F476970

General Info

Members Datasets Scaffolds Average Seq Length
715 227 1430 156

Family's Representative Sequence

Representative Sequence 3300002067|JGI24735J21928_10009533|JGI24735J21928_100095333
Length 182
Sequence VRGDATASIGFERKLAEAALAIDSYNRPMTYRITGIDPAPYRHLFGRSDEELAAEGVVRMTVTDPTFPCRVSLTDRAIGETVLLLNHVSHDVANPYRASHAIFVTEAVEEPAEYIDQVPPVFRTRVLSLRGFTADGMMADAILTQPGEADAGIRKLLENPEIAXIHAHNATRGCFAAKIERN

Samples

Sample ID Description Type Environment
1 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
2 3300001432 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
5 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
6 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
10 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
11 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
12 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
13 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
14 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
15 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
165 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
166 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
167 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
168 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
169 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
170 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
171 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
172 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
173 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
174 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
175 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
176 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
177 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
178 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
180 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
181 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
182 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
183 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
184 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
185 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
186 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
187 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
188 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
189 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
190 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
191 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
192 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
193 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
194 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
195 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
196 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
197 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
198 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
199 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
200 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
201 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
202 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
203 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
204 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
205 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
206 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
207 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
208 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
209 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
210 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
211 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
212 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
213 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
214 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
215 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
216 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
217 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
218 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
219 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
220 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
221 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
222 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
223 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
