F476979

General Info

Members Datasets Scaffolds Average Seq Length
715 294 1430 252

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10158422|Ga0070681_101584222
Length 271
Sequence VGADGAVDGGRLPYGAVVKVSAVVISHGHAGELEHSLPALAPQVDELVVVANVAGSVPVAMPEGTRVIENGEPLSFAANANLGAARTRHELVLIANPDAIPEPGAVATLRDFVEAHPRAGVAGPRMLYPDGSWQASRRSFPTVGATLVRRTPLRLLFPPLRWQRRHYLLDERPEDPVPAETMLGAFILLRRAMLDEIGGWDAGFRMYGEDIDLNYRAARAGWERWYVPAAVVRHEYAAVIDRRFLTRHTLWHARAMLRFLRKHPERLLALR

Samples

Sample ID Description Type Environment
1 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
104 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
108 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
162 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
163 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
164 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
165 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
166 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
167 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
168 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
169 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
170 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
171 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
172 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
173 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
174 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
175 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
176 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
177 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
178 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
179 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
180 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
181 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
182 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
183 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
184 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
185 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
186 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
187 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
189 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
190 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
191 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
192 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
193 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
194 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
195 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
196 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
197 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
198 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
199 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
200 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
201 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
202 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
203 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
204 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
205 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
206 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
207 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
208 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
209 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
210 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
211 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
212 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
213 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
214 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
215 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
216 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
217 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
218 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
219 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
220 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
221 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
222 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
223 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
224 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
225 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
226 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
227 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
228 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
229 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
230 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
231 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
232 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
233 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
234 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
235 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
236 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
237 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
238 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
239 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
240 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
241 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
242 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
243 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
244 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
245 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
246 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
247 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
248 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
249 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
250 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
251 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
252 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
253 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
254 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
255 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
256 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
267 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
268 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
269 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
270 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
271 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
272 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
273 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
274 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
275 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
276 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
277 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
278 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
279 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
280 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
281 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
282 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
283 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
284 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
285 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
286 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
287 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
288 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
289 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
290 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
291 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
292 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
293 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
294 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.02
Metatranscriptomes 0.98
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.79
Rhizosphere 89.65
Stem 0
Stem Tuber 0
Unclassified 7.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070681_10158422 3300005458 Bacteria 2188
2 Ga0070658_10024401 3300005327 Bacteria 4850
3 Ga0070658_10169222 3300005327 Bacteria 1835
4 Ga0070658_10195214 3300005327 Bacteria 1707
5 Ga0070683_100046221 3300005329 Bacteria 4021
6 Ga0070683_100100413 3300005329 Bacteria 2724
7 Ga0070683_100119565 3300005329 Bacteria 2488
8 Ga0070683_100562464 3300005329 Bacteria 1090
9 Ga0070666_10103430 3300005335 Bacteria 1965
10 Ga0070666_10163702 3300005335 Bacteria 1555
11 Ga0070680_100007374 3300005336 Bacteria 8391
