ga0207706_10370901 3300025933 Bacteria 1243
448 Ga0207706_10373729 3300025933 Bacteria 1238
449 Ga0207670_10016080 3300025936 Bacteria 4487
450 Ga0207670_10073532 3300025936 Unclassified 2370
451 Ga0207670_10200987 3300025936 Unclassified 1514
452 Ga0207670_10211064 3300025936 Bacteria 1481
453 Ga0207670_10264435 3300025936 Bacteria 1335
454 Ga0207669_10097612 3300025937 Bacteria 1932
455 Ga0207669_10277895 3300025937 Unclassified 1261
456 Ga0207669_10440057 3300025937 Bacteria 1031
457 Ga0207704_10240780 3300025938 Unclassified 1352
458 Ga0207665_10035635 3300025939 Unclassified 3304
459 Ga0207665_10067610 3300025939 Bacteria 2433
460 Ga0207665_10299867 3300025939 Bacteria 1201
461 Ga0207691_10001501 3300025940 Bacteria 23232
462 Ga0207691_10020552 3300025940 Viruses 6243
463 Ga0207691_10127110 3300025940 Unclassified 2254
464 Ga0207691_10325759 3300025940 Bacteria 1317
465 Ga0207711_10485521 3300025941 Bacteria 1151
466 Ga0207689_10348577 3300025942 Bacteria 1231
467 Ga0207661_10007139 3300025944 Bacteria 7936
468 Ga0207661_10011869 3300025944 Bacteria 6328
469 Ga0207661_10495205 3300025944 Bacteria 1116
470 Ga0207661_10669337 3300025944 Bacteria 954
471 Ga0207679_10302526 3300025945 Unclassified 1379
472 Ga0207679_10390455 3300025945 Bacteria 1222
473 Ga0207679_10440580 3300025945 Bacteria 1153
474 Ga0207667_10714287 3300025949 Unclassified 1004
475 Ga0207667_10922045 3300025949 Bacteria 864
476 Ga0207651_10002173 3300025960 Bacteria 9282
477 Ga0207651_10569904 3300025960 Unclassified 986
478 Ga0207651_10714799 3300025960 Bacteria 883
479 Ga0207712_10003754 3300025961 Bacteria 9587
480 Ga0207712_10045682 3300025961 Bacteria 3034
481 Ga0207668_10002290 3300025972 Bacteria 11177
482 Ga0207668_10151188 3300025972 Bacteria 1797
483 Ga0207668_10179205 3300025972 Bacteria 1670
484 Ga0207668_10286948 3300025972 Bacteria 1352
485 Ga0207640_10260657 3300025981 Bacteria 1351
486 Ga0207658_10052352 3300025986 Bacteria 3012
487 Ga0207658_10096246 3300025986 Viruses 2308
488 Ga0207677_10131863 3300026023 Bacteria 1899
489 Ga0207677_10184954 3300026023 Unclassified 1642
490 Ga0207677_10309001 3300026023 Bacteria 1309
491 Ga0207703_10225527 3300026035 Unclassified 1677
492 Ga0207703_11496881 3300026035 Unclassified 649
493 Ga0207678_10909441 3300026067 Unclassified 778
494 Ga0207708_10008180 3300026075 Bacteria 7749
495 Ga0207708_10908121 3300026075 Bacteria 762
496 Ga0207708_11230671 3300026075 Unclassified 655
497 Ga0207702_10020253 3300026078 Bacteria 5510
498 Ga0207641_10082361 3300026088 Bacteria 2795
499 Ga0207641_10730925 3300026088 Bacteria 976
500 Ga0207648_10142916 3300026089 Viruses 2110
501 Ga0207648_10253233 3300026089 Bacteria 1570
502 Ga0207676_10871582 3300026095 Bacteria 882
503 Ga0207674_10390733 3300026116 Bacteria 1345
504 Ga0207675_100059613 3300026118 Bacteria 3562
505 Ga0207683_10014745 3300026121 Bacteria 6654
506 Ga0207683_10066068 3300026121 Bacteria 3189
507 Ga0207683_10105673 3300026121 Bacteria 2517
508 Ga0207683_10125058 3300026121 Bacteria 2311
509 Ga0207683_10381036 3300026121 Bacteria 1296
510 Ga0207683_10447935 3300026121 Bacteria 1190
511 Ga0207698_10881173 3300026142 Bacteria 901
512 Ga0209971_1047710 3300027682 Bacteria 1033
513 Ga0209974_10054499 3300027876 Bacteria 1347
514 Ga0268266_10034617 3300028379 Unclassified 4295
515 Ga0268266_10047937 3300028379 Bacteria 3661
516 Ga0268266_10212868 3300028379 Bacteria 1773
517 Ga0268266_10441937 3300028379 Bacteria 1235
518 Ga0268266_10734990 3300028379 Bacteria 952
519 Ga0268265_10116740 3300028380 Bacteria 2190
520 Ga0268264_10010837 3300028381 Bacteria 7532
521 Ga0268264_10087326 3300028381 Bacteria 2681
522 Ga0268264_10115576 3300028381 Unclassified 2357
523 Ga0268264_10413896 3300028381 Unclassified 1299