224 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
225 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
226 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
227 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.56
Nodule 0
Rhizoplane 1.4
Rhizosphere 97.48
Stem 0
Stem Tuber 0
Unclassified 6.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10009533 3300002067 Bacteria 3114
2 JGI24034J14986_100862 3300001432 Bacteria 1798
3 JGI24736J21556_1000032 3300001904 Bacteria 24066
4 JGI24736J21556_1005054 3300001904 Bacteria 2234
5 JGI24736J21556_1077882 3300001904 Bacteria 520
6 JGI24741J21665_1007050 3300001915 Bacteria 2207
7 JGI24741J21665_1008425 3300001915 Bacteria 1944
8 JGI24741J21665_1025010 3300001915 Bacteria 914
9 JGI24752J21851_1002487 3300001976 Bacteria 2454
10 JGI24740J21852_10000725 3300001979 Bacteria 14365
11 JGI24740J21852_10010276 3300001979 Bacteria 3615
12 JGI24739J22299_10003316 3300001989 Bacteria 6140
13 JGI24739J22299_10013496 3300001989 Bacteria 2982
14 JGI24737J22298_10000448 3300001990 Bacteria 14160
15 JGI24737J22298_10000878 3300001990 Bacteria 10727
16 JGI24737J22298_10001833 3300001990 Bacteria 7606
17 JGI24737J22298_10001939 3300001990 Bacteria 7401
18 JGI24737J22298_10009454 3300001990 Bacteria 3239
19 JGI24737J22298_10027059 3300001990 Bacteria 1810
20 JGI24735J21928_10004427 3300002067 Bacteria 4724
21 JGI24735J21928_10013281 3300002067 Bacteria 2591
22 JGI24735J21928_10087415 3300002067 Unclassified 893
23 JGI24735J21928_10090197 3300002067 Bacteria 879
24 JGI24750J21931_1000268 3300002070 Bacteria 8908
25 JGI24748J21848_1000036 3300002074 Bacteria 72512
26 JGI24738J21930_10000356 3300002075 Bacteria 12665
27 JGI24738J21930_10009436 3300002075 Bacteria 2195
28 JGI24749J21850_1000281 3300002076 Bacteria 7813
29 JGI24034J26672_10000008 3300002239 Bacteria 200986
30 JGI24034J26672_10000038 3300002239 Bacteria 75372
31 JGI24034J26672_10021420 3300002239 Unclassified 1017
32 JGI24742J22300_10002789 3300002244 Bacteria 2819
33 rootH1_10140429 3300003323 Bacteria 1654
34 Ga0070658_10032671 3300005327 Bacteria 4184
35 Ga0070658_10104996 3300005327 Bacteria 2337
36 Ga0070658_10185130 3300005327 Bacteria 1753
37 Ga0070658_10216582 3300005327 Bacteria 1618
38 Ga0070658_10277385 3300005327 Bacteria 1426
39 Ga0070658_10625297 3300005327 Unclassified 934
40 Ga0070658_10897739 3300005327 Bacteria 770
41 Ga0070658_11134141 3300005327 Bacteria 680
42 Ga0070676_10071055 3300005328 Bacteria 2090
43 Ga0070676_10983272 3300005328 Bacteria 632
44 Ga0070683_100043021 3300005329 Bacteria 4161
45 Ga0070683_100182086 3300005329 Bacteria 1994
46 Ga0070683_101242903 3300005329 Bacteria 716
47 Ga0070690_100000021 3300005330 Bacteria 74350
48 Ga0070690_100134088 3300005330 Unclassified 1675
49 Ga0070670_100026159 3300005331 Bacteria 5022
50 Ga0070670_100127659 3300005331 Bacteria 2195
51 Ga0070670_100203575 3300005331 Bacteria 1720
52 Ga0070670_100214157 3300005331 Unclassified 1675
53 Ga0070670_100227049 3300005331 Bacteria 1625
54 Ga0070670_100621881 3300005331 Bacteria 967
55 Ga0070670_101220412 3300005331 Bacteria 687
56 Ga0070677_10113251 3300005333 Bacteria 1214
57 Ga0068869_100002121 3300005334 Bacteria 11927
58 Ga0070666_10000004 3300005335 Bacteria 372098
59 Ga0070666_10018874 3300005335 Bacteria 4443
60 Ga0070666_10048933 3300005335 Bacteria 2840
61 Ga0070680_100113670 3300005336 Bacteria 2255
62 Ga0070680_100304120 3300005336 Bacteria 1352
63 Ga0070682_100070499 3300005337 Bacteria 2234
64 Ga0070682_100091012 3300005337 Bacteria 1996
65 Ga0070682_100338331 3300005337 Bacteria 1118
66 Ga0070682_100490420 3300005337 Bacteria 950
67 Ga0068868_100192901 3300005338 Bacteria 1695
68 Ga0068868_100219703 3300005338 Bacteria 1590
69 Ga0068868_100310148 3300005338 Bacteria 1342
70 Ga0068868_100586607 3300005338 Bacteria 986
71 Ga0070660_100002916 3300005339 Bacteria 11778
72 Ga0070660_100005333 3300005339 Bacteria 8896
73 Ga0070660_100041300 3300005339 Bacteria 3515
74 Ga0070660_100055623 3300005339 Bacteria 3058
75 Ga0070660_100113512 3300005339 Bacteria 2157
76 Ga0070660_100135960 3300005339 Unclassified 1969
77 Ga0070660_100221933 3300005339 Bacteria 1536
78 Ga0070660_100228896 3300005339 Bacteria 1512
79 Ga0070660_101257129 3300005339 Unclassified 628
80 Ga0070660_101365799 3300005339 Unclassified 602
81 Ga0070689_100024970 3300005340 Bacteria 4486