12 Ga0070680_100021896 3300005336 Bacteria 5084
13 Ga0070680_100470137 3300005336 Unclassified 1074
14 Ga0070680_100543880 3300005336 Bacteria 995
15 Ga0070682_100001492 3300005337 Bacteria 13123
16 Ga0070682_100016682 3300005337 Bacteria 4275
17 Ga0070682_100054040 3300005337 Bacteria 2518
18 Ga0070682_100114579 3300005337 Bacteria 1802
19 Ga0070660_100053904 3300005339 Bacteria 3103
20 Ga0070660_100055716 3300005339 Bacteria 3056
21 Ga0070660_100113291 3300005339 Unclassified 2159
22 Ga0070660_100154326 3300005339 Bacteria 1848
23 Ga0070660_100196875 3300005339 Bacteria 1634
24 Ga0070660_100263100 3300005339 Bacteria 1409
25 Ga0070660_100315194 3300005339 Bacteria 1284
26 Ga0070660_100478501 3300005339 Bacteria 1035
27 Ga0070689_100017897 3300005340 Bacteria 5210
28 Ga0070691_10030375 3300005341 Bacteria 2531
29 Ga0070661_100011647 3300005344 Bacteria 6132
30 Ga0070692_10002310 3300005345 Bacteria 7344
31 Ga0070692_10012649 3300005345 Bacteria 3915
32 Ga0070669_100053699 3300005353 Bacteria 2950
33 Ga0070669_100127047 3300005353 Bacteria 1952
34 Ga0070674_100000613 3300005356 Bacteria 17992
35 Ga0070674_100145990 3300005356 Bacteria 1781
36 Ga0070674_100327557 3300005356 Bacteria 1230
37 Ga0070673_100012304 3300005364 Bacteria 5872
38 Ga0070673_100064890 3300005364 Bacteria 2910
39 Ga0070673_100190043 3300005364 Bacteria 1763
40 Ga0070688_100004694 3300005365 Bacteria 7131
41 Ga0070659_100009625 3300005366 Bacteria 7102
42 Ga0070659_100026290 3300005366 Bacteria 4477
43 Ga0070659_100083945 3300005366 Bacteria 2547
44 Ga0070659_100230196 3300005366 Bacteria 1532
45 Ga0070667_100260269 3300005367 Bacteria 1553
46 Ga0070703_10119042 3300005406 Bacteria 956
47 Ga0070709_10216808 3300005434 Bacteria 1363
48 Ga0070709_10237290 3300005434 Bacteria 1308
49 Ga0070709_10256155 3300005434 Bacteria 1262
50 Ga0070714_100021179 3300005435 Bacteria 5316
51 Ga0070714_100022660 3300005435 Bacteria 5150
52 Ga0070714_100177096 3300005435 Unclassified 1938
53 Ga0070714_100223407 3300005435 Unclassified 1732
54 Ga0070714_100367380 3300005435 Bacteria 1354
55 Ga0070714_100388620 3300005435 Bacteria 1317
56 Ga0070713_100068330 3300005436 Bacteria 2994
57 Ga0070701_10099372 3300005438 Bacteria 1609
58 Ga0070711_100003660 3300005439 Bacteria 8987
59 Ga0070711_100106994 3300005439 Bacteria 2046
60 Ga0070705_100003822 3300005440 Bacteria 7366
61 Ga0070705_100008525 3300005440 Bacteria 5078
62 Ga0070705_100070912 3300005440 Bacteria 2106
63 Ga0070700_100002651 3300005441 Bacteria 9154
64 Ga0070700_100234904 3300005441 Bacteria 1307
65 Ga0070700_100271282 3300005441 Bacteria 1226
66 Ga0070694_100002090 3300005444 Bacteria 11835
67 Ga0070694_100261466 3300005444 Bacteria 1313
68 Ga0070694_100338740 3300005444 Bacteria 1162
69 Ga0070663_100002700 3300005455 Bacteria 10041
70 Ga0070663_100080969 3300005455 Bacteria 2386
71 Ga0070678_100001809 3300005456 Bacteria 11528
72 Ga0070678_100005307 3300005456 Bacteria 7431
73 Ga0070662_100392327 3300005457 Bacteria 1144
74 Ga0070681_10027367 3300005458 Bacteria 5732
75 Ga0070681_10068437 3300005458 Bacteria 3517
76 Ga0070681_10092144 3300005458 Bacteria 2980
77 Ga0070681_10371964 3300005458 Bacteria 1340
78 Ga0068867_100005787 3300005459 Bacteria 8769
79 Ga0068867_100077150 3300005459 Bacteria 2503
80 Ga0070685_10003128 3300005466 Bacteria 8417
81 Ga0070707_100070003 3300005468 Unclassified 3379
82 Ga0070707_100287233 3300005468 Bacteria 1598
83 Ga0070698_100010369 3300005471 Bacteria 9950
84 Ga0070698_100035489 3300005471 Bacteria 5156
85 Ga0070698_100165995 3300005471 Bacteria 2151
86 Ga0070698_100172883 3300005471 Bacteria 2100
87 Ga0070698_100319255 3300005471 Bacteria 1484
88 Ga0070699_100006552 3300005518 Bacteria 10135
89 Ga0070699_100151998 3300005518 Bacteria 2048
90 Ga0070699_100304514 3300005518 Unclassified 1430
91 Ga0070699_100494961 3300005518 Bacteria 1110
92 Ga0070679_100017776 3300005530 Bacteria 6885
93 Ga0070679_100037659 3300005530 Bacteria 4806
94 Ga0070679_100123232 3300005530 Bacteria 2575
95 Ga0070679_100128724 3300005530 Bacteria 2513
96 Ga0070679_100361653 3300005530 Bacteria 1398
97 Ga0070684_100032903 3300005535 Bacteria 4423
98 Ga0070684_100059717 3300005535 Bacteria 3334
99 Ga0070684_100082497 3300005535 Bacteria 2846
100 Ga0070684_100122284 3300005535 Bacteria 2342
101 Ga0070684_100324865 3300005535 Bacteria 1413
102 Ga0068853_100005182 3300005539 Bacteria 10196
103 Ga0068853_100224355 3300005539 Bacteria 1717
104 Ga0070672_100021141 3300005543 Unclassified 4757
105 Ga0070686_100004843 3300005544 Bacteria 7430
106 Ga0070686_100044096 3300005544 Bacteria 2801
107 Ga0070696_100011746 3300005546 Bacteria 5868
108 Ga0070696_100219401 3300005546 Bacteria 1426
109 Ga0070665_100060642 3300005548 Bacteria 3792
110 Ga0070704_100006896 3300005549 Bacteria 6728
111 Ga0070704_100533090 3300005549 Unclassified 1024
112 Ga0068855_100008481 3300005563 Bacteria 12423
113 Ga0068855_100076485 3300005563 Bacteria 3885
114 Ga0068855_100158991 3300005563 Bacteria 2566
115 Ga0070664_100050793 3300005564 Bacteria 3510
116 Ga0070664_100186782 3300005564 Bacteria 1845
117 Ga0070664_100560884 3300005564 Bacteria 1057
118 Ga0068857_100033520 3300005577 Bacteria 4542
119 Ga0068854_100622678 3300005578 Bacteria 924
120 Ga0068856_100025287 3300005614 Bacteria 5787
121 Ga0068856_100191932 3300005614 Bacteria 2056
122 Ga0068856_100573663 3300005614 Bacteria 1149
123 Ga0068856_100694059 3300005614 Bacteria 1038
124 Ga0070702_100003382 3300005615 Bacteria 7127
125 Ga0070702_100013748 3300005615 Bacteria 4094
126 Ga0070702_100065992 3300005615 Bacteria 2121
127 Ga0070702_100066150 3300005615 Bacteria 2119
128 Ga0070702_100131483 3300005615 Bacteria 1581
129 Ga0070702_100242909 3300005615 Bacteria 1216
130 Ga0068852_100026860 3300005616 Bacteria 4686
131 Ga0068852_100329208 3300005616 Bacteria 1486
132 Ga0068859_100050410 3300005617 Bacteria 4182
133 Ga0068859_100264832 3300005617 Bacteria 1811
134 Ga0068864_100333303 3300005618 Bacteria 1428
135 Ga0068866_10271438 3300005718 Bacteria 1047
136 Ga0068861_100135398 3300005719 Bacteria 2004
137 Ga0068870_10091199 3300005840 Bacteria 1704
138 Ga0068860_100022210 3300005843 Bacteria 6142
139 Ga0068862_100070069 3300005844 Bacteria 3027
140 Ga0081455_10006746 3300005937 Bacteria 12254
141 Ga0081455_10015733 3300005937 Bacteria 7330
142 Ga0081455_10048697 3300005937 Bacteria 3659
143 Ga0081539_10000620 3300005985 Bacteria 71882
144 Ga0070717_10034174 3300006028 Bacteria 4108
145 Ga0075432_10034026 3300006058 Bacteria 1768
146 Ga0070715_10017663 3300006163 Bacteria 2704
147 Ga0070716_100023862 3300006173 Bacteria 3250
148 Ga0070716_100101857 3300006173 Unclassified 1762
149 Ga0070712_100011334 3300006175 Bacteria 5649
150 Ga0097621_100037636 3300006237 Bacteria 3879
151 Ga0068871_100011192 3300006358 Bacteria 6575
152 Ga0075428_100379998 3300006844 Bacteria 1514
153 Ga0075431_100028016 3300006847 Bacteria 5783
154 Ga0075431_100408976 3300006847 Bacteria 1357
155 Ga0075433_10033657 3300006852 Bacteria 4396
156 Ga0075433_10106185 3300006852 Bacteria 2489
157 Ga0075433_10168891 3300006852 Bacteria 1947
158 Ga0075433_10197449 3300006852 Bacteria 1789
159 Ga0075434_100001314 3300006871 Bacteria 20738
160 Ga0075434_100058331 3300006871 Bacteria 3837
161 Ga0075434_100080756 3300006871 Bacteria 3249
162 Ga0075434_100152389 3300006871 Bacteria 2332
163 Ga0075434_100221182 3300006871 Bacteria 1913
164 Ga0075429_100163485 3300006880 Bacteria 1949
165 Ga0068865_100027342 3300006881 Bacteria 3767
166 Ga0068865_100065581 3300006881 Bacteria 2559
167 Ga0075436_100006837 3300006914 Bacteria 7802
168 Ga0075436_100022398 3300006914 Bacteria 4340
169 Ga0075436_100082332 3300006914 Bacteria 2233
170 Ga0075436_100217502 3300006914 Bacteria 1355
171 Ga0075436_100251726 3300006914 Bacteria 1258
172 Ga0075436_100467535 3300006914 Bacteria 920
173 Ga0097620_100050411 3300006931 Bacteria 4182
174 Ga0097620_100264830 3300006931 Bacteria 1811
175 Ga0075435_100163551 3300007076 Bacteria 1876
176 Ga0075435_100290669 3300007076 Bacteria 1396
177 Ga0105240_10098533 3300009093 Bacteria 3559
178 Ga0111539_10172849 3300009094 Bacteria 2524
179 Ga0111539_10361140 3300009094 Bacteria 1690
180 Ga0105245_10000687 3300009098 Bacteria 30520
181 Ga0105245_10004149 3300009098 Bacteria 12870
182 Ga0105245_10027600 3300009098 Bacteria 5002
183 Ga0105245_10422237 3300009098 Unclassified 1337
184 Ga0105247_10006420 3300009101 Bacteria 7282
185 Ga0105247_10017577 3300009101 Bacteria 4290