524 Ga0268264_10958689 3300028381 Bacteria 861
525 Ga0265337_1006564 3300028556 Bacteria 4466
526 Ga0265337_1027552 3300028556 Bacteria 1712
527 Ga0265326_10017412 3300028558 Bacteria 2073
528 Ga0265319_1002659 3300028563 Bacteria 9595
529 Ga0265319_1003274 3300028563 Bacteria 8521
530 Ga0265319_1004357 3300028563 Bacteria 7022
531 Ga0265319_1029232 3300028563 Bacteria 1936
532 Ga0265334_10009405 3300028573 Bacteria 4135
533 Ga0265334_10203145 3300028573 Bacteria 688
534 Ga0265318_10000372 3300028577 Bacteria 35288
535 Ga0265318_10005196 3300028577 Bacteria 6145
536 Ga0265318_10018337 3300028577 Bacteria 2857
537 Ga0265336_10009769 3300028666 Bacteria 3306
538 Ga0265336_10016109 3300028666 Bacteria 2447
539 Ga0265338_10003029 3300028800 Bacteria 24221
540 Ga0265338_10006524 3300028800 Bacteria 14835
541 Ga0265338_10080152 3300028800 Bacteria 2744
542 Ga0265324_10032484 3300029957 Bacteria 1824
543 Ga0265324_10034631 3300029957 Bacteria 1758
544 Ga0265320_10005869 3300031240 Bacteria 7817
545 Ga0265320_10007103 3300031240 Bacteria 6981
546 Ga0265320_10010800 3300031240 Bacteria 5412
547 Ga0265320_10032987 3300031240 Bacteria 2647
548 Ga0265320_10047071 3300031240 Bacteria 2110
549 Ga0265320_10061077 3300031240 Bacteria 1797
550 Ga0265320_10167297 3300031240 Bacteria 988
551 Ga0265325_10007901 3300031241 Bacteria 6328
552 Ga0265325_10071570 3300031241 Bacteria 1740
553 Ga0265325_10084544 3300031241 Bacteria 1573
554 Ga0265331_10014316 3300031250 Bacteria 4229
555 Ga0265327_10005729 3300031251 Bacteria 10237
556 Ga0265327_10012167 3300031251 Bacteria 5838
557 Ga0265316_10019883 3300031344 Bacteria 5731
558 Ga0265316_10119460 3300031344 Bacteria 1991
559 Ga0265313_10003683 3300031595 Bacteria 12239
560 Ga0265313_10013278 3300031595 Bacteria 4954
561 Ga0265313_10037934 3300031595 Bacteria 2404
562 Ga0265314_10000435 3300031711 Bacteria 55753
563 Ga0265314_10063999 3300031711 Bacteria 2492
564 Ga0265314_10127512 3300031711 Bacteria 1592
565 Ga0265314_10143083 3300031711 Bacteria 1476
566 Ga0265342_10124186 3300031712 Bacteria 1451
567 Ga0307412_10044794 3300031911 Unclassified 2888
568 Ga0307411_10063095 3300032005 Bacteria 2475
569 Ga0373926_0211479 3300035083 Bacteria 748
570 Ga0373944_0011018 3300035089 Unclassified 2473
571 Ga0373952_0017693 3300035092 Unclassified 1466
572 Ga0373932_0213347 3300035112 Bacteria 691
573 Ga0373956_0080455 3300035119 Bacteria 1495
574 Ga0373956_0094367 3300035119 Bacteria 1383
575 Ga0373957_0034611 3300035120 Bacteria 1872
576 Ga0373943_0032945 3300035170 Unclassified 2465
577 Ga0373946_0003668 3300035171 Bacteria 5438
578 Ga0373955_0317626 3300035172 Unclassified 941
579 Ga0373942_0182248 3300035207 Bacteria 689
580 Ga0373931_0124642 3300035691 Bacteria 1476
581 Ga0373935_0021051 3300035692 Unclassified 3991
582 Ga0373935_0052552 3300035692 Bacteria 2590
583 Ga0373935_0082485 3300035692 Bacteria 2092
584 Ga0373935_0088968 3300035692 Bacteria 2018
585 Ga0373927_0036679 3300035695 Bacteria 3188
586 Ga0373927_0476796 3300035695 Bacteria 824
587 Ga0373933_0189444 3300035724 Bacteria 1314
588 Ga0373947_0074647 3300035725 Bacteria 2087
589 Ga0373947_0154884 3300035725 Bacteria 1478
590 Ga0373937_0065074 3300036401 Bacteria 3355
591 Ga0373937_0105234 3300036401 Bacteria 2622
592 Ga0373925_0072961 3300037068 Bacteria 2597
593 Ga0373925_0525389 3300037068 Unclassified 972
594 Ga0373925_0576325 3300037068 Bacteria 926
595 Ga0395899_0145056 3300037312 Bacteria 1686
596 Ga0395900_0002235 3300037418 Bacteria 21586
597 Ga0395900_0360302 3300037418 Bacteria 1426
598 Ga0395905_0047606 3300037471 Bacteria 4017
599 Ga0395901_0000676 3300038443 Bacteria 39205
600 Ga0395901_0220945 3300038443 Bacteria 1980
601 Ga0395901_0654947 3300038443 Bacteria 1053