82 Ga0070689_100333899 3300005340 Bacteria 1268
83 Ga0070691_10460073 3300005341 Unclassified 728
84 Ga0070661_100010886 3300005344 Bacteria 6336
85 Ga0070661_100076035 3300005344 Bacteria 2475
86 Ga0070661_100103201 3300005344 Bacteria 2123
87 Ga0070661_100166439 3300005344 Bacteria 1672
88 Ga0070661_100202437 3300005344 Bacteria 1517
89 Ga0070661_100304762 3300005344 Bacteria 1241
90 Ga0070661_100441305 3300005344 Bacteria 1034
91 Ga0070692_10018126 3300005345 Bacteria 3379
92 Ga0070692_10019433 3300005345 Bacteria 3279
93 Ga0070692_10691201 3300005345 Unclassified 685
94 Ga0070668_100018530 3300005347 Bacteria 5227
95 Ga0070668_100031487 3300005347 Bacteria 4036
96 Ga0070668_100465940 3300005347 Unclassified 1089
97 Ga0070669_100000475 3300005353 Bacteria 30512
98 Ga0070669_100023051 3300005353 Bacteria 4457
99 Ga0070669_100024624 3300005353 Bacteria 4317
100 Ga0070675_100091703 3300005354 Bacteria 2546
101 Ga0070671_100021520 3300005355 Bacteria 5267
102 Ga0070671_100058838 3300005355 Bacteria 3198
103 Ga0070671_100390702 3300005355 Bacteria 1190
104 Ga0070674_100008949 3300005356 Bacteria 5982
105 Ga0070673_100000054 3300005364 Bacteria 47411
106 Ga0070673_100048389 3300005364 Bacteria 3315
107 Ga0070688_100022666 3300005365 Bacteria 3684
108 Ga0070659_100007541 3300005366 Bacteria 7907
109 Ga0070659_100010941 3300005366 Bacteria 6696
110 Ga0070659_100021273 3300005366 Bacteria 4936
111 Ga0070659_100092786 3300005366 Bacteria 2421
112 Ga0070659_100125663 3300005366 Bacteria 2080
113 Ga0070659_100213597 3300005366 Bacteria 1590
114 Ga0070659_100249556 3300005366 Bacteria 1470
115 Ga0070659_101484616 3300005366 Bacteria 604
116 Ga0070667_100018468 3300005367 Bacteria 5783
117 Ga0070667_100112440 3300005367 Bacteria 2362
118 Ga0070667_100177513 3300005367 Bacteria 1882
119 Ga0070667_100195633 3300005367 Bacteria 1792
120 Ga0070667_100215262 3300005367 Bacteria 1709
121 Ga0070667_100463501 3300005367 Bacteria 1159
122 Ga0070714_100357982 3300005435 Bacteria 1372
123 Ga0070700_100988773 3300005441 Bacteria 691
124 Ga0070663_100006700 3300005455 Bacteria 6948
125 Ga0070663_100015931 3300005455 Bacteria 4867
126 Ga0070663_100016936 3300005455 Bacteria 4744
127 Ga0070663_100051426 3300005455 Bacteria 2935
128 Ga0070663_100208412 3300005455 Bacteria 1529
129 Ga0070663_100333896 3300005455 Bacteria 1222
130 Ga0070663_100755482 3300005455 Bacteria 831
131 Ga0070678_101541251 3300005456 Bacteria 623
132 Ga0070662_100003794 3300005457 Bacteria 9449
133 Ga0070662_100014874 3300005457 Bacteria 5203
134 Ga0070662_100054688 3300005457 Bacteria 2893
135 Ga0070662_100121567 3300005457 Bacteria 2002
136 Ga0070662_100540503 3300005457 Bacteria 975
137 Ga0070662_100641503 3300005457 Bacteria 895
138 Ga0070662_100953238 3300005457 Unclassified 733
139 Ga0070681_10076256 3300005458 Bacteria 3312
140 Ga0070681_10077824 3300005458 Bacteria 3273
141 Ga0070681_10217437 3300005458 Bacteria 1826
142 Ga0070681_10304397 3300005458 Bacteria 1503
143 Ga0070681_10387312 3300005458 Bacteria 1309
144 Ga0068867_100003158 3300005459 Bacteria 11616
145 Ga0068867_100111693 3300005459 Bacteria 2100
146 Ga0070685_10000388 3300005466 Bacteria 26436
147 Ga0070679_100033768 3300005530 Bacteria 5066
148 Ga0070679_100456390 3300005530 Bacteria 1222
149 Ga0070679_100810350 3300005530 Bacteria 879
150 Ga0070679_101198021 3300005530 Bacteria 705
151 Ga0070684_100009573 3300005535 Bacteria 7634
152 Ga0070684_100199805 3300005535 Bacteria 1821
153 Ga0070684_100823743 3300005535 Bacteria 868
154 Ga0068853_100005583 3300005539 Bacteria 9879
155 Ga0068853_100019297 3300005539 Bacteria 5652
156 Ga0068853_100066021 3300005539 Bacteria 3141
157 Ga0068853_100093267 3300005539 Bacteria 2650
158 Ga0068853_100638748 3300005539 Bacteria 1013
159 Ga0070672_100000662 3300005543 Bacteria 20203
160 Ga0070686_100000012 3300005544 Bacteria 176038
161 Ga0070696_100039146 3300005546 Bacteria 3274
162 Ga0070693_100021079 3300005547 Bacteria 3448
163 Ga0070665_100000004 3300005548 Bacteria 785500
164 Ga0070665_100154236 3300005548 Bacteria 2299
165 Ga0068855_100057377 3300005563 Bacteria 4564
166 Ga0068855_100090918 3300005563 Bacteria 3521
167 Ga0068855_100097087 3300005563 Bacteria 3394
168 Ga0068855_100167544 3300005563 Bacteria 2489
169 Ga0068855_100483517 3300005563 Bacteria 1347
170 Ga0068855_101069958 3300005563 Bacteria 845
171 Ga0068855_101488069 3300005563 Unclassified 695