186 Ga0114129_10003985 3300009147 Bacteria 20857
187 Ga0114129_10052285 3300009147 Bacteria 5733
188 Ga0114129_10104316 3300009147 Bacteria 3918
189 Ga0114129_10445186 3300009147 Unclassified 1700
190 Ga0114129_10452787 3300009147 Bacteria 1683
191 Ga0114129_10611595 3300009147 Bacteria 1411
192 Ga0105243_10003637 3300009148 Bacteria 12407
193 Ga0105243_10004777 3300009148 Bacteria 10650
194 Ga0105243_10024670 3300009148 Bacteria 4588
195 Ga0105243_10027097 3300009148 Bacteria 4389
196 Ga0105243_10180726 3300009148 Bacteria 1834
197 Ga0105241_10018926 3300009174 Bacteria 5075
198 Ga0105241_10022461 3300009174 Bacteria 4673
199 Ga0105242_10004795 3300009176 Bacteria 10465
200 Ga0105242_10009237 3300009176 Bacteria 7565
201 Ga0105242_10082602 3300009176 Bacteria 2689
202 Ga0105242_10313929 3300009176 Bacteria 1435
203 Ga0105248_10013939 3300009177 Bacteria 8845
204 Ga0105248_10026267 3300009177 Bacteria 6479
205 Ga0105248_10231039 3300009177 Unclassified 2082
206 Ga0105248_10844083 3300009177 Unclassified 1034
207 Ga0105237_10181586 3300009545 Bacteria 2104
208 Ga0105237_10220104 3300009545 Bacteria 1899
209 Ga0105238_10141407 3300009551 Bacteria 2383
210 Ga0105238_10685168 3300009551 Unclassified 1037
211 Ga0105238_10890947 3300009551 Unclassified 908
212 Ga0105249_10000455 3300009553 Bacteria 38320
213 Ga0105249_10673680 3300009553 Bacteria 1093
214 Ga0099796_10186083 3300010159 Bacteria 836
215 Ga0105239_10011699 3300010375 Bacteria 9793
216 Ga0105239_10017542 3300010375 Bacteria 7918
217 Ga0105239_10056504 3300010375 Bacteria 4305
218 Ga0157373_10094935 3300013100 Bacteria 2099
219 Ga0157371_10123855 3300013102 Bacteria 1838
220 Ga0157370_10039960 3300013104 Bacteria 4532
221 Ga0157370_10076569 3300013104 Bacteria 3151
222 Ga0157369_10021388 3300013105 Bacteria 7236
223 Ga0157369_10065023 3300013105 Bacteria 3927
224 Ga0157369_10243115 3300013105 Bacteria 1880
225 Ga0157369_10343116 3300013105 Bacteria 1551
226 Ga0157374_10003618 3300013296 Bacteria 13010
227 Ga0157374_10075864 3300013296 Bacteria 3177
228 Ga0157374_10554569 3300013296 Bacteria 1157
229 Ga0157378_10006989 3300013297 Bacteria 9848
230 Ga0157378_10017994 3300013297 Bacteria 6203
231 Ga0163162_10004697 3300013306 Bacteria 13174
232 Ga0163162_10180683 3300013306 Bacteria 2236
233 Ga0157372_10031569 3300013307 Bacteria 5800
234 Ga0157372_10061363 3300013307 Bacteria 4209
235 Ga0157372_10061732 3300013307 Bacteria 4198
236 Ga0157372_10179530 3300013307 Bacteria 2450
237 Ga0157372_10667174 3300013307 Bacteria 1211
238 Ga0157375_10011201 3300013308 Bacteria 7912
239 Ga0157375_10157866 3300013308 Bacteria 2408
240 Ga0157375_10344966 3300013308 Bacteria 1655
241 Ga0157375_10446656 3300013308 Bacteria 1459
242 Ga0163163_10527600 3300014325 Bacteria 1243
243 Ga0163163_11130214 3300014325 Bacteria 846
244 Ga0157380_10015179 3300014326 Bacteria 5655
245 Ga0157380_10201491 3300014326 Bacteria 1766
246 Ga0157377_10005684 3300014745 Bacteria 5878
247 Ga0157377_10243178 3300014745 Bacteria 1163
248 Ga0157379_10001254 3300014968 Bacteria 20593
249 Ga0157379_10102730 3300014968 Bacteria 2565
250 Ga0157379_10154370 3300014968 Bacteria 2071
251 Ga0157376_10005765 3300014969 Bacteria 8676
252 Ga0157376_10009734 3300014969 Bacteria 6998
253 Ga0157376_10042373 3300014969 Bacteria 3731
254 Ga0182007_10016483 3300015262 Bacteria 2725
255 Ga0206356_10502707 3300020070 Bacteria 1763
256 Ga0206354_10028334 3300020081 Bacteria 1856
257 Ga0206354_10991001 3300020081 Bacteria 5191
258 Ga0206353_11096121 3300020082 Bacteria 3152
259 Ga0206353_11631260 3300020082 Bacteria 3814
260 Ga0206353_11798865 3300020082 Bacteria 1659
261 Ga0206353_11864970 3300020082 Bacteria 1310
262 Ga0213871_10013538 3300021441 Bacteria 1919
263 Ga0207653_10093445 3300025885 Bacteria 1056
264 Ga0207642_10000965 3300025899 Bacteria 8993
265 Ga0207642_10087816 3300025899 Bacteria 1528
266 Ga0207688_10014530 3300025901 Bacteria 4278
267 Ga0207688_10349608 3300025901 Bacteria 911
268 Ga0207680_10031456 3300025903 Bacteria 3006
269 Ga0207680_10101613 3300025903 Bacteria 1849
270 Ga0207685_10002776 3300025905 Bacteria 4096
271 Ga0207699_10190109 3300025906 Unclassified 1385
272 Ga0207699_10308895 3300025906 Unclassified 1106
273 Ga0207645_10178525 3300025907 Bacteria 1393
274 Ga0207643_10177029 3300025908 Bacteria 1289
275 Ga0207705_10118216 3300025909 Bacteria 1964
276 Ga0207705_10136568 3300025909 Bacteria 1829
277 Ga0207705_10150748 3300025909 Bacteria 1742
278 Ga0207705_10187374 3300025909 Bacteria 1563
279 Ga0207684_10375233 3300025910 Bacteria 1223
280 Ga0207684_10486172 3300025910 Bacteria 1059
281 Ga0207654_10015344 3300025911 Bacteria 3973
282 Ga0207654_10174964 3300025911 Bacteria 1396
283 Ga0207707_10006584 3300025912 Bacteria 10133
284 Ga0207707_10012203 3300025912 Bacteria 7470
285 Ga0207707_10021614 3300025912 Bacteria 5623
286 Ga0207707_10468950 3300025912 Unclassified 1076
287 Ga0207707_10633297 3300025912 Bacteria 903
288 Ga0207695_10110295 3300025913 Bacteria 2732
289 Ga0207693_10001503 3300025915 Bacteria 20580
290 Ga0207693_10002912 3300025915 Bacteria 14807
291 Ga0207663_10040355 3300025916 Unclassified 2836
292 Ga0207663_10132870 3300025916 Unclassified 1722
293 Ga0207660_10023903 3300025917 Bacteria 4132
294 Ga0207660_10146386 3300025917 Bacteria 1811
295 Ga0207660_10628356 3300025917 Bacteria 875
296 Ga0207657_10000325 3300025919 Bacteria 50816
297 Ga0207657_10007017 3300025919 Bacteria 11587
298 Ga0207657_10008773 3300025919 Bacteria 10235
299 Ga0207657_10046659 3300025919 Bacteria 3794
300 Ga0207657_10076499 3300025919 Bacteria 2823
301 Ga0207657_10511706 3300025919 Bacteria 940
302 Ga0207649_10164548 3300025920 Bacteria 1540
303 Ga0207649_10261080 3300025920 Bacteria 1251
304 Ga0207652_10072866 3300025921 Bacteria 2987
305 Ga0207652_10075370 3300025921 Bacteria 2940
306 Ga0207652_10076945 3300025921 Archaea 2911
307 Ga0207652_10080256 3300025921 Bacteria 2852
308 Ga0207652_10133383 3300025921 Bacteria 2216
309 Ga0207646_10571527 3300025922 Bacteria 1016
310 Ga0207646_10667267 3300025922 Unclassified 931
311 Ga0207687_10028918 3300025927 Bacteria 3725
312 Ga0207687_10054315 3300025927 Bacteria 2802
313 Ga0207700_10000001 3300025928 Bacteria 1122509
314 Ga0207700_10075718 3300025928 Bacteria 2609
315 Ga0207700_10131863 3300025928 Bacteria 2041
316 Ga0207700_10132188 3300025928 Unclassified 2039
317 Ga0207664_10014659 3300025929 Bacteria 5668
318 Ga0207664_10043162 3300025929 Bacteria 3525
319 Ga0207664_10076287 3300025929 Bacteria 2713
320 Ga0207664_10181034 3300025929 Bacteria 1809
321 Ga0207664_10214417 3300025929 Bacteria 1667
322 Ga0207664_10257008 3300025929 Unclassified 1526
323 Ga0207690_10124531 3300025932 Bacteria 1877
324 Ga0207690_10233252 3300025932 Bacteria 1414
325 Ga0207706_10030821 3300025933 Bacteria 4783
326 Ga0207686_10225271 3300025934 Bacteria 1356
327 Ga0207709_10004216 3300025935 Bacteria 8340
328 Ga0207670_10072232 3300025936 Bacteria 2388
329 Ga0207669_10001484 3300025937 Bacteria 10013
330 Ga0207669_10699781 3300025937 Bacteria 833
331 Ga0207704_10002819 3300025938 Bacteria 7842
332 Ga0207704_10050329 3300025938 Bacteria 2512
333 Ga0207704_10156587 3300025938 Bacteria 1615
334 Ga0207665_10104647 3300025939 Unclassified 1981
335 Ga0207665_10106224 3300025939 Bacteria 1967
336 Ga0207665_10128146 3300025939 Unclassified 1799
337 Ga0207691_10037344 3300025940 Bacteria 4498
338 Ga0207691_10056802 3300025940 Bacteria 3565
339 Ga0207711_10015355 3300025941 Bacteria 6355
340 Ga0207661_10002356 3300025944 Bacteria 13011
341 Ga0207661_10101654 3300025944 Bacteria 2415
342 Ga0207661_10188279 3300025944 Bacteria 1808
343 Ga0207679_10094574 3300025945 Bacteria 2321
344 Ga0207679_10674992 3300025945 Bacteria 936
345 Ga0207667_10346621 3300025949 Unclassified 1515
346 Ga0207651_10471720 3300025960 Bacteria 1080
347 Ga0207651_10478438 3300025960 Unclassified 1073
348 Ga0207712_10246184 3300025961 Bacteria 1443
349 Ga0207668_10120746 3300025972 Bacteria 1984
350 Ga0207640_10309857 3300025981 Bacteria 1253
351 Ga0207658_10003635 3300025986 Bacteria 10894
352 Ga0207658_10174902 3300025986 Bacteria 1772
353 Ga0207703_10014182 3300026035 Bacteria 6215
354 Ga0207639_10016336 3300026041 Bacteria 5250
355 Ga0207639_10159676 3300026041 Bacteria 1898
356 Ga0207639_10195108 3300026041 Bacteria 1732
357 Ga0207639_10386923 3300026041 Bacteria 1257
358 Ga0207639_10511410 3300026041 Bacteria 1099
359 Ga0207678_10006892 3300026067 Bacteria 10082
360 Ga0207678_10117741 3300026067 Bacteria 2267