602 Ga0395901_1016605 3300038443 Bacteria 804
603 Ga0451847_0038405 3300041503 Unclassified 700
604 Ga0439455_0000789 3300042012 Bacteria 4789
605 Ga0439458_0009340 3300042157 Bacteria 2183
606 Ga0439460_0027453 3300042461 Unclassified 1599
607 Ga0451577_0000087 3300042876 Bacteria 207662
608 Ga0451577_0406765 3300042876 Bacteria 1235
609 Ga0453683_0003708 3300044673 Bacteria 11168
610 Ga0466964_0042904 3300044706 Bacteria 1834
611 Ga0453684_0003020 3300044712 Bacteria 39129
612 Ga0453684_0048204 3300044712 Bacteria 5638
613 Ga0453684_0102330 3300044712 Bacteria 3502
614 Ga0451576_0020753 3300045051 Bacteria 7150
615 Ga0451576_0059604 3300045051 Bacteria 3984
616 Ga0451576_0062062 3300045051 Bacteria 3897
617 Ga0451576_0721507 3300045051 Bacteria 1047
618 Ga0495592_0012951 3300046454 Bacteria 6340
619 Ga0495629_0114584 3300046459 Bacteria 1879
620 Ga0495641_0079208 3300046461 Unclassified 1472
621 Ga0495651_0188577 3300046462 Bacteria 1453
622 Ga0495580_0559843 3300046472 Bacteria 758
623 Ga0495662_0037217 3300046476 Bacteria 2350
624 Ga0495664_0354505 3300046477 Bacteria 883
625 Ga0495585_0147681 3300046492 Bacteria 1228
626 Ga0495594_0097746 3300046499 Bacteria 1650
627 Ga0495608_0162663 3300046511 Bacteria 1419
628 Ga0495628_0000626 3300046516 Bacteria 32314
629 Ga0495630_0022740 3300046517 Bacteria 4631
630 Ga0495630_0060052 3300046517 Bacteria 2853
631 Ga0495630_0707374 3300046517 Bacteria 771
632 Ga0495644_0225655 3300046523 Unclassified 725
633 Ga0495642_0447451 3300046528 Bacteria 571
634 Ga0495652_0077717 3300046529 Bacteria 2750
635 Ga0495652_0169437 3300046529 Bacteria 1687
636 Ga0495640_0171988 3300046533 Bacteria 1384
637 Ga0495586_0344210 3300046535 Bacteria 856
638 Ga0495598_0126648 3300046537 Unclassified 871
639 Ga0495645_0007221 3300046543 Bacteria 7733
640 Ga0495645_0068409 3300046543 Bacteria 2564
641 Ga0495667_0172465 3300046559 Bacteria 1390
642 Ga0495659_0056971 3300046664 Unclassified 1435
643 Ga0495588_0337261 3300046674 Bacteria 793
644 Ga0495657_0340474 3300046675 Bacteria 889
645 Ga0495599_0009597 3300046678 Bacteria 5920
646 Ga0495599_0115422 3300046678 Bacteria 1671
647 Ga0495658_0025721 3300046683 Bacteria 3149
648 Ga0495669_0005817 3300046684 Bacteria 5143
649 Ga0495613_0175651 3300046689 Bacteria 1518
650 Ga0495624_0080767 3300046690 Bacteria 2015
651 Ga0495581_0402429 3300047315 Bacteria 798
652 Ga0495604_0174393 3300047317 Bacteria 1509
653 Ga0495674_0183526 3300047319 Bacteria 1741
654 Ga0495675_0041516 3300047444 Bacteria 2932
655 Ga0495675_0275353 3300047444 Bacteria 1005
656 Ga0495684_0008357 3300047471 Bacteria 8021
657 Ga0495602_0128757 3300048088 Viruses 2022
658 Ga0496100_0010261 3300048903 Bacteria 5298
659 Ga0496101_0108195 3300048904 Bacteria 2090
660 Ga0496101_0151817 3300048904 Unclassified 1772
661 Ga0496101_0522690 3300048904 Bacteria 938
662 Ga0496102_0023376 3300048905 Bacteria 5489
663 Ga0496102_0132049 3300048905 Bacteria 2338
664 Ga0496102_0326088 3300048905 Bacteria 1446
665 Ga0496103_0111927 3300048906 Bacteria 1735
666 Ga0496103_0217885 3300048906 Unclassified 1228
667 Ga0496103_0316123 3300048906 Bacteria 1004
668 Ga0496104_0088402 3300048907 Bacteria 2960
669 Ga0496104_0111100 3300048907 Unclassified 2628
670 Ga0496104_0221168 3300048907 Unclassified 1806
671 Ga0496104_0361170 3300048907 Unclassified 1365
672 Ga0496104_0595867 3300048907 Bacteria 1015
673 Ga0496104_0751845 3300048907 Bacteria 882
674 Ga0496105_0105391 3300048908 Bacteria 2328
675 Ga0496105_0124601 3300048908 Bacteria 2124
676 Ga0496106_0027190 3300048909 Bacteria 4260
677 Ga0496106_0278980 3300048909 Bacteria 1339
678 Ga0496107_0002445 3300048910 Bacteria 12042
679 Ga0496107_0151987 3300048910 Bacteria 1713
680 Ga0496107_0261679 3300048910 Bacteria 1287