172 Ga0070664_100010008 3300005564 Bacteria 7684
173 Ga0070664_100011956 3300005564 Bacteria 7047
174 Ga0070664_100029990 3300005564 Bacteria 4536
175 Ga0070664_100094153 3300005564 Bacteria 2597
176 Ga0070664_100116654 3300005564 Bacteria 2335
177 Ga0068857_100004300 3300005577 Bacteria 12015
178 Ga0068857_100066257 3300005577 Bacteria 3213
179 Ga0068857_100069042 3300005577 Bacteria 3146
180 Ga0068857_100184685 3300005577 Bacteria 1898
181 Ga0068857_100199696 3300005577 Bacteria 1823
182 Ga0068857_100263085 3300005577 Bacteria 1583
183 Ga0068857_100389976 3300005577 Bacteria 1294
184 Ga0068854_100004284 3300005578 Bacteria 8989
185 Ga0068854_100010697 3300005578 Bacteria 5955
186 Ga0068854_100101130 3300005578 Bacteria 2161
187 Ga0068854_100149738 3300005578 Bacteria 1798
188 Ga0068854_100204052 3300005578 Bacteria 1556
189 Ga0068854_100294168 3300005578 Bacteria 1311
190 Ga0068854_100606702 3300005578 Bacteria 935
191 Ga0068854_101681990 3300005578 Bacteria 580
192 Ga0068856_100144812 3300005614 Bacteria 2383
193 Ga0068856_100245549 3300005614 Bacteria 1805
194 Ga0068856_100723375 3300005614 Bacteria 1016
195 Ga0068856_101306793 3300005614 Bacteria 740
196 Ga0070702_100320430 3300005615 Unclassified 1080
197 Ga0068852_100007127 3300005616 Bacteria 8146
198 Ga0068852_100063051 3300005616 Bacteria 3226
199 Ga0068852_100064238 3300005616 Bacteria 3199
200 Ga0068852_100126435 3300005616 Bacteria 2348
201 Ga0068852_100368991 3300005616 Bacteria 1406
202 Ga0068852_100449047 3300005616 Bacteria 1276
203 Ga0068852_100805377 3300005616 Unclassified 954
204 Ga0068859_100002194 3300005617 Bacteria 19831
205 Ga0068859_100006732 3300005617 Bacteria 11675
206 Ga0068859_100030043 3300005617 Bacteria 5452
207 Ga0068859_100795689 3300005617 Bacteria 1033
208 Ga0068859_101665713 3300005617 Bacteria 704
209 Ga0068864_100004002 3300005618 Bacteria 12137
210 Ga0068864_100011898 3300005618 Bacteria 7184
211 Ga0068864_100130085 3300005618 Bacteria 2260
212 Ga0068864_100291844 3300005618 Bacteria 1525
213 Ga0068866_10027758 3300005718 Bacteria 2690
214 Ga0068861_100190229 3300005719 Bacteria 1715
215 Ga0068851_10025821 3300005834 Bacteria 2883
216 Ga0068851_10033197 3300005834 Bacteria 2571
217 Ga0068851_10050023 3300005834 Bacteria 2121
218 Ga0068851_10086129 3300005834 Bacteria 1648
219 Ga0068851_10098755 3300005834 Bacteria 1546
220 Ga0068851_10216693 3300005834 Bacteria 1074
221 Ga0068870_10398299 3300005840 Bacteria 895
222 Ga0068863_100000013 3300005841 Bacteria 220357
223 Ga0068863_100007045 3300005841 Bacteria 11016
224 Ga0068863_100014207 3300005841 Bacteria 7670
225 Ga0068863_100053243 3300005841 Bacteria 3835
226 Ga0068858_100003085 3300005842 Bacteria 16664
227 Ga0068858_100004681 3300005842 Bacteria 13410
228 Ga0068858_100008938 3300005842 Bacteria 9602
229 Ga0068858_100011972 3300005842 Bacteria 8177
230 Ga0068858_101355437 3300005842 Bacteria 700
231 Ga0068860_100000009 3300005843 Bacteria 372089
232 Ga0068860_100038118 3300005843 Bacteria 4598
233 Ga0068860_100083047 3300005843 Bacteria 3046
234 Ga0068860_100579824 3300005843 Bacteria 1126
235 Ga0068860_101451390 3300005843 Bacteria 707
236 Ga0068862_100000209 3300005844 Bacteria 65440
237 Ga0068862_100019582 3300005844 Bacteria 5651
238 Ga0068862_100044045 3300005844 Bacteria 3806
239 Ga0068862_100452501 3300005844 Bacteria 1211
240 Ga0081539_10068482 3300005985 Bacteria 1914
241 Ga0070712_101135059 3300006175 Unclassified 679
242 Ga0075362_10145827 3300006177 Unclassified 1133
243 Ga0068871_101316926 3300006358 Bacteria 680
244 Ga0068865_100370845 3300006881 Bacteria 1165
245 Ga0097620_100002194 3300006931 Bacteria 19831
246 Ga0097620_100006731 3300006931 Bacteria 11675
247 Ga0097620_100030043 3300006931 Bacteria 5452
248 Ga0097620_100795665 3300006931 Bacteria 1033
249 Ga0097620_101665797 3300006931 Bacteria 704
250 Ga0105251_10195707 3300009011 Unclassified 911
251 Ga0105240_10152399 3300009093 Bacteria 2752
252 Ga0105240_11293247 3300009093 Bacteria 769
253 Ga0105247_10046982 3300009101 Bacteria 2651
254 Ga0105243_10012952 3300009148 Bacteria 6302
255 Ga0105241_10018748 3300009174 Bacteria 5097
256 Ga0105241_10415187 3300009174 Unclassified 1183
257 Ga0105241_10823792 3300009174 Bacteria 856
258 Ga0105242_10912879 3300009176 Bacteria 879
259 Ga0105248_10000734 3300009177 Bacteria 36902
260 Ga0105248_10144357 3300009177 Bacteria 2685