361 Ga0207708_10000220 3300026075 Bacteria 45476
362 Ga0207708_10098099 3300026075 Bacteria 2265
363 Ga0207708_10147105 3300026075 Bacteria 1852
364 Ga0207708_10286163 3300026075 Bacteria 1337
365 Ga0207648_10000545 3300026089 Bacteria 42051
366 Ga0207648_10109073 3300026089 Bacteria 2430
367 Ga0207648_10114200 3300026089 Bacteria 2372
368 Ga0207674_10014585 3300026116 Bacteria 8673
369 Ga0207674_10053608 3300026116 Bacteria 4110
370 Ga0207674_10153938 3300026116 Bacteria 2255
371 Ga0207675_100086011 3300026118 Bacteria 2952
372 Ga0207683_10000840 3300026121 Bacteria 28142
373 Ga0207683_10001410 3300026121 Bacteria 21710
374 Ga0207683_10023709 3300026121 Bacteria 5279
375 Ga0207698_10116081 3300026142 Unclassified 2255
376 Ga0207698_10292498 3300026142 Bacteria 1512
377 Ga0207698_10302851 3300026142 Bacteria 1489
378 Ga0207428_10000389 3300027907 Bacteria 54953
379 Ga0207428_10000869 3300027907 Bacteria 33966
380 Ga0268266_10039983 3300028379 Bacteria 3996
381 Ga0268264_10018756 3300028381 Bacteria 5656
382 Ga0265337_1054746 3300028556 Unclassified 1116
383 Ga0265319_1006742 3300028563 Bacteria 5270
384 Ga0265319_1007059 3300028563 Bacteria 5105
385 Ga0265319_1032629 3300028563 Bacteria 1803
386 Ga0265334_10005577 3300028573 Bacteria 5498
387 Ga0265318_10005560 3300028577 Bacteria 5910
388 Ga0265318_10046287 3300028577 Bacteria 1642
389 Ga0265322_10013027 3300028654 Bacteria 2407
390 Ga0265322_10038086 3300028654 Bacteria 1369
391 Ga0265336_10092688 3300028666 Bacteria 900
392 Ga0265338_10004708 3300028800 Bacteria 18272
393 Ga0265338_10005706 3300028800 Bacteria 16098
394 Ga0265338_10007095 3300028800 Bacteria 14038
395 Ga0265338_10012426 3300028800 Bacteria 9706
396 Ga0265338_10019091 3300028800 Bacteria 7297
397 Ga0265324_10023385 3300029957 Bacteria 2201
398 Ga0265332_10018694 3300031238 Bacteria 3058
399 Ga0265328_10003143 3300031239 Bacteria 7354
400 Ga0265320_10105611 3300031240 Bacteria 1294
401 Ga0265325_10005368 3300031241 Bacteria 7928
402 Ga0265325_10095314 3300031241 Bacteria 1463
403 Ga0265329_10012037 3300031242 Bacteria 3124
404 Ga0265329_10077477 3300031242 Bacteria 1052
405 Ga0265340_10033010 3300031247 Bacteria 2579
406 Ga0265339_10020775 3300031249 Bacteria 3829
407 Ga0265339_10101276 3300031249 Bacteria 1498
408 Ga0265331_10014023 3300031250 Bacteria 4283
409 Ga0265331_10197820 3300031250 Bacteria 906
410 Ga0265327_10005353 3300031251 Bacteria 10743
411 Ga0265327_10016262 3300031251 Bacteria 4737
412 Ga0265327_10056792 3300031251 Bacteria 2015
413 Ga0265327_10127777 3300031251 Bacteria 1198
414 Ga0265316_10025048 3300031344 Bacteria 4984
415 Ga0265316_10028857 3300031344 Bacteria 4571
416 Ga0265316_10185059 3300031344 Bacteria 1549
417 Ga0265316_10321316 3300031344 Unclassified 1124
418 Ga0265314_10015131 3300031711 Bacteria 6135
419 Ga0265314_10188745 3300031711 Bacteria 1228
420 Ga0265342_10237326 3300031712 Bacteria 977
421 Ga0307416_100034341 3300032002 Bacteria 3859
422 Ga0307415_100196510 3300032126 Bacteria 1596
423 Ga0316583_10046500 3300032133 Bacteria 1532
424 Ga0373924_0287297 3300035410 Bacteria 730
425 Ga0373931_0120836 3300035691 Bacteria 1497
426 Ga0373933_0174994 3300035724 Bacteria 1367
427 Ga0373937_0033442 3300036401 Bacteria 4670
428 Ga0395899_0003605 3300037312 Bacteria 12244
429 Ga0395899_0014553 3300037312 Bacteria 6007
430 Ga0395899_0021159 3300037312 Bacteria 4933
431 Ga0395899_0036875 3300037312 Bacteria 3666
432 Ga0395899_0090747 3300037312 Bacteria 2215
433 Ga0395899_0122963 3300037312 Bacteria 1857
434 Ga0395900_0004994 3300037418 Bacteria 13941
435 Ga0395900_0007477 3300037418 Bacteria 11294
436 Ga0395900_0020824 3300037418 Bacteria 6701
437 Ga0395900_0033561 3300037418 Bacteria 5281
438 Ga0395900_0128828 3300037418 Bacteria 2594
439 Ga0395900_0151262 3300037418 Bacteria 2371
440 Ga0395900_0240834 3300037418 Bacteria 1815
441 Ga0395900_0280059 3300037418 Bacteria 1660
442 Ga0395900_0677928 3300037418 Bacteria 966
443 Ga0395898_0012113 3300037466 Bacteria 8927
444 Ga0395898_0012588 3300037466 Bacteria 8747
445 Ga0395898_0017867 3300037466 Bacteria 7234
446 Ga0395898_0044624 3300037466 Bacteria 4361
447 Ga0395898_0066146 3300037466 Bacteria 3503
448 Ga0395898_0169828 3300037466 Unclassified 2085
449 Ga0395898_0170337 3300037466 Bacteria 2081
450 Ga0395898_0222809 3300037466 Unclassified 1799
451 Ga0395898_0231816 3300037466 Bacteria 1761
452 Ga0395898_0257847 3300037466 Bacteria 1663
453 Ga0395898_0265021 3300037466 Bacteria 1639
454 Ga0395898_0278918 3300037466 Bacteria 1594
455 Ga0395898_0387782 3300037466 Bacteria 1332
456 Ga0395898_0425897 3300037466 Bacteria 1265
457 Ga0395898_0701062 3300037466 Unclassified 954
458 Ga0395905_0004428 3300037471 Bacteria 14594
459 Ga0395905_0009090 3300037471 Bacteria 9741
460 Ga0395905_0030073 3300037471 Bacteria 5119
461 Ga0395905_0051458 3300037471 Bacteria 3858
462 Ga0395905_0076690 3300037471 Bacteria 3132
463 Ga0395905_0165647 3300037471 Bacteria 2077
464 Ga0395905_0797595 3300037471 Unclassified 847
465 Ga0395901_0002959 3300038443 Bacteria 17130
466 Ga0395901_0027606 3300038443 Bacteria 5833
467 Ga0395901_0030391 3300038443 Bacteria 5565
468 Ga0395901_0034974 3300038443 Bacteria 5190
469 Ga0395901_0042844 3300038443 Bacteria 4694
470 Ga0395901_0060070 3300038443 Bacteria 3955
471 Ga0395901_0064910 3300038443 Bacteria 3800
472 Ga0395901_0133429 3300038443 Bacteria 2609
473 Ga0395901_0167134 3300038443 Bacteria 2309
474 Ga0395901_0370728 3300038443 Bacteria 1475
475 Ga0395901_0508037 3300038443 Bacteria 1226
476 Ga0436360_0677367 3300039438 Bacteria 1505
477 Ga0451835_0855988 3300041492 Bacteria 1454
478 Ga0451853_1942658 3300041512 Bacteria 2127
479 Ga0451853_2274240 3300041512 Bacteria 1803
480 Ga0439448_0037135 3300042005 Bacteria 1564
481 Ga0439451_020131 3300042009 Bacteria 1345
482 Ga0466963_0006625 3300044694 Bacteria 6872
483 Ga0466963_0010772 3300044694 Bacteria 5550
484 Ga0466963_0291876 3300044694 Bacteria 1146
485 Ga0466964_0034353 3300044706 Bacteria 2024
486 Ga0466964_0075465 3300044706 Bacteria 1435
487 Ga0466968_0028600 3300044735 Bacteria 2299
488 Ga0466957_0160160 3300044842 Bacteria 1461
489 Ga0466957_0179028 3300044842 Bacteria 1384
490 Ga0466960_0003524 3300044901 Bacteria 6026
491 Ga0466959_0021160 3300045049 Bacteria 4795
492 Ga0466959_0275514 3300045049 Bacteria 1156
493 Ga0466959_0303692 3300045049 Bacteria 1093
494 Ga0466958_0014419 3300045836 Bacteria 4513
495 Ga0466958_0087771 3300045836 Bacteria 1921
496 Ga0466958_0094621 3300045836 Bacteria 1851
497 Ga0466958_0267194 3300045836 Unclassified 1095
498 Ga0466967_0014550 3300045976 Bacteria 6134
499 Ga0466967_0030086 3300045976 Bacteria 4553
500 Ga0466967_0185073 3300045976 Bacteria 1966
501 Ga0466967_0223109 3300045976 Bacteria 1792
502 Ga0466967_0319645 3300045976 Bacteria 1496
503 Ga0466967_0503583 3300045976 Bacteria 1189
504 Ga0495603_0003937 3300046455 Bacteria 8847
505 Ga0495603_0145115 3300046455 Unclassified 1380
506 Ga0495629_0052525 3300046459 Bacteria 2852
507 Ga0495629_0060723 3300046459 Bacteria 2642
508 Ga0495629_0264097 3300046459 Bacteria 1183
509 Ga0495651_0060355 3300046462 Bacteria 2905
510 Ga0495580_0107174 3300046472 Bacteria 1941
511 Ga0495582_0006329 3300046473 Bacteria 6584
512 Ga0495582_0190259 3300046473 Bacteria 1171
513 Ga0495639_0136160 3300046475 Bacteria 1178
514 Ga0495662_0087923 3300046476 Unclassified 1514
515 Ga0495664_0068484 3300046477 Unclassified 2118
516 Ga0495585_0179909 3300046492 Unclassified 1088
517 Ga0495594_0018945 3300046499 Bacteria 3653
518 Ga0495596_0051189 3300046500 Bacteria 1618
519 Ga0495608_0088801 3300046511 Bacteria 2001
520 Ga0495618_0057819 3300046514 Bacteria 2456
521 Ga0495618_0107472 3300046514 Bacteria 1787
522 Ga0495630_0133758 3300046517 Bacteria 1884
523 Ga0495630_0144932 3300046517 Bacteria 1806
524 Ga0495665_0046615 3300046531 Bacteria 2301
525 Ga0495609_0061973 3300046538 Bacteria 1652
526 Ga0495667_0093254 3300046559 Bacteria 1950
527 Ga0495634_0143114 3300046642 Bacteria 1517
528 Ga0495635_0090928 3300046663 Bacteria 2088
529 Ga0495635_0154361 3300046663 Bacteria 1563
530 Ga0495588_0047517 3300046674 Bacteria 2204
531 Ga0495647_0029992 3300046681 Unclassified 2015
532 Ga0495647_0127153 3300046681 Bacteria 1077
533 Ga0495647_0214313 3300046681 Bacteria 848
534 Ga0495658_0014791 3300046683 Unclassified 3992
535 Ga0495613_0474452 3300046689 Unclassified 845
536 Ga0495624_0144072 3300046690 Bacteria 1459
537 Ga0495624_0239037 3300046690 Bacteria 1099
538 Ga0495670_0166798 3300046691 Bacteria 1159