681 Ga0496108_0086706 3300048911 Bacteria 2658
682 Ga0496108_0380975 3300048911 Unclassified 1232
683 Ga0496108_0767151 3300048911 Bacteria 833
684 Ga0496109_0383518 3300048912 Bacteria 1328
685 Ga0496109_0418012 3300048912 Bacteria 1267
686 Ga0496109_0432516 3300048912 Bacteria 1243
687 Ga0496110_0014181 3300048913 Bacteria 6612
688 Ga0496110_0219027 3300048913 Bacteria 1731
689 Ga0496110_0227487 3300048913 Bacteria 1696
690 Ga0496110_0260664 3300048913 Viruses 1578
691 Ga0496111_0433817 3300048914 Bacteria 970
692 Ga0496112_0094882 3300048915 Bacteria 2954
693 Ga0496112_0166892 3300048915 Bacteria 2167
694 Ga0496112_0241768 3300048915 Bacteria 1758
695 Ga0496112_0266935 3300048915 Bacteria 1660
696 Ga0496112_0294232 3300048915 Bacteria 1569
697 Ga0496113_0039009 3300048916 Bacteria 3495
698 Ga0496113_0053683 3300048916 Bacteria 3014
699 Ga0496113_0206435 3300048916 Bacteria 1563
700 Ga0496114_0900249 3300048917 Unclassified 766
701 Ga0496115_0000589 3300048918 Bacteria 27866
702 Ga0496115_0006346 3300048918 Bacteria 8659
703 Ga0496115_0010025 3300048918 Bacteria 7059
704 Ga0501047_0120725 3300049581 Bacteria 2503
705 Ga0501035_0026902 3300049822 Bacteria 5259
706 nmdc:mga05p37_102706_c1 3300050507 Bacteria 3520
707 nmdc:mga05p37_1244057_c1 3300050507 Unclassified 764
708 nmdc:mga05p37_565335_c1 3300050507 Bacteria 1291
709 nmdc:mga0n895_1014346_c1 3300050512 Bacteria 810
710 nmdc:mga0n895_188829_c1 3300050512 Unclassified 2091
711 nmdc:mga0n895_464040_c1 3300050512 Bacteria 1278
712 nmdc:mga08x19_55728_c1 3300050514 Bacteria 2549
713 nmdc:mga0a205_566594_c1 3300050515 Unclassified 990
714 Ga0495601_0001289 3300053077 Bacteria 13769
715 Ga0495601_0071717 3300053077 Bacteria 2212
716 Ga0395905_0517561
717 CNXas_1000059
718 JGI24737J22298_10033978
719 JGI24035J26624_1000988
720 JGI24035J26624_1011344
721 JGI25406J46586_10000016
722 rootH2_10009122
723 JGI25405J52794_10000347
724 JGI25405J52794_10021128
725 Ga0065704_10079155
726 Ga0065704_10102297
727 Ga0065704_10373220
728 Ga0065712_10003067
729 Ga0065712_10032399
730 Ga0065715_10015031
731 Ga0065715_10171439
732 Ga0065715_10216380
733 Ga0065707_10006567
734 Ga0065707_10147055
735 Ga0070676_10010421
736 Ga0070676_10017105
737 Ga0070676_10098353
738 Ga0070683_100004288
739 Ga0070683_100042793
740 Ga0070683_100137586
741 Ga0070683_100451539
742 Ga0070683_100753751
743 Ga0070690_100210338
744 Ga0070690_100281948
745 Ga0070670_100114661
746 Ga0070670_100290771
747 Ga0070670_100591209
748 Ga0070670_101106295
749 Ga0068869_100028267
750 Ga0070666_10032419
751 Ga0070666_10049994
752 Ga0070666_10080321
753 Ga0070680_100757448
754 Ga0068868_100051273
755 Ga0068868_100106418
756 Ga0068868_100174164
757 Ga0068868_100441846
758 Ga0068868_100756005
759 Ga0070660_100003154
760 Ga0070660_100062327
761 Ga0070660_100431753
762 Ga0070689_100001811
763 Ga0070689_100002264
764 Ga0070689_100041277
765 Ga0070689_100364005
766 Ga0070689_100402689
767 Ga0070689_100554050
768 Ga0070689_101208218
769 Ga0070687_100077469
770 Ga0070687_100119080
771 Ga0070661_100052959
772 Ga0070661_100317235
773 Ga0070668_100015886
774 Ga0070668_100017330
775 Ga0070668_100024796
776 Ga0070668_100114176
777 Ga0070668_100159081
778 Ga0070668_100267195
779 Ga0070669_100001631
780 Ga0070669_100006376
781 Ga0070669_101082460
782 Ga0070675_100001249
783 Ga0070675_100015899
784 Ga0070675_100111452
785 Ga0070675_100117137
786 Ga0070675_100154693
787 Ga0070675_100180732
788 Ga0070675_100315297
789 Ga0070675_100631826
790 Ga0070671_100037191
791 Ga0070671_100040675
792 Ga0070671_100196167
793 Ga0070671_100304592
794 Ga0070671_100577366
795 Ga0070671_100676441
796 Ga0070674_100005928
797 Ga0070674_100033581
798 Ga0070674_100098178
799 Ga0070674_100113172
800 Ga0070674_100727232
801 Ga0070673_100010203