261 Ga0105237_10047879 3300009545 Bacteria 4299
262 Ga0105237_10604337 3300009545 Bacteria 1104
263 Ga0105238_10135959 3300009551 Bacteria 2436
264 Ga0105238_10154313 3300009551 Bacteria 2271
265 Ga0105238_10231241 3300009551 Bacteria 1826
266 Ga0105249_10000006 3300009553 Bacteria 354449
267 Ga0105239_10137153 3300010375 Bacteria 2724
268 Ga0105246_10015101 3300011119 Bacteria 4869
269 Ga0105246_10111916 3300011119 Bacteria 2007
270 Ga0157373_10016294 3300013100 Bacteria 5423
271 Ga0157373_10027977 3300013100 Bacteria 4067
272 Ga0157373_10083310 3300013100 Bacteria 2254
273 Ga0157373_10134156 3300013100 Bacteria 1741
274 Ga0157373_10138597 3300013100 Bacteria 1710
275 Ga0157373_10203659 3300013100 Bacteria 1395
276 Ga0157373_10204630 3300013100 Bacteria 1392
277 Ga0157373_10348518 3300013100 Bacteria 1056
278 Ga0157371_10008527 3300013102 Bacteria 8160
279 Ga0157371_10105278 3300013102 Bacteria 2002
280 Ga0157371_10165325 3300013102 Bacteria 1580
281 Ga0157371_10248968 3300013102 Bacteria 1279
282 Ga0157371_10258532 3300013102 Bacteria 1255
283 Ga0157370_10029153 3300013104 Bacteria 5421
284 Ga0157370_10041135 3300013104 Bacteria 4462
285 Ga0157370_10065820 3300013104 Bacteria 3428
286 Ga0157370_10260998 3300013104 Bacteria 1601
287 Ga0157369_10047501 3300013105 Bacteria 4660
288 Ga0157369_10082315 3300013105 Bacteria 3444
289 Ga0157369_10420825 3300013105 Bacteria 1385
290 Ga0157369_10689767 3300013105 Bacteria 1052
291 Ga0157374_11072481 3300013296 Bacteria 826
292 Ga0157374_11858307 3300013296 Unclassified 628
293 Ga0157378_10000385 3300013297 Bacteria 43624
294 Ga0163162_10095116 3300013306 Bacteria 3065
295 Ga0163162_11109387 3300013306 Bacteria 896
296 Ga0157372_10258948 3300013307 Bacteria 2020
297 Ga0157372_10333510 3300013307 Bacteria 1767
298 Ga0157372_10438904 3300013307 Bacteria 1522
299 Ga0157372_10657181 3300013307 Bacteria 1221
300 Ga0157372_11784506 3300013307 Unclassified 707
301 Ga0157372_12071578 3300013307 Bacteria 654
302 Ga0163163_10269560 3300014325 Bacteria 1754
303 Ga0163163_12770181 3300014325 Unclassified 547
304 Ga0157380_10000182 3300014326 Bacteria 36263
305 Ga0182008_10274703 3300014497 Bacteria 875
306 Ga0182008_10659420 3300014497 Bacteria 593
307 Ga0157379_10153468 3300014968 Bacteria 2077
308 Ga0163161_10000101 3300017792 Bacteria 81604
309 Ga0207672_1000247 3300025223 Bacteria 7478
310 Ga0207697_10001196 3300025315 Bacteria 14220
311 Ga0207656_10005761 3300025321 Bacteria 4408
312 Ga0207656_10057162 3300025321 Bacteria 1702
313 Ga0207656_10094353 3300025321 Bacteria 1363
314 Ga0207656_10106279 3300025321 Bacteria 1292
315 Ga0207682_10161370 3300025893 Bacteria 1016
316 Ga0207642_10213303 3300025899 Unclassified 1074
317 Ga0207710_10038414 3300025900 Bacteria 2116
318 Ga0207710_10188914 3300025900 Bacteria 1014
319 Ga0207688_10005303 3300025901 Bacteria 7002
320 Ga0207680_10000010 3300025903 Bacteria 414170
321 Ga0207680_10144206 3300025903 Bacteria 1582
322 Ga0207647_10003861 3300025904 Bacteria 11212
323 Ga0207647_10015108 3300025904 Bacteria 5304
324 Ga0207647_10031747 3300025904 Bacteria 3397
325 Ga0207647_10037339 3300025904 Bacteria 3081
326 Ga0207647_10044036 3300025904 Bacteria 2790
327 Ga0207647_10063695 3300025904 Bacteria 2242
328 Ga0207647_10078027 3300025904 Bacteria 1990
329 Ga0207647_10129971 3300025904 Bacteria 1481
330 Ga0207647_10246073 3300025904 Bacteria 1026
331 Ga0207645_10006757 3300025907 Bacteria 8193
332 Ga0207645_10010932 3300025907 Bacteria 6213
333 Ga0207645_10011850 3300025907 Bacteria 5935
334 Ga0207645_10323674 3300025907 Bacteria 1029
335 Ga0207643_10544915 3300025908 Bacteria 744
336 Ga0207705_10000853 3300025909 Bacteria 24997
337 Ga0207705_10010637 3300025909 Bacteria 6683
338 Ga0207705_10025542 3300025909 Bacteria 4215
339 Ga0207705_10040163 3300025909 Bacteria 3355
340 Ga0207705_10105202 3300025909 Bacteria 2080
341 Ga0207705_10353522 3300025909 Bacteria 1132
342 Ga0207705_10643107 3300025909 Bacteria 825
343 Ga0207705_10954206 3300025909 Bacteria 663
344 Ga0207705_10997379 3300025909 Bacteria 647
345 Ga0207654_10002849 3300025911 Bacteria 8767
346 Ga0207707_10373105 3300025912 Bacteria 1227
347 Ga0207707_10374131 3300025912 Bacteria 1225
348 Ga0207707_10798952 3300025912 Bacteria 786
349 Ga0207695_10081929 3300025913 Bacteria 3265
350 Ga0207695_10335069 3300025913 Bacteria 1401
351 Ga0207671_10002150 3300025914 Bacteria 21495