539 Ga0495589_0209324 3300046794 Unclassified 918
540 Ga0495581_0005331 3300047315 Bacteria 7436
541 Ga0495581_0043992 3300047315 Unclassified 2582
542 Ga0495674_0170443 3300047319 Bacteria 1817
543 Ga0495674_0300318 3300047319 Bacteria 1312
544 Ga0495676_0012502 3300047321 Bacteria 7645
545 Ga0495676_0161680 3300047321 Bacteria 1584
546 Ga0495676_0228494 3300047321 Bacteria 1279
547 Ga0495680_0127256 3300047322 Bacteria 1875
548 Ga0495680_0258770 3300047322 Bacteria 1231
549 Ga0495675_0231856 3300047444 Bacteria 1114
550 Ga0495677_0061966 3300047445 Bacteria 1388
551 Ga0495602_0193350 3300048088 Bacteria 1558
552 Ga0496100_0001717 3300048903 Bacteria 10906
553 Ga0496100_0055841 3300048903 Bacteria 2581
554 Ga0496101_0001965 3300048904 Bacteria 12453
555 Ga0496101_0121371 3300048904 Bacteria 1976
556 Ga0496101_0171121 3300048904 Bacteria 1670
557 Ga0496101_0467968 3300048904 Bacteria 995
558 Ga0496101_0600047 3300048904 Unclassified 870
559 Ga0496101_0622052 3300048904 Bacteria 854
560 Ga0496102_0003182 3300048905 Bacteria 13920
561 Ga0496102_0099716 3300048905 Bacteria 2696
562 Ga0496102_0433569 3300048905 Bacteria 1234
563 Ga0496103_0005157 3300048906 Bacteria 7865
564 Ga0496103_0045616 3300048906 Bacteria 2704
565 Ga0496104_0003657 3300048907 Bacteria 13274
566 Ga0496104_0013686 3300048907 Bacteria 7314
567 Ga0496104_0071738 3300048907 Bacteria 3293
568 Ga0496104_0133384 3300048907 Bacteria 2386
569 Ga0496104_0279499 3300048907 Bacteria 1582
570 Ga0496104_0330330 3300048907 Bacteria 1438
571 Ga0496104_0787093 3300048907 Unclassified 857
572 Ga0496105_0001970 3300048908 Bacteria 14773
573 Ga0496105_0023960 3300048908 Bacteria 4958
574 Ga0496105_0052059 3300048908 Bacteria 3381
575 Ga0496105_0166034 3300048908 Bacteria 1811
576 Ga0496105_0219648 3300048908 Bacteria 1547
577 Ga0496105_0229538 3300048908 Bacteria 1509
578 Ga0496106_0002643 3300048909 Bacteria 13325
579 Ga0496106_0003803 3300048909 Bacteria 11245
580 Ga0496106_0079871 3300048909 Bacteria 2511
581 Ga0496107_0000962 3300048910 Bacteria 17069
582 Ga0496107_0004856 3300048910 Bacteria 9130
583 Ga0496107_0007003 3300048910 Bacteria 7768
584 Ga0496107_0441650 3300048910 Unclassified 967
585 Ga0496108_0013661 3300048911 Bacteria 6629
586 Ga0496108_0082910 3300048911 Bacteria 2719
587 Ga0496108_0163443 3300048911 Bacteria 1925
588 Ga0496109_0005852 3300048912 Bacteria 10308
589 Ga0496109_0029175 3300048912 Bacteria 4940
590 Ga0496109_0075369 3300048912 Bacteria 3102
591 Ga0496109_0312974 3300048912 Bacteria 1481
592 Ga0496109_0363867 3300048912 Bacteria 1366
593 Ga0496110_0006017 3300048913 Bacteria 9555
594 Ga0496110_0009573 3300048913 Bacteria 7840
595 Ga0496110_0012122 3300048913 Bacteria 7083
596 Ga0496110_0120263 3300048913 Bacteria 2366
597 Ga0496110_0191968 3300048913 Bacteria 1855
598 Ga0496110_0248212 3300048913 Bacteria 1620
599 Ga0496111_0012283 3300048914 Bacteria 5795
600 Ga0496111_0019918 3300048914 Bacteria 4666
601 Ga0496111_0033466 3300048914 Bacteria 3666
602 Ga0496112_0005220 3300048915 Bacteria 11181
603 Ga0496112_0008285 3300048915 Bacteria 9302
604 Ga0496112_0012817 3300048915 Bacteria 7716
605 Ga0496112_0018350 3300048915 Bacteria 6587
606 Ga0496112_0036489 3300048915 Bacteria 4796
607 Ga0496112_0037938 3300048915 Bacteria 4705
608 Ga0496112_0046431 3300048915 Bacteria 4260
609 Ga0496112_0109256 3300048915 Bacteria 2736
610 Ga0496112_0277130 3300048915 Bacteria 1625
611 Ga0496112_0700001 3300048915 Bacteria 941
612 Ga0496113_0037843 3300048916 Bacteria 3544
613 Ga0496113_0248828 3300048916 Bacteria 1419
614 Ga0496113_0502461 3300048916 Bacteria 973
615 Ga0496114_0002930 3300048917 Bacteria 13086
616 Ga0496114_0064820 3300048917 Bacteria 3061
617 Ga0496114_0173052 3300048917 Bacteria 1882
618 Ga0496114_0355018 3300048917 Bacteria 1297
619 Ga0496115_0007385 3300048918 Bacteria 8088
620 Ga0496115_0082321 3300048918 Bacteria 2622
621 Ga0496115_0512688 3300048918 Bacteria 962
622 Ga0496126_0092054 3300048929 Bacteria 2665
623 Ga0501031_0055418 3300049568 Bacteria 2583
624 Ga0501032_0138425 3300049569 Bacteria 1604
625 Ga0501034_0186000 3300049571 Bacteria 2041
626 Ga0501036_0139518 3300049572 Bacteria 2046
627 Ga0501036_0150847 3300049572 Bacteria 1960
628 Ga0501038_0554950 3300049574 Bacteria 873
629 Ga0501039_0077197 3300049575 Bacteria 2590
630 Ga0501039_0407839 3300049575 Unclassified 1067
631 Ga0501039_0530496 3300049575 Bacteria 924
632 Ga0501040_0115250 3300049576 Bacteria 1881
633 Ga0501040_0284956 3300049576 Bacteria 1180
634 Ga0501042_0147263 3300049578 Bacteria 1698
635 Ga0501046_0066911 3300049580 Bacteria 2799
636 Ga0501048_0038062 3300049582 Bacteria 3453
637 Ga0501067_0052819 3300049583 Bacteria 2252
638 Ga0501067_0181672 3300049583 Bacteria 1171
639 Ga0501067_0194998 3300049583 Unclassified 1128
640 Ga0501068_0123060 3300049584 Bacteria 1619
641 Ga0501068_0144289 3300049584 Bacteria 1494
642 Ga0501069_0024328 3300049585 Bacteria 3302
643 Ga0501069_0139485 3300049585 Bacteria 1390
644 Ga0501070_0538969 3300049586 Bacteria 935
645 Ga0501071_0012907 3300049587 Bacteria 5684
646 Ga0501072_0003619 3300049588 Bacteria 11628
647 Ga0501072_0010791 3300049588 Bacteria 6962
648 Ga0501072_0094053 3300049588 Bacteria 2381
649 Ga0501074_0033109 3300049590 Bacteria 3745
650 Ga0501074_0068033 3300049590 Bacteria 2560
651 Ga0501074_0093500 3300049590 Bacteria 2153
652 Ga0501074_0111117 3300049590 Bacteria 1961
653 Ga0501075_0004141 3300049591 Bacteria 9786
654 Ga0501075_0203445 3300049591 Bacteria 1510
655 Ga0501076_0004413 3300049592 Bacteria 10002
656 Ga0501076_0036581 3300049592 Bacteria 3847
657 Ga0501076_0080623 3300049592 Bacteria 2613
658 Ga0501077_0007573 3300049593 Bacteria 6699
659 Ga0501079_0002654 3300049741 Bacteria 13009
660 Ga0501079_0128902 3300049741 Bacteria 1968
661 Ga0501080_0001641 3300049742 Bacteria 19043
662 Ga0501080_0009494 3300049742 Bacteria 8876
663 Ga0501081_0002444 3300049743 Bacteria 11723
664 Ga0501081_0118823 3300049743 Bacteria 1881
665 Ga0501081_0260935 3300049743 Unclassified 1266
666 Ga0501083_0003404 3300049744 Bacteria 11128
667 Ga0501083_0091538 3300049744 Bacteria 2008
668 Ga0501083_0287267 3300049744 Bacteria 1070
669 Ga0501045_0005466 3300049824 Bacteria 8796
670 Ga0501045_0048170 3300049824 Bacteria 3106
671 nmdc:mga05p37_120145_c1 3300050507 Bacteria 3228
672 nmdc:mga05p37_167094_c1 3300050507 Bacteria 2684
673 nmdc:mga05p37_584555_c1 3300050507 Bacteria 1264
674 nmdc:mga05p37_703597_c1 3300050507 Bacteria 1122
675 nmdc:mga09592_95211_c1 3300050508 Bacteria 2547
676 nmdc:mga0qj67_436789_c1 3300050509 Bacteria 1055
677 nmdc:mga08y16_804_c1 3300050511 Bacteria 30028
678 nmdc:mga0n895_123221_c1 3300050512 Bacteria 2614
679 nmdc:mga0n895_19490_c1 3300050512 Bacteria 6306
680 nmdc:mga0n895_23666_c1 3300050512 Bacteria 5777
681 nmdc:mga0n895_45455_c1 3300050512 Bacteria 4285
682 nmdc:mga0n895_473102_c1 3300050512 Bacteria 1264
683 nmdc:mga0n895_5486_c1 3300050512 Bacteria 10607
684 nmdc:mga0rr50_120708_c1 3300050513 Bacteria 2086
685 nmdc:mga0rr50_15510_c1 3300050513 Bacteria 5032
686 nmdc:mga0rr50_2009_c1 3300050513 Bacteria 11326
687 nmdc:mga0rr50_39697_c1 3300050513 Bacteria 3416
688 nmdc:mga08x19_18693_c1 3300050514 Bacteria 4247
689 nmdc:mga08x19_235929_c1 3300050514 Bacteria 1260
690 nmdc:mga08x19_236512_c1 3300050514 Bacteria 1258
691 nmdc:mga08x19_45624_c1 3300050514 Bacteria 2800
692 nmdc:mga08x19_73427_c1 3300050514 Bacteria 2233
693 nmdc:mga0a205_17140_c1 3300050515 Bacteria 6784
694 nmdc:mga0a205_231_c1 3300050515 Bacteria 39322
695 nmdc:mga0a205_281883_c1 3300050515 Bacteria 1537
696 nmdc:mga0a205_579_c1 3300050515 Bacteria 28969
697 nmdc:mga0a205_598944_c1 3300050515 Unclassified 955
698 Ga0495595_0089658 3300053084 Bacteria 1474
699 Ga0495595_0123101 3300053084 Bacteria 1264
700 Ga0495619_0006463 3300053085 Bacteria 7422
701 Ga0495619_0036925 3300053085 Bacteria 3183
702 Ga0495619_0163493 3300053085 Bacteria 1538
703 Ga0501084_0071935 3300054114 Bacteria 2896
704 Ga0501084_0149932 3300054114 Bacteria 1965
705 Ga0501084_0150197 3300054114 Bacteria 1963
706 Ga0501082_0009811 3300060353 Bacteria 8249
707 Ga0501082_0264216 3300060353 Bacteria 1497
708 Ga0501082_0302924 3300060353 Bacteria 1392
709 Ga0501082_0375268 3300060353 Bacteria 1241
710 Ga0466962_0031942 3300061719 Bacteria 2521
711 Ga0530510_0012517 3300061734 Bacteria 5960
712 Ga0530510_0057924 3300061734 Bacteria 2800
713 Ga0530510_0180226 3300061734 Bacteria 1566
714 Ga0530510_0379639 3300061734 Unclassified 1064