802 Ga0070673_100014486
803 Ga0070673_100034620
804 Ga0070673_100081299
805 Ga0070673_100135330
806 Ga0070688_100007000
807 Ga0070688_100009653
808 Ga0070688_100022114
809 Ga0070688_100043686
810 Ga0070659_100002955
811 Ga0070659_100032041
812 Ga0070659_100284546
813 Ga0070667_100016403
814 Ga0070667_100063311
815 Ga0070667_100154546
816 Ga0070667_100158759
817 Ga0070667_100299527
818 Ga0070667_100851308
819 Ga0070709_10236557
820 Ga0070714_100028845
821 Ga0070714_100060373
822 Ga0070714_100328574
823 Ga0070714_100570408
824 Ga0070713_100194573
825 Ga0070713_100338376
826 Ga0070710_10033162
827 Ga0070710_10129189
828 Ga0070710_10283007
829 Ga0070711_100001814
830 Ga0070711_100355533
831 Ga0070705_100043127
832 Ga0070705_100473314
833 Ga0070705_100644851
834 Ga0070705_100746962
835 Ga0070700_100032389
836 Ga0070694_100055935
837 Ga0070708_100064861
838 Ga0070708_100071619
839 Ga0070708_100141852
840 Ga0070708_100154294
841 Ga0070708_100176253
842 Ga0070708_100238934
843 Ga0070708_100305705
844 Ga0070678_100077203
845 Ga0070678_100149931
846 Ga0070678_100539116
847 Ga0070678_100752153
848 Ga0070662_100000642
849 Ga0070662_100053487
850 Ga0070662_100107613
851 Ga0070662_100189901
852 Ga0070662_100664532
853 Ga0070681_10234913
854 Ga0070685_10106478
855 Ga0070685_10261463
856 Ga0070685_10484017
857 Ga0070706_100000159
858 Ga0070706_100006694
859 Ga0070706_100012745
860 Ga0070706_100018243
861 Ga0070706_100028784
862 Ga0070706_100068705
863 Ga0070706_100099230
864 Ga0070706_100111358
865 Ga0070706_100225009
866 Ga0070706_100415228
867 Ga0070706_100516732
868 Ga0070706_100956404
869 Ga0070707_100000143
870 Ga0070707_100028288
871 Ga0070707_100041053
872 Ga0070707_100082730
873 Ga0070707_100138327
874 Ga0070707_100144939
875 Ga0070707_100152444
876 Ga0070707_100274819
877 Ga0070707_101025271
878 Ga0070698_100018927
879 Ga0070698_100166457
880 Ga0070698_100483711
881 Ga0070699_100219892
882 Ga0070699_100312101
883 Ga0070679_100092852
884 Ga0070684_100000179
885 Ga0070684_100040436
886 Ga0070684_100207605
887 Ga0070684_100522238
888 Ga0070684_100554196
889 Ga0070684_100580944
890 Ga0070684_100625870
891 Ga0070697_100018542
892 Ga0070697_100035635
893 Ga0070697_100077373
894 Ga0070697_100123586
895 Ga0070697_100208411
896 Ga0070697_100269686
897 Ga0070697_100474736
898 Ga0070697_100864223
899 Ga0068853_100256880
900 Ga0068853_101040103
901 Ga0070672_100006804
902 Ga0070672_100014164
903 Ga0070672_100219748
904 Ga0070686_100049449
905 Ga0070686_100160828
906 Ga0070695_100031071
907 Ga0070696_100048750
908 Ga0070665_100102203
909 Ga0070665_100121258
910 Ga0070665_100125194
911 Ga0070665_100582841
912 Ga0070704_101060801
913 Ga0068855_100349884
914 Ga0068855_100642797
915 Ga0068855_100690792
916 Ga0070664_100045734
917 Ga0070664_100087215
918 Ga0070664_100160815
919 Ga0070664_100221663
920 Ga0068856_100142538
921 Ga0068852_101133192
922 Ga0068859_100009257
923 Ga0068859_100369945
924 Ga0068864_100150778
925 Ga0068864_101628506
926 Ga0068866_10643625
927 Ga0068863_100049523
928 Ga0068863_100345252
929 Ga0068863_100531493
930 Ga0068858_100008463
931 Ga0068858_100677572
932 Ga0068858_101030044
933 Ga0068860_100001331
934 Ga0068860_100027665
935 Ga0068860_100109380
936 Ga0068860_100926309
937 Ga0068860_101038195
938 Ga0068862_100004080
939 Ga0081455_10000781
940 Ga0081455_10001020
941 Ga0081455_10012135
942 Ga0081455_10038206
943 Ga0081455_10051539
944 Ga0081455_10105954
945 Ga0081455_10139109
946 Ga0081540_1000031
947 Ga0081540_1011395
948 Ga0081540_1121338
949 Ga0081540_1191235
950 Ga0081539_10000383
951 Ga0081539_10015010
952 Ga0081539_10016822
953 Ga0081539_10085773
954 Ga0070717_10066598
955 Ga0070717_10129810
956 Ga0070717_10426329
957 Ga0070717_10673052
958 Ga0070717_10775670