352 Ga0207663_10304213 3300025916 Bacteria 1192
353 Ga0207660_10010098 3300025917 Bacteria 6116
354 Ga0207660_10150839 3300025917 Bacteria 1786
355 Ga0207660_10291266 3300025917 Bacteria 1298
356 Ga0207657_10006863 3300025919 Bacteria 11745
357 Ga0207657_10013608 3300025919 Bacteria 7978
358 Ga0207657_10014626 3300025919 Bacteria 7646
359 Ga0207657_10022348 3300025919 Bacteria 5921
360 Ga0207657_10059993 3300025919 Bacteria 3266
361 Ga0207657_10072538 3300025919 Bacteria 2912
362 Ga0207657_10076614 3300025919 Bacteria 2821
363 Ga0207657_10080804 3300025919 Bacteria 2732
364 Ga0207657_10147331 3300025919 Unclassified 1919
365 Ga0207657_10223048 3300025919 Bacteria 1509
366 Ga0207657_10267637 3300025919 Bacteria 1359
367 Ga0207657_10365635 3300025919 Bacteria 1137
368 Ga0207657_10851213 3300025919 Bacteria 704
369 Ga0207649_10063461 3300025920 Bacteria 2332
370 Ga0207649_10082722 3300025920 Bacteria 2082
371 Ga0207649_10312605 3300025920 Bacteria 1152
372 Ga0207649_10775748 3300025920 Bacteria 747
373 Ga0207652_10009067 3300025921 Bacteria 8013
374 Ga0207652_10229422 3300025921 Bacteria 1673
375 Ga0207652_10232300 3300025921 Bacteria 1662
376 Ga0207652_10367050 3300025921 Bacteria 1299
377 Ga0207681_10000183 3300025923 Bacteria 51105
378 Ga0207681_10000837 3300025923 Bacteria 20329
379 Ga0207681_10022424 3300025923 Bacteria 4027
380 Ga0207694_10013396 3300025924 Bacteria 6175
381 Ga0207694_10014268 3300025924 Bacteria 5992
382 Ga0207694_10105726 3300025924 Bacteria 2235
383 Ga0207694_10140227 3300025924 Bacteria 1944
384 Ga0207694_10211203 3300025924 Bacteria 1581
385 Ga0207650_10056392 3300025925 Bacteria 2919
386 Ga0207650_10379077 3300025925 Bacteria 1168
387 Ga0207650_10929043 3300025925 Bacteria 739
388 Ga0207659_10039297 3300025926 Bacteria 3299
389 Ga0207659_10090598 3300025926 Bacteria 2283
390 Ga0207687_10041900 3300025927 Bacteria 3147
391 Ga0207687_10242113 3300025927 Bacteria 1430
392 Ga0207644_10009011 3300025931 Bacteria 6539
393 Ga0207644_10390360 3300025931 Bacteria 1136
394 Ga0207690_10004904 3300025932 Bacteria 7894
395 Ga0207690_10008921 3300025932 Bacteria 5953
396 Ga0207690_10048664 3300025932 Bacteria 2821
397 Ga0207690_10076699 3300025932 Bacteria 2321
398 Ga0207690_10093029 3300025932 Bacteria 2135
399 Ga0207690_10106849 3300025932 Bacteria 2009
400 Ga0207690_10301849 3300025932 Bacteria 1253
401 Ga0207690_10314564 3300025932 Bacteria 1229
402 Ga0207690_10989297 3300025932 Bacteria 699
403 Ga0207690_11008615 3300025932 Unclassified 693
404 Ga0207706_10006510 3300025933 Bacteria 10835
405 Ga0207706_10017971 3300025933 Bacteria 6363
406 Ga0207706_10030874 3300025933 Bacteria 4777
407 Ga0207706_10116307 3300025933 Bacteria 2352
408 Ga0207706_10181899 3300025933 Bacteria 1846
409 Ga0207706_10234825 3300025933 Bacteria 1603
410 Ga0207706_10500823 3300025933 Bacteria 1048
411 Ga0207706_10502239 3300025933 Bacteria 1047
412 Ga0207706_10872805 3300025933 Bacteria 761
413 Ga0207706_11690193 3300025933 Unclassified 510
414 Ga0207709_10081973 3300025935 Unclassified 2082
415 Ga0207670_10066832 3300025936 Bacteria 2471
416 Ga0207670_10294517 3300025936 Bacteria 1269
417 Ga0207669_10085830 3300025937 Bacteria 2033
418 Ga0207704_10021708 3300025938 Bacteria 3425
419 Ga0207704_10591497 3300025938 Unclassified 907
420 Ga0207691_10013722 3300025940 Bacteria 7741
421 Ga0207711_10009860 3300025941 Bacteria 7944
422 Ga0207711_10082654 3300025941 Bacteria 2808
423 Ga0207689_10003528 3300025942 Bacteria 14295
424 Ga0207661_11807996 3300025944 Bacteria 556
425 Ga0207679_10020031 3300025945 Bacteria 4508
426 Ga0207679_10025974 3300025945 Bacteria 4034
427 Ga0207679_10172881 3300025945 Bacteria 1780
428 Ga0207679_10189629 3300025945 Bacteria 1708
429 Ga0207679_11155310 3300025945 Bacteria 710
430 Ga0207667_10025213 3300025949 Bacteria 6512
431 Ga0207667_10086190 3300025949 Bacteria 3250
432 Ga0207667_10120112 3300025949 Bacteria 2708
433 Ga0207667_10137642 3300025949 Bacteria 2514
434 Ga0207667_10248299 3300025949 Bacteria 1820
435 Ga0207667_10495135 3300025949 Bacteria 1240
436 Ga0207667_10503670 3300025949 Bacteria 1228
437 Ga0207667_10748826 3300025949 Bacteria 976
438 Ga0207667_10811612 3300025949 Bacteria 932
439 Ga0207667_11370339 3300025949 Bacteria 682
440 Ga0207651_10017017 3300025960 Bacteria 4281
441 Ga0207712_10000014 3300025961 Bacteria 375393
442 Ga0207668_10011675 3300025972 Bacteria 5346