715 Ga0530510_0436446 3300061734 Bacteria 989
716 Ga0070681_10158422
717 Ga0070658_10024401
718 Ga0070658_10169222
719 Ga0070658_10195214
720 Ga0070683_100046221
721 Ga0070683_100100413
722 Ga0070683_100119565
723 Ga0070683_100562464
724 Ga0070666_10103430
725 Ga0070666_10163702
726 Ga0070680_100007374
727 Ga0070680_100021896
728 Ga0070680_100470137
729 Ga0070680_100543880
730 Ga0070682_100001492
731 Ga0070682_100016682
732 Ga0070682_100054040
733 Ga0070682_100114579
734 Ga0070660_100053904
735 Ga0070660_100055716
736 Ga0070660_100113291
737 Ga0070660_100154326
738 Ga0070660_100196875
739 Ga0070660_100263100
740 Ga0070660_100315194
741 Ga0070660_100478501
742 Ga0070689_100017897
743 Ga0070691_10030375
744 Ga0070661_100011647
745 Ga0070692_10002310
746 Ga0070692_10012649
747 Ga0070669_100053699
748 Ga0070669_100127047
749 Ga0070674_100000613
750 Ga0070674_100145990
751 Ga0070674_100327557
752 Ga0070673_100012304
753 Ga0070673_100064890
754 Ga0070673_100190043
755 Ga0070688_100004694
756 Ga0070659_100009625
757 Ga0070659_100026290
758 Ga0070659_100083945
759 Ga0070659_100230196
760 Ga0070667_100260269
761 Ga0070703_10119042
762 Ga0070709_10216808
763 Ga0070709_10237290
764 Ga0070709_10256155
765 Ga0070714_100021179
766 Ga0070714_100022660
767 Ga0070714_100177096
768 Ga0070714_100223407
769 Ga0070714_100367380
770 Ga0070714_100388620
771 Ga0070713_100068330
772 Ga0070701_10099372
773 Ga0070711_100003660
774 Ga0070711_100106994
775 Ga0070705_100003822
776 Ga0070705_100008525
777 Ga0070705_100070912
778 Ga0070700_100002651
779 Ga0070700_100234904
780 Ga0070700_100271282
781 Ga0070694_100002090
782 Ga0070694_100261466
783 Ga0070694_100338740
784 Ga0070663_100002700
785 Ga0070663_100080969
786 Ga0070678_100001809
787 Ga0070678_100005307
788 Ga0070662_100392327
789 Ga0070681_10027367
790 Ga0070681_10068437
791 Ga0070681_10092144
792 Ga0070681_10371964
793 Ga0068867_100005787
794 Ga0068867_100077150
795 Ga0070685_10003128
796 Ga0070707_100070003
797 Ga0070707_100287233
798 Ga0070698_100010369
799 Ga0070698_100035489
800 Ga0070698_100165995
801 Ga0070698_100172883
802 Ga0070698_100319255
803 Ga0070699_100006552
804 Ga0070699_100151998
805 Ga0070699_100304514
806 Ga0070699_100494961
807 Ga0070679_100017776
808 Ga0070679_100037659
809 Ga0070679_100123232
810 Ga0070679_100128724
811 Ga0070679_100361653
812 Ga0070684_100032903
813 Ga0070684_100059717
814 Ga0070684_100082497
815 Ga0070684_100122284
816 Ga0070684_100324865
817 Ga0068853_100005182
818 Ga0068853_100224355
819 Ga0070672_100021141
820 Ga0070686_100004843
821 Ga0070686_100044096
822 Ga0070696_100011746
823 Ga0070696_100219401
824 Ga0070665_100060642
825 Ga0070704_100006896
826 Ga0070704_100533090
827 Ga0068855_100008481
828 Ga0068855_100076485
829 Ga0068855_100158991
830 Ga0070664_100050793
831 Ga0070664_100186782
832 Ga0070664_100560884
833 Ga0068857_100033520
834 Ga0068854_100622678
835 Ga0068856_100025287
836 Ga0068856_100191932
837 Ga0068856_100573663
838 Ga0068856_100694059
839 Ga0070702_100003382
840 Ga0070702_100013748
841 Ga0070702_100065992
842 Ga0070702_100066150
843 Ga0070702_100131483
844 Ga0070702_100242909
845 Ga0068852_100026860
846 Ga0068852_100329208
847 Ga0068859_100050410
848 Ga0068859_100264832
849 Ga0068864_100333303
850 Ga0068866_10271438
851 Ga0068861_100135398
852 Ga0068870_10091199
853 Ga0068860_100022210
854 Ga0068862_100070069
855 Ga0081455_10006746
856 Ga0081455_10015733
857 Ga0081455_10048697
858 Ga0081539_10000620
859 Ga0070717_10034174
860 Ga0075432_10034026
861 Ga0070715_10017663
862 Ga0070716_100023862
863 Ga0070716_100101857
864 Ga0070712_100011334
865 Ga0097621_100037636
866 Ga0068871_100011192
867 Ga0075428_100379998
868 Ga0075431_100028016
869 Ga0075431_100408976
870 Ga0075433_10033657
871 Ga0075433_10106185
872 Ga0075433_10168891
873 Ga0075433_10197449
874 Ga0075434_100001314
875 Ga0075434_100058331
876 Ga0075434_100080756
877 Ga0075434_100152389
878 Ga0075434_100221182
879 Ga0075429_100163485
880 Ga0068865_100027342
881 Ga0068865_100065581
882 Ga0075436_100006837
883 Ga0075436_100022398
884 Ga0075436_100082332
885 Ga0075436_100217502
886 Ga0075436_100251726
887 Ga0075436_100467535
888 Ga0097620_100050411
889 Ga0097620_100264830
890 Ga0075435_100163551
891 Ga0075435_100290669
892 Ga0105240_10098533
893 Ga0111539_10172849
894 Ga0111539_10361140
895 Ga0105245_10000687
896 Ga0105245_10004149
897 Ga0105245_10027600
898 Ga0105245_10422237
899 Ga0105247_10006420
900 Ga0105247_10017577
901 Ga0114129_10003985
902 Ga0114129_10052285
903 Ga0114129_10104316
904 Ga0114129_10445186
905 Ga0114129_10452787
906 Ga0114129_10611595
907 Ga0105243_10003637
908 Ga0105243_10004777
909 Ga0105243_10024670
910 Ga0105243_10027097
911 Ga0105243_10180726
912 Ga0105241_10018926
913 Ga0105241_10022461
914 Ga0105242_10004795
915 Ga0105242_10009237
916 Ga0105242_10082602
917 Ga0105242_10313929
918 Ga0105248_10013939
919 Ga0105248_10026267
920 Ga0105248_10231039
921 Ga0105248_10844083
922 Ga0105237_10181586
923 Ga0105237_10220104
924 Ga0105238_10141407
925 Ga0105238_10685168
926 Ga0105238_10890947
927 Ga0105249_10000455
928 Ga0105249_10673680
929 Ga0099796_10186083
930 Ga0105239_10011699
931 Ga0105239_10017542
932 Ga0105239_10056504
933 Ga0157373_10094935
934 Ga0157371_10123855
935 Ga0157370_10039960
936 Ga0157370_10076569
937 Ga0157369_10021388
938 Ga0157369_10065023
939 Ga0157369_10243115
940 Ga0157369_10343116
941 Ga0157374_10003618
942 Ga0157374_10075864
943 Ga0157374_10554569
944 Ga0157378_10006989
945 Ga0157378_10017994
946 Ga0163162_10004697
947 Ga0163162_10180683
948 Ga0157372_10031569
949 Ga0157372_10061363
950 Ga0157372_10061732
951 Ga0157372_10179530
952 Ga0157372_10667174
953 Ga0157375_10011201
954 Ga0157375_10157866
955 Ga0157375_10344966
956 Ga0157375_10446656
957 Ga0163163_10527600
958 Ga0163163_11130214
959 Ga0157380_10015179
960 Ga0157380_10201491
961 Ga0157377_10005684
962 Ga0157377_10243178
963 Ga0157379_10001254
964 Ga0157379_10102730
965 Ga0157379_10154370
966 Ga0157376_10005765
967 Ga0157376_10009734
968 Ga0157376_10042373
969 Ga0182007_10016483
970 Ga0206356_10502707
971 Ga0206354_10028334
972 Ga0206354_10991001
973 Ga0206353_11096121
974 Ga0206353_11631260
975 Ga0206353_11798865
976 Ga0206353_11864970
977 Ga0213871_10013538
978 Ga0207653_10093445
979 Ga0207642_10000965
980 Ga0207642_10087816
981 Ga0207688_10014530
982 Ga0207688_10349608
983 Ga0207680_10031456
984 Ga0207680_10101613
985 Ga0207685_10002776
986 Ga0207699_10190109
987 Ga0207699_10308895
988 Ga0207645_10178525
989 Ga0207643_10177029
990 Ga0207705_10118216
991 Ga0207705_10136568
992 Ga0207705_10150748
993 Ga0207705_10187374
994 Ga0207684_10375233
995 Ga0207684_10486172
996 Ga0207654_10015344
997 Ga0207654_10174964
998 Ga0207707_10006584
999 Ga0207707_10012203
1000 Ga0207707_10021614
1001 Ga0207707_10468950
1002 Ga0207707_10633297
1003 Ga0207695_10110295
1004 Ga0207693_10001503
1005 Ga0207693_10002912
1006 Ga0207663_10040355
1007 Ga0207663_10132870
1008 Ga0207660_10023903
1009 Ga0207660_10146386
1010 Ga0207660_10628356
1011 Ga0207657_10000325
1012 Ga0207657_10007017
1013 Ga0207657_10008773
1014 Ga0207657_10046659
1015 Ga0207657_10076499
1016 Ga0207657_10511706
1017 Ga0207649_10164548
1018 Ga0207649_10261080
1019 Ga0207652_10072866
1020 Ga0207652_10075370
1021 Ga0207652_10076945
1022 Ga0207652_10080256
1023 Ga0207652_10133383
1024 Ga0207646_10571527
1025 Ga0207646_10667267
1026 Ga0207687_10028918
1027 Ga0207687_10054315
1028 Ga0207700_10000001
1029 Ga0207700_10075718
1030 Ga0207700_10131863
1031 Ga0207700_10132188
1032 Ga0207664_10014659
1033 Ga0207664_10043162
1034 Ga0207664_10076287
1035 Ga0207664_10181034
1036 Ga0207664_10214417
1037 Ga0207664_10257008
1038 Ga0207690_10124531
1039 Ga0207690_10233252
1040 Ga0207706_10030821
1041 Ga0207686_10225271
1042 Ga0207709_10004216
1043 Ga0207670_10072232
1044 Ga0207669_10001484
1045 Ga0207669_10699781
1046 Ga0207704_10002819
1047 Ga0207704_10050329
1048 Ga0207704_10156587
1049 Ga0207665_10104647
1050 Ga0207665_10106224
1051 Ga0207665_10128146
1052 Ga0207691_10037344
1053 Ga0207691_10056802
1054 Ga0207711_10015355
1055 Ga0207661_10002356
1056 Ga0207661_10101654
1057 Ga0207661_10188279
1058 Ga0207679_10094574
1059 Ga0207679_10674992
1060 Ga0207667_10346621
1061 Ga0207651_10471720
1062 Ga0207651_10478438
1063 Ga0207712_10246184
1064 Ga0207668_10120746
1065 Ga0207640_10309857
1066 Ga0207658_10003635
1067 Ga0207658_10174902
1068 Ga0207703_10014182
1069 Ga0207639_10016336
1070 Ga0207639_10159676
1071 Ga0207639_10195108