959 Ga0070715_10006690
960 Ga0070715_10214617
961 Ga0070716_100019890
962 Ga0070716_100026658
963 Ga0070716_100276912
964 Ga0070712_100039145
965 Ga0070712_100230652
966 Ga0097621_100306582
967 Ga0097621_100457213
968 Ga0068871_100118221
969 Ga0068871_100136959
970 Ga0075434_100519011
971 Ga0075434_100644505
972 Ga0068865_100108664
973 Ga0068865_101401699
974 Ga0075436_100041724
975 Ga0075436_100145039
976 Ga0097620_100009257
977 Ga0097620_100369931
978 Ga0075435_100098928
979 Ga0075435_100993080
980 Ga0099794_10121759
981 Ga0099794_10420019
982 Ga0105240_10555860
983 Ga0105240_10580343
984 Ga0111539_10539530
985 Ga0105245_10074701
986 Ga0105245_10085422
987 Ga0105245_10089962
988 Ga0105247_10100496
989 Ga0114129_10018230
990 Ga0114129_11306806
991 Ga0105243_10025677
992 Ga0105242_10057522
993 Ga0105242_10671640
994 Ga0105242_10930173
995 Ga0105248_10562184
996 Ga0105248_10749855
997 Ga0105237_10185750
998 Ga0105237_10418318
999 Ga0105249_10035706
1000 Ga0099796_10011589
1001 Ga0105239_10022580
1002 Ga0105239_10082520
1003 Ga0157314_1005213
1004 Ga0157371_10137270
1005 Ga0157370_10036669
1006 Ga0157369_10211105
1007 Ga0157374_10043108
1008 Ga0157374_10045219
1009 Ga0157374_10122036
1010 Ga0157374_10163004
1011 Ga0157374_10192159
1012 Ga0157374_10244083
1013 Ga0157374_10265071
1014 Ga0157374_10410454
1015 Ga0157374_10799929
1016 Ga0157378_10002650
1017 Ga0157378_10030197
1018 Ga0157378_10050099
1019 Ga0157378_10073342
1020 Ga0157378_10105855
1021 Ga0157378_10126918
1022 Ga0157378_10213771
1023 Ga0157378_10217920
1024 Ga0157378_10260718
1025 Ga0157378_12027857
1026 Ga0163162_10063360
1027 Ga0163162_10114657
1028 Ga0163162_10149849
1029 Ga0157372_10009600
1030 Ga0157372_10067379
1031 Ga0157372_10074586
1032 Ga0157372_10239853
1033 Ga0157372_10291826
1034 Ga0157375_10002872
1035 Ga0157375_10024560
1036 Ga0157375_10025585
1037 Ga0157375_10067172
1038 Ga0163163_10144624
1039 Ga0163163_10251183
1040 Ga0163163_10275067
1041 Ga0182008_10201107
1042 Ga0157377_10090098
1043 Ga0157379_10030679
1044 Ga0157379_10962380
1045 Ga0157376_10004251
1046 Ga0157376_10089002
1047 Ga0157376_10157522
1048 Ga0157376_10252892
1049 Ga0157376_11243977
1050 Ga0182006_1051483
1051 Ga0182005_1058506
1052 Ga0163161_10016534
1053 Ga0163161_10217481
1054 Ga0207666_1000887
1055 Ga0207666_1001531
1056 Ga0207666_1012784
1057 Ga0207673_1002731
1058 Ga0207673_1006479
1059 Ga0207697_10000626
1060 Ga0207697_10000790
1061 Ga0207697_10001407
1062 Ga0207697_10001746
1063 Ga0207697_10003875
1064 Ga0207697_10009718
1065 Ga0207697_10010084
1066 Ga0207697_10035668
1067 Ga0207697_10108170
1068 Ga0207697_10248018
1069 Ga0207653_10023259
1070 Ga0207682_10040316
1071 Ga0207692_10178298
1072 Ga0207642_10400118
1073 Ga0207710_10095248
1074 Ga0207688_10004890
1075 Ga0207688_10042397
1076 Ga0207688_10214748
1077 Ga0207680_10020476
1078 Ga0207680_10110758
1079 Ga0207680_10377060
1080 Ga0207647_10003329
1081 Ga0207647_10289626
1082 Ga0207685_10062885
1083 Ga0207685_10186046
1084 Ga0207699_10030004
1085 Ga0207645_10001183
1086 Ga0207645_10038169
1087 Ga0207645_10042786
1088 Ga0207645_10046101
1089 Ga0207645_10136848
1090 Ga0207645_10525646
1091 Ga0207684_10000208
1092 Ga0207684_10009053
1093 Ga0207684_10018908
1094 Ga0207684_10072635
1095 Ga0207684_10096312
1096 Ga0207684_10126877
1097 Ga0207684_10137948
1098 Ga0207684_10148420
1099 Ga0207684_10202512
1100 Ga0207684_10202704
1101 Ga0207684_10387300
1102 Ga0207684_10446524
1103 Ga0207684_10507617
1104 Ga0207684_10534125
1105 Ga0207707_10047916
1106 Ga0207671_10729467
1107 Ga0207693_10005761
1108 Ga0207693_10082646
1109 Ga0207693_10291406
1110 Ga0207693_10395926
1111 Ga0207693_10639790
1112 Ga0207663_10017214
1113 Ga0207663_10281356
1114 Ga0207663_10397159
1115 Ga0207660_10324408
1116 Ga0207660_10626794