443 Ga0207668_10185961 3300025972 Bacteria 1642
444 Ga0207668_10361033 3300025972 Bacteria 1217
445 Ga0207640_10007845 3300025981 Bacteria 5890
446 Ga0207640_10023016 3300025981 Bacteria 3739
447 Ga0207640_10125514 3300025981 Bacteria 1847
448 Ga0207640_10156573 3300025981 Bacteria 1680
449 Ga0207640_10166583 3300025981 Bacteria 1637
450 Ga0207640_10170973 3300025981 Bacteria 1619
451 Ga0207640_11317943 3300025981 Unclassified 645
452 Ga0207658_10000739 3300025986 Bacteria 28225
453 Ga0207658_10009550 3300025986 Bacteria 6585
454 Ga0207658_10491540 3300025986 Bacteria 1092
455 Ga0207658_11042819 3300025986 Bacteria 746
456 Ga0207677_10012887 3300026023 Bacteria 4827
457 Ga0207677_10063883 3300026023 Bacteria 2561
458 Ga0207677_10154084 3300026023 Bacteria 1777
459 Ga0207703_10000985 3300026035 Bacteria 27423
460 Ga0207703_10014035 3300026035 Bacteria 6244
461 Ga0207703_10016769 3300026035 Bacteria 5715
462 Ga0207703_10041642 3300026035 Bacteria 3681
463 Ga0207639_10002096 3300026041 Bacteria 13429
464 Ga0207639_10023116 3300026041 Bacteria 4486
465 Ga0207639_10053144 3300026041 Bacteria 3089
466 Ga0207639_10154448 3300026041 Bacteria 1926
467 Ga0207639_10185956 3300026041 Bacteria 1771
468 Ga0207639_10252939 3300026041 Bacteria 1537
469 Ga0207639_10268793 3300026041 Bacteria 1495
470 Ga0207678_10014746 3300026067 Bacteria 6877
471 Ga0207678_10015371 3300026067 Bacteria 6732
472 Ga0207678_10049714 3300026067 Bacteria 3624
473 Ga0207678_10066320 3300026067 Bacteria 3100
474 Ga0207678_10158708 3300026067 Bacteria 1931
475 Ga0207678_10298185 3300026067 Bacteria 1385
476 Ga0207702_10005432 3300026078 Bacteria 11152
477 Ga0207702_10018861 3300026078 Bacteria 5707
478 Ga0207702_10114945 3300026078 Bacteria 2399
479 Ga0207702_10585065 3300026078 Bacteria 1094
480 Ga0207702_10850598 3300026078 Bacteria 903
481 Ga0207702_11040948 3300026078 Bacteria 812
482 Ga0207641_10000099 3300026088 Bacteria 122892
483 Ga0207641_10006633 3300026088 Bacteria 9716
484 Ga0207641_10022752 3300026088 Bacteria 5160
485 Ga0207648_10007186 3300026089 Bacteria 10979
486 Ga0207676_10004316 3300026095 Bacteria 10053
487 Ga0207676_10014654 3300026095 Bacteria 5645
488 Ga0207676_10016807 3300026095 Bacteria 5297
489 Ga0207676_10769556 3300026095 Bacteria 937
490 Ga0207674_10006137 3300026116 Bacteria 14197
491 Ga0207674_10008725 3300026116 Bacteria 11669
492 Ga0207674_10012558 3300026116 Bacteria 9463
493 Ga0207674_10040610 3300026116 Bacteria 4819
494 Ga0207674_10097238 3300026116 Bacteria 2928
495 Ga0207674_10142146 3300026116 Bacteria 2359
496 Ga0207674_10158194 3300026116 Bacteria 2221
497 Ga0207674_10355228 3300026116 Bacteria 1417
498 Ga0207674_10881153 3300026116 Unclassified 863
499 Ga0207675_100001918 3300026118 Bacteria 20742
500 Ga0207675_100070792 3300026118 Bacteria 3260
501 Ga0207683_11096335 3300026121 Bacteria 739
502 Ga0207698_10007378 3300026142 Bacteria 6892
503 Ga0207698_10073726 3300026142 Unclassified 2719
504 Ga0207698_10274021 3300026142 Bacteria 1557
505 Ga0207698_10293431 3300026142 Bacteria 1510
506 Ga0207698_10369944 3300026142 Bacteria 1360
507 Ga0207698_10442579 3300026142 Bacteria 1252
508 Ga0207698_10449195 3300026142 Bacteria 1244
509 Ga0207698_10770303 3300026142 Bacteria 962
510 Ga0207698_10915347 3300026142 Unclassified 885
511 Ga0268266_10000009 3300028379 Bacteria 1097737
512 Ga0268266_10036375 3300028379 Bacteria 4190
513 Ga0268266_10053575 3300028379 Bacteria 3466
514 Ga0268266_11505594 3300028379 Unclassified 648
515 Ga0268265_10000047 3300028380 Bacteria 179354
516 Ga0268265_10002288 3300028380 Bacteria 14579
517 Ga0268265_10230337 3300028380 Unclassified 1628
518 Ga0268265_10330897 3300028380 Bacteria 1383
519 Ga0268264_10000023 3300028381 Bacteria 471408
520 Ga0268264_10008874 3300028381 Bacteria 8335
521 Ga0268264_10048773 3300028381 Bacteria 3522
522 Ga0268264_10543352 3300028381 Bacteria 1139
523 Ga0307408_100037753 3300031548 Bacteria 3403
524 Ga0307408_100058616 3300031548 Bacteria 2800
525 Ga0307408_100967791 3300031548 Bacteria 783
526 Ga0307405_10016316 3300031731 Bacteria 4048
527 Ga0307405_10054214 3300031731 Bacteria 2502
528 Ga0307405_10110489 3300031731 Bacteria 1861
529 Ga0307405_10235387 3300031731 Bacteria 1353
530 Ga0307413_10087233 3300031824 Bacteria 2020
531 Ga0307413_10185634 3300031824 Bacteria 1487
532 Ga0307410_10061161 3300031852 Bacteria 2577