1072 Ga0207639_10386923
1073 Ga0207639_10511410
1074 Ga0207678_10006892
1075 Ga0207678_10117741
1076 Ga0207708_10000220
1077 Ga0207708_10098099
1078 Ga0207708_10147105
1079 Ga0207708_10286163
1080 Ga0207648_10000545
1081 Ga0207648_10109073
1082 Ga0207648_10114200
1083 Ga0207674_10014585
1084 Ga0207674_10053608
1085 Ga0207674_10153938
1086 Ga0207675_100086011
1087 Ga0207683_10000840
1088 Ga0207683_10001410
1089 Ga0207683_10023709
1090 Ga0207698_10116081
1091 Ga0207698_10292498
1092 Ga0207698_10302851
1093 Ga0207428_10000389
1094 Ga0207428_10000869
1095 Ga0268266_10039983
1096 Ga0268264_10018756
1097 Ga0265337_1054746
1098 Ga0265319_1006742
1099 Ga0265319_1007059
1100 Ga0265319_1032629
1101 Ga0265334_10005577
1102 Ga0265318_10005560
1103 Ga0265318_10046287
1104 Ga0265322_10013027
1105 Ga0265322_10038086
1106 Ga0265336_10092688
1107 Ga0265338_10004708
1108 Ga0265338_10005706
1109 Ga0265338_10007095
1110 Ga0265338_10012426
1111 Ga0265338_10019091
1112 Ga0265324_10023385
1113 Ga0265332_10018694
1114 Ga0265328_10003143
1115 Ga0265320_10105611
1116 Ga0265325_10005368
1117 Ga0265325_10095314
1118 Ga0265329_10012037
1119 Ga0265329_10077477
1120 Ga0265340_10033010
1121 Ga0265339_10020775
1122 Ga0265339_10101276
1123 Ga0265331_10014023
1124 Ga0265331_10197820
1125 Ga0265327_10005353
1126 Ga0265327_10016262
1127 Ga0265327_10056792
1128 Ga0265327_10127777
1129 Ga0265316_10025048
1130 Ga0265316_10028857
1131 Ga0265316_10185059
1132 Ga0265316_10321316
1133 Ga0265314_10015131
1134 Ga0265314_10188745
1135 Ga0265342_10237326
1136 Ga0307416_100034341
1137 Ga0307415_100196510
1138 Ga0316583_10046500
1139 Ga0373924_0287297
1140 Ga0373931_0120836
1141 Ga0373933_0174994
1142 Ga0373937_0033442
1143 Ga0395899_0003605
1144 Ga0395899_0014553
1145 Ga0395899_0021159
1146 Ga0395899_0036875
1147 Ga0395899_0090747
1148 Ga0395899_0122963
1149 Ga0395900_0004994
1150 Ga0395900_0007477
1151 Ga0395900_0020824
1152 Ga0395900_0033561
1153 Ga0395900_0128828
1154 Ga0395900_0151262
1155 Ga0395900_0240834
1156 Ga0395900_0280059
1157 Ga0395900_0677928
1158 Ga0395898_0012113
1159 Ga0395898_0012588
1160 Ga0395898_0017867
1161 Ga0395898_0044624
1162 Ga0395898_0066146
1163 Ga0395898_0169828
1164 Ga0395898_0170337
1165 Ga0395898_0222809
1166 Ga0395898_0231816
1167 Ga0395898_0257847
1168 Ga0395898_0265021
1169 Ga0395898_0278918
1170 Ga0395898_0387782
1171 Ga0395898_0425897
1172 Ga0395898_0701062
1173 Ga0395905_0004428
1174 Ga0395905_0009090
1175 Ga0395905_0030073
1176 Ga0395905_0051458
1177 Ga0395905_0076690
1178 Ga0395905_0165647
1179 Ga0395905_0797595
1180 Ga0395901_0002959
1181 Ga0395901_0027606
1182 Ga0395901_0030391
1183 Ga0395901_0034974
1184 Ga0395901_0042844
1185 Ga0395901_0060070
1186 Ga0395901_0064910
1187 Ga0395901_0133429
1188 Ga0395901_0167134
1189 Ga0395901_0370728
1190 Ga0395901_0508037
1191 Ga0436360_0677367
1192 Ga0451835_0855988
1193 Ga0451853_1942658
1194 Ga0451853_2274240
1195 Ga0439448_0037135
1196 Ga0439451_020131
1197 Ga0466963_0006625
1198 Ga0466963_0010772
1199 Ga0466963_0291876
1200 Ga0466964_0034353
1201 Ga0466964_0075465
1202 Ga0466968_0028600
1203 Ga0466957_0160160
1204 Ga0466957_0179028
1205 Ga0466960_0003524
1206 Ga0466959_0021160
1207 Ga0466959_0275514
1208 Ga0466959_0303692
1209 Ga0466958_0014419
1210 Ga0466958_0087771
1211 Ga0466958_0094621
1212 Ga0466958_0267194
1213 Ga0466967_0014550
1214 Ga0466967_0030086
1215 Ga0466967_0185073
1216 Ga0466967_0223109
1217 Ga0466967_0319645
1218 Ga0466967_0503583
1219 Ga0495603_0003937
1220 Ga0495603_0145115
1221 Ga0495629_0052525
1222 Ga0495629_0060723
1223 Ga0495629_0264097
1224 Ga0495651_0060355
1225 Ga0495580_0107174
1226 Ga0495582_0006329
1227 Ga0495582_0190259
1228 Ga0495639_0136160
1229 Ga0495662_0087923
1230 Ga0495664_0068484
1231 Ga0495585_0179909
1232 Ga0495594_0018945
1233 Ga0495596_0051189
1234 Ga0495608_0088801
1235 Ga0495618_0057819
1236 Ga0495618_0107472
1237 Ga0495630_0133758
1238 Ga0495630_0144932
1239 Ga0495665_0046615
1240 Ga0495609_0061973
1241 Ga0495667_0093254
1242 Ga0495634_0143114
1243 Ga0495635_0090928
1244 Ga0495635_0154361
1245 Ga0495588_0047517
1246 Ga0495647_0029992
1247 Ga0495647_0127153
1248 Ga0495647_0214313
1249 Ga0495658_0014791
1250 Ga0495613_0474452
1251 Ga0495624_0144072
1252 Ga0495624_0239037
1253 Ga0495670_0166798
1254 Ga0495589_0209324
1255 Ga0495581_0005331
1256 Ga0495581_0043992
1257 Ga0495674_0170443
1258 Ga0495674_0300318
1259 Ga0495676_0012502
1260 Ga0495676_0161680
1261 Ga0495676_0228494
1262 Ga0495680_0127256
1263 Ga0495680_0258770
1264 Ga0495675_0231856
1265 Ga0495677_0061966
1266 Ga0495602_0193350
1267 Ga0496100_0001717
1268 Ga0496100_0055841
1269 Ga0496101_0001965
1270 Ga0496101_0121371
1271 Ga0496101_0171121
1272 Ga0496101_0467968
1273 Ga0496101_0600047
1274 Ga0496101_0622052
1275 Ga0496102_0003182
1276 Ga0496102_0099716
1277 Ga0496102_0433569
1278 Ga0496103_0005157
1279 Ga0496103_0045616
1280 Ga0496104_0003657
1281 Ga0496104_0013686
1282 Ga0496104_0071738
1283 Ga0496104_0133384
1284 Ga0496104_0279499
1285 Ga0496104_0330330
1286 Ga0496104_0787093
1287 Ga0496105_0001970
1288 Ga0496105_0023960
1289 Ga0496105_0052059
1290 Ga0496105_0166034
1291 Ga0496105_0219648
1292 Ga0496105_0229538
1293 Ga0496106_0002643
1294 Ga0496106_0003803
1295 Ga0496106_0079871
1296 Ga0496107_0000962
1297 Ga0496107_0004856
1298 Ga0496107_0007003
1299 Ga0496107_0441650
1300 Ga0496108_0013661
1301 Ga0496108_0082910
1302 Ga0496108_0163443
1303 Ga0496109_0005852
1304 Ga0496109_0029175
1305 Ga0496109_0075369
1306 Ga0496109_0312974
1307 Ga0496109_0363867
1308 Ga0496110_0006017
1309 Ga0496110_0009573
1310 Ga0496110_0012122
1311 Ga0496110_0120263
1312 Ga0496110_0191968
1313 Ga0496110_0248212
1314 Ga0496111_0012283
1315 Ga0496111_0019918
1316 Ga0496111_0033466
1317 Ga0496112_0005220
1318 Ga0496112_0008285
1319 Ga0496112_0012817
1320 Ga0496112_0018350
1321 Ga0496112_0036489
1322 Ga0496112_0037938
1323 Ga0496112_0046431
1324 Ga0496112_0109256
1325 Ga0496112_0277130
1326 Ga0496112_0700001
1327 Ga0496113_0037843
1328 Ga0496113_0248828
1329 Ga0496113_0502461
1330 Ga0496114_0002930
1331 Ga0496114_0064820
1332 Ga0496114_0173052
1333 Ga0496114_0355018
1334 Ga0496115_0007385
1335 Ga0496115_0082321
1336 Ga0496115_0512688
1337 Ga0496126_0092054
1338 Ga0501031_0055418
1339 Ga0501032_0138425
1340 Ga0501034_0186000
1341 Ga0501036_0139518
1342 Ga0501036_0150847
1343 Ga0501038_0554950
1344 Ga0501039_0077197
1345 Ga0501039_0407839
1346 Ga0501039_0530496
1347 Ga0501040_0115250
1348 Ga0501040_0284956
1349 Ga0501042_0147263
1350 Ga0501046_0066911
1351 Ga0501048_0038062
1352 Ga0501067_0052819
1353 Ga0501067_0181672
1354 Ga0501067_0194998
1355 Ga0501068_0123060
1356 Ga0501068_0144289
1357 Ga0501069_0024328
1358 Ga0501069_0139485
1359 Ga0501070_0538969
1360 Ga0501071_0012907
1361 Ga0501072_0003619
1362 Ga0501072_0010791
1363 Ga0501072_0094053
1364 Ga0501074_0033109
1365 Ga0501074_0068033
1366 Ga0501074_0093500
1367 Ga0501074_0111117
1368 Ga0501075_0004141
1369 Ga0501075_0203445
1370 Ga0501076_0004413
1371 Ga0501076_0036581
1372 Ga0501076_0080623
1373 Ga0501077_0007573
1374 Ga0501079_0002654
1375 Ga0501079_0128902
1376 Ga0501080_0001641
1377 Ga0501080_0009494
1378 Ga0501081_0002444
1379 Ga0501081_0118823
1380 Ga0501081_0260935
1381 Ga0501083_0003404
1382 Ga0501083_0091538
1383 Ga0501083_0287267
1384 Ga0501045_0005466
1385 Ga0501045_0048170
1386 nmdc:mga05p37_120145_c1
1387 nmdc:mga05p37_167094_c1
1388 nmdc:mga05p37_584555_c1
1389 nmdc:mga05p37_703597_c1
1390 nmdc:mga09592_95211_c1
1391 nmdc:mga0qj67_436789_c1
1392 nmdc:mga08y16_804_c1
1393 nmdc:mga0n895_123221_c1
1394 nmdc:mga0n895_19490_c1
1395 nmdc:mga0n895_23666_c1
1396 nmdc:mga0n895_45455_c1
1397 nmdc:mga0n895_473102_c1
1398 nmdc:mga0n895_5486_c1
1399 nmdc:mga0rr50_120708_c1
1400 nmdc:mga0rr50_15510_c1
1401 nmdc:mga0rr50_2009_c1
1402 nmdc:mga0rr50_39697_c1
1403 nmdc:mga08x19_18693_c1
1404 nmdc:mga08x19_235929_c1
1405 nmdc:mga08x19_236512_c1
1406 nmdc:mga08x19_45624_c1
1407 nmdc:mga08x19_73427_c1
1408 nmdc:mga0a205_17140_c1
1409 nmdc:mga0a205_231_c1
1410 nmdc:mga0a205_281883_c1
1411 nmdc:mga0a205_579_c1
1412 nmdc:mga0a205_598944_c1
1413 Ga0495595_0089658
1414 Ga0495595_0123101
1415 Ga0495619_0006463
1416 Ga0495619_0036925
1417 Ga0495619_0163493
1418 Ga0501084_0071935
1419 Ga0501084_0149932
1420 Ga0501084_0150197
1421 Ga0501082_0009811
1422 Ga0501082_0264216
1423 Ga0501082_0302924
1424 Ga0501082_0375268
1425 Ga0466962_0031942
1426 Ga0530510_0012517
1427 Ga0530510_0057924
1428 Ga0530510_0180226
1429 Ga0530510_0379639
1430 Ga0530510_0436446