1117 Ga0207662_10000409
1118 Ga0207662_10108009
1119 Ga0207662_10225431
1120 Ga0207657_10007021
1121 Ga0207657_10046052
1122 Ga0207657_10099102
1123 Ga0207657_10334277
1124 Ga0207649_10031361
1125 Ga0207649_10168810
1126 Ga0207652_10178022
1127 Ga0207646_10000183
1128 Ga0207646_10000631
1129 Ga0207646_10028560
1130 Ga0207646_10038639
1131 Ga0207646_10101185
1132 Ga0207646_10111676
1133 Ga0207646_10115681
1134 Ga0207646_10218548
1135 Ga0207646_11027915
1136 Ga0207681_10004167
1137 Ga0207681_10005359
1138 Ga0207681_10064328
1139 Ga0207681_10100284
1140 Ga0207650_10026570
1141 Ga0207650_10296260
1142 Ga0207659_10002134
1143 Ga0207659_10004521
1144 Ga0207659_10129366
1145 Ga0207659_10528065
1146 Ga0207659_10866942
1147 Ga0207687_10072299
1148 Ga0207700_10061383
1149 Ga0207700_10378033
1150 Ga0207664_10664085
1151 Ga0207644_10029919
1152 Ga0207644_10039776
1153 Ga0207644_10148476
1154 Ga0207644_10163009
1155 Ga0207644_10193770
1156 Ga0207644_10475377
1157 Ga0207644_10646268
1158 Ga0207706_10002682
1159 Ga0207706_10013334
1160 Ga0207706_10088201
1161 Ga0207706_10157209
1162 Ga0207706_10370901
1163 Ga0207706_10373729
1164 Ga0207670_10016080
1165 Ga0207670_10073532
1166 Ga0207670_10200987
1167 Ga0207670_10211064
1168 Ga0207670_10264435
1169 Ga0207669_10097612
1170 Ga0207669_10277895
1171 Ga0207669_10440057
1172 Ga0207704_10240780
1173 Ga0207665_10035635
1174 Ga0207665_10067610
1175 Ga0207665_10299867
1176 Ga0207691_10001501
1177 Ga0207691_10020552
1178 Ga0207691_10127110
1179 Ga0207691_10325759
1180 Ga0207711_10485521
1181 Ga0207689_10348577
1182 Ga0207661_10007139
1183 Ga0207661_10011869
1184 Ga0207661_10495205
1185 Ga0207661_10669337
1186 Ga0207679_10302526
1187 Ga0207679_10390455
1188 Ga0207679_10440580
1189 Ga0207667_10714287
1190 Ga0207667_10922045
1191 Ga0207651_10002173
1192 Ga0207651_10569904
1193 Ga0207651_10714799
1194 Ga0207712_10003754
1195 Ga0207712_10045682
1196 Ga0207668_10002290
1197 Ga0207668_10151188
1198 Ga0207668_10179205
1199 Ga0207668_10286948
1200 Ga0207640_10260657
1201 Ga0207658_10052352
1202 Ga0207658_10096246
1203 Ga0207677_10131863
1204 Ga0207677_10184954
1205 Ga0207677_10309001
1206 Ga0207703_10225527
1207 Ga0207703_11496881
1208 Ga0207678_10909441
1209 Ga0207708_10008180
1210 Ga0207708_10908121
1211 Ga0207708_11230671
1212 Ga0207702_10020253
1213 Ga0207641_10082361
1214 Ga0207641_10730925
1215 Ga0207648_10142916
1216 Ga0207648_10253233
1217 Ga0207676_10871582
1218 Ga0207674_10390733
1219 Ga0207675_100059613
1220 Ga0207683_10014745
1221 Ga0207683_10066068
1222 Ga0207683_10105673
1223 Ga0207683_10125058
1224 Ga0207683_10381036
1225 Ga0207683_10447935
1226 Ga0207698_10881173
1227 Ga0209971_1047710
1228 Ga0209974_10054499
1229 Ga0268266_10034617
1230 Ga0268266_10047937
1231 Ga0268266_10212868
1232 Ga0268266_10441937
1233 Ga0268266_10734990
1234 Ga0268265_10116740
1235 Ga0268264_10010837
1236 Ga0268264_10087326
1237 Ga0268264_10115576
1238 Ga0268264_10413896
1239 Ga0268264_10958689
1240 Ga0265337_1006564
1241 Ga0265337_1027552
1242 Ga0265326_10017412
1243 Ga0265319_1002659
1244 Ga0265319_1003274
1245 Ga0265319_1004357
1246 Ga0265319_1029232
1247 Ga0265334_10009405
1248 Ga0265334_10203145
1249 Ga0265318_10000372
1250 Ga0265318_10005196
1251 Ga0265318_10018337
1252 Ga0265336_10009769
1253 Ga0265336_10016109
1254 Ga0265338_10003029
1255 Ga0265338_10006524
1256 Ga0265338_10080152
1257 Ga0265324_10032484
1258 Ga0265324_10034631
1259 Ga0265320_10005869
1260 Ga0265320_10007103
1261 Ga0265320_10010800
1262 Ga0265320_10032987
1263 Ga0265320_10047071
1264 Ga0265320_10061077
1265 Ga0265320_10167297
1266 Ga0265325_10007901
1267 Ga0265325_10071570
1268 Ga0265325_10084544
1269 Ga0265331_10014316
1270 Ga0265327_10005729
1271 Ga0265327_10012167
1272 Ga0265316_10019883
1273 Ga0265316_10119460
1274 Ga0265313_10003683
1275 Ga0265313_10013278
1276 Ga0265313_10037934
1277 Ga0265314_10000435
1278 Ga0265314_10063999
1279 Ga0265314_10127512
1280 Ga0265314_10143083
1281 Ga0265342_10124186
1282 Ga0307412_10044794
1283 Ga0307411_10063095
1284 Ga0373926_0211479
1285 Ga0373944_0011018
1286 Ga0373952_0017693
1287 Ga0373932_0213347
1288 Ga0373956_0080455
1289 Ga0373956_0094367
1290 Ga0373957_0034611
1291 Ga0373943_0032945
1292 Ga0373946_0003668
1293 Ga0373955_0317626
1294 Ga0373942_0182248
1295 Ga0373931_0124642
1296 Ga0373935_0021051
1297 Ga0373935_0052552
1298 Ga0373935_0082485
1299 Ga0373935_0088968
1300 Ga0373927_0036679
1301 Ga0373927_0476796
1302 Ga0373933_0189444
1303 Ga0373947_0074647
1304 Ga0373947_0154884
1305 Ga0373937_0065074
1306 Ga0373937_0105234
1307 Ga0373925_0072961
1308 Ga0373925_0525389
1309 Ga0373925_0576325
1310 Ga0395899_0145056
1311 Ga0395900_0002235
1312 Ga0395900_0360302
1313 Ga0395905_0047606
1314 Ga0395901_0000676
1315 Ga0395901_0220945
1316 Ga0395901_0654947
1317 Ga0395901_1016605
1318 Ga0451847_0038405
1319 Ga0439455_0000789
1320 Ga0439458_0009340
1321 Ga0439460_0027453
1322 Ga0451577_0000087
1323 Ga0451577_0406765
1324 Ga0453683_0003708
1325 Ga0466964_0042904
1326 Ga0453684_0003020
1327 Ga0453684_0048204
1328 Ga0453684_0102330
1329 Ga0451576_0020753
1330 Ga0451576_0059604
1331 Ga0451576_0062062
1332 Ga0451576_0721507
1333 Ga0495592_0012951
1334 Ga0495629_0114584
1335 Ga0495641_0079208
1336 Ga0495651_0188577
1337 Ga0495580_0559843
1338 Ga0495662_0037217
1339 Ga0495664_0354505
1340 Ga0495585_0147681
1341 Ga0495594_0097746
1342 Ga0495608_0162663
1343 Ga0495628_0000626
1344 Ga0495630_0022740
1345 Ga0495630_0060052
1346 Ga0495630_0707374
1347 Ga0495644_0225655
1348 Ga0495642_0447451
1349 Ga0495652_0077717
1350 Ga0495652_0169437
1351 Ga0495640_0171988
1352 Ga0495586_0344210
1353 Ga0495598_0126648
1354 Ga0495645_0007221
1355 Ga0495645_0068409
1356 Ga0495667_0172465
1357 Ga0495659_0056971
1358 Ga0495588_0337261
1359 Ga0495657_0340474
1360 Ga0495599_0009597
1361 Ga0495599_0115422
1362 Ga0495658_0025721
1363 Ga0495669_0005817
1364 Ga0495613_0175651
1365 Ga0495624_0080767
1366 Ga0495581_0402429
1367 Ga0495604_0174393
1368 Ga0495674_0183526
1369 Ga0495675_0041516
1370 Ga0495675_0275353
1371 Ga0495684_0008357
1372 Ga0495602_0128757
1373 Ga0496100_0010261
1374 Ga0496101_0108195
1375 Ga0496101_0151817
1376 Ga0496101_0522690
1377 Ga0496102_0023376
1378 Ga0496102_0132049
1379 Ga0496102_0326088
1380 Ga0496103_0111927
1381 Ga0496103_0217885
1382 Ga0496103_0316123
1383 Ga0496104_0088402
1384 Ga0496104_0111100
1385 Ga0496104_0221168
1386 Ga0496104_0361170
1387 Ga0496104_0595867
1388 Ga0496104_0751845
1389 Ga0496105_0105391
1390 Ga0496105_0124601
1391 Ga0496106_0027190
1392 Ga0496106_0278980
1393 Ga0496107_0002445
1394 Ga0496107_0151987
1395 Ga0496107_0261679
1396 Ga0496108_0086706
1397 Ga0496108_0380975
1398 Ga0496108_0767151
1399 Ga0496109_0383518
1400 Ga0496109_0418012
1401 Ga0496109_0432516
1402 Ga0496110_0014181
1403 Ga0496110_0219027
1404 Ga0496110_0227487
1405 Ga0496110_0260664
1406 Ga0496111_0433817
1407 Ga0496112_0094882
1408 Ga0496112_0166892
1409 Ga0496112_0241768
1410 Ga0496112_0266935
1411 Ga0496112_0294232
1412 Ga0496113_0039009
1413 Ga0496113_0053683
1414 Ga0496113_0206435
1415 Ga0496114_0900249
1416 Ga0496115_0000589
1417 Ga0496115_0006346
1418 Ga0496115_0010025
1419 Ga0501047_0120725
1420 Ga0501035_0026902
1421 nmdc:mga05p37_102706_c1
1422 nmdc:mga05p37_1244057_c1
1423 nmdc:mga05p37_565335_c1
1424 nmdc:mga0n895_1014346_c1
1425 nmdc:mga0n895_188829_c1
1426 nmdc:mga0n895_464040_c1
1427 nmdc:mga08x19_55728_c1
1428 nmdc:mga0a205_566594_c1
1429 Ga0495601_0001289
1430 Ga0495601_0071717

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map