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13506

Glyco_transf_21

Glycosyl transferase family 21

168

253

0.92

PF00535

Glycos_transf_2

Glycosyl transferase family 2

21

198

0.87

PF13632

Glyco_trans_2_3

Glycosyl transferase family group 2

91

263

0.72

PF13641

Glyco_tranf_2_3

Glycosyltransferase like family 2

41

258

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dzt-assembly1.cif.gz_A structure of mutant tryptophan synthase alpha-subunit (d110a) from a hyperthermophile, pyrococcus furiosus 0.7566 2 37
5nqa-assembly1.cif.gz_A crystal structure of galnac-t4 in complex with the monoglycopeptide 3 0.7536 2 211
6e4r-assembly1.cif.gz_A crystal structure of the drosophila melanogaster polypeptide n-acetylgalactosaminyl transferase pgant9b 0.7519 2 243
6nqt-assembly1.cif.gz_C galnac-t2 soaked with udp-sugar 0.7509 2 215
6nqt-assembly1.cif.gz_A galnac-t2 soaked with udp-sugar 0.7492 2 215
ID Description Score Start End Superfamily
af_P36667_1_231_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8502 3 222 3.90.550.10
af_A0A2R8QCE8_89_340_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8355 2 96 3.90.550.10
af_P9WMY3_4_248_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.823 3 219 3.90.550.10
af_P36667_1_231_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8091 3 222 3.90.550.10
af_P9WMX1_74_289_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7476 3 216 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A7W1N511-F1-model_v4 Glycosyltransferase family 2 protein 0.9823 2 246 GO:0016740
AF-A0A7W1N511-F1-model_v4 Glycosyltransferase family 2 protein 0.9745 2 246 GO:0016740
AF-A0A538JIR2-F1-model_v4 Glycosyltransferase family 2 protein 0.9532 1 246 GO:0016740
AF-A0A538LKB4-F1-model_v4 Glycosyltransferase family 2 protein 0.9496 1 246 GO:0016740
AF-A0A538JIR2-F1-model_v4 Glycosyltransferase family 2 protein 0.9494 1 246 GO:0016740

Map