533 Ga0307406_10051414 3300031901 Bacteria 2616
534 Ga0307406_10265686 3300031901 Bacteria 1300
535 Ga0307406_10691408 3300031901 Bacteria 851
536 Ga0307406_11488084 3300031901 Bacteria 595
537 Ga0307406_11684500 3300031901 Unclassified 562
538 Ga0307407_10003974 3300031903 Bacteria 6179
539 Ga0307407_10055682 3300031903 Bacteria 2286
540 Ga0307407_10488424 3300031903 Bacteria 900
541 Ga0307409_100006010 3300031995 Bacteria 7076
542 Ga0307409_100100992 3300031995 Bacteria 2392
543 Ga0307409_101354004 3300031995 Bacteria 737
544 Ga0307416_100009204 3300032002 Bacteria 6445
545 Ga0307416_100077987 3300032002 Bacteria 2785
546 Ga0307416_100556011 3300032002 Bacteria 1221
547 Ga0307414_10099214 3300032004 Bacteria 2187
548 Ga0307414_11363588 3300032004 Bacteria 658
549 Ga0307411_10014955 3300032005 Bacteria 4338
550 Ga0307411_10148141 3300032005 Bacteria 1740
551 Ga0307411_10338586 3300032005 Bacteria 1221
552 Ga0307415_100001510 3300032126 Bacteria 11161
553 Ga0307415_100001605 3300032126 Bacteria 10923
554 Ga0307415_100554186 3300032126 Bacteria 1015
555 Ga0307415_101079215 3300032126 Bacteria 750
556 Ga0373943_0001968 3300035170 Bacteria 9302
557 Ga0373946_0001564 3300035171 Bacteria 7972
558 Ga0373927_0014491 3300035695 Bacteria 5217
559 Ga0373925_0081955 3300037068 Bacteria 2454
560 Ga0395899_0010997 3300037312 Bacteria 6932
561 Ga0395899_0011491 3300037312 Bacteria 6777
562 Ga0395899_0028954 3300037312 Bacteria 4167
563 Ga0395899_0044155 3300037312 Bacteria 3322
564 Ga0395899_0592265 3300037312 Unclassified 707
565 Ga0395900_0008433 3300037418 Bacteria 10601
566 Ga0395900_0009176 3300037418 Bacteria 10136
567 Ga0395900_0021034 3300037418 Bacteria 6667
568 Ga0395900_0021542 3300037418 Bacteria 6589
569 Ga0395900_0037468 3300037418 Bacteria 4999
570 Ga0395900_0046161 3300037418 Bacteria 4486
571 Ga0395900_0082818 3300037418 Bacteria 3296
572 Ga0395900_0094609 3300037418 Bacteria 3069
573 Ga0395900_0139432 3300037418 Bacteria 2484
574 Ga0395900_0155326 3300037418 Bacteria 2337
575 Ga0395900_0185836 3300037418 Bacteria 2109
576 Ga0395900_0201274 3300037418 Bacteria 2015
577 Ga0395900_0245969 3300037418 Bacteria 1792
578 Ga0395900_0281606 3300037418 Bacteria 1654
579 Ga0395900_0290401 3300037418 Bacteria 1624
580 Ga0395900_0296296 3300037418 Bacteria 1605
581 Ga0395900_0351486 3300037418 Bacteria 1447
582 Ga0395900_0359944 3300037418 Bacteria 1426
583 Ga0395900_0385951 3300037418 Bacteria 1368
584 Ga0395900_0409914 3300037418 Bacteria 1318
585 Ga0395900_0583545 3300037418 Bacteria 1060
586 Ga0395900_0841062 3300037418 Bacteria 844
587 Ga0395900_1225155 3300037418 Unclassified 665
588 Ga0395898_0009943 3300037466 Bacteria 9963
589 Ga0395898_0023445 3300037466 Bacteria 6237
590 Ga0395898_0080373 3300037466 Bacteria 3144
591 Ga0395898_0081294 3300037466 Bacteria 3124
592 Ga0395898_0140030 3300037466 Bacteria 2316
593 Ga0395898_0145201 3300037466 Bacteria 2271
594 Ga0395898_0193377 3300037466 Bacteria 1944
595 Ga0395898_0207143 3300037466 Bacteria 1871
596 Ga0395898_0210440 3300037466 Bacteria 1855
597 Ga0395898_0225701 3300037466 Bacteria 1786
598 Ga0395898_0240770 3300037466 Bacteria 1725
599 Ga0395898_0313133 3300037466 Bacteria 1497
600 Ga0395898_0323480 3300037466 Bacteria 1471
601 Ga0395898_0377889 3300037466 Bacteria 1351
602 Ga0395898_0521698 3300037466 Bacteria 1129
603 Ga0395898_0656925 3300037466 Unclassified 991
604 Ga0395905_0001939 3300037471 Bacteria 23712
605 Ga0395905_0005920 3300037471 Bacteria 12397
606 Ga0395905_0006816 3300037471 Bacteria 11438
607 Ga0395905_0008208 3300037471 Bacteria 10312
608 Ga0395905_0020979 3300037471 Bacteria 6185
609 Ga0395905_0022898 3300037471 Bacteria 5904
610 Ga0395905_0027424 3300037471 Bacteria 5371
611 Ga0395905_0035354 3300037471 Bacteria 4691
612 Ga0395905_0035655 3300037471 Bacteria 4670
613 Ga0395905_0037759 3300037471 Bacteria 4533
614 Ga0395905_0041452 3300037471 Bacteria 4320
615 Ga0395905_0072140 3300037471 Bacteria 3237
616 Ga0395905_0089372 3300037471 Bacteria 2887
617 Ga0395905_0090087 3300037471 Bacteria 2875
618 Ga0395905_0122440 3300037471 Bacteria 2445
619 Ga0395905_0212251 3300037471 Bacteria 1813
620 Ga0395905_0284058 3300037471 Bacteria 1541
621 Ga0395905_0299881 3300037471 Bacteria 1494
622 Ga0395905_0349400 3300037471 Bacteria 1371
623 Ga0395905_0465375 3300037471 Bacteria 1163
624 Ga0395905_0534411 3300037471 Bacteria 1073
625 Ga0395905_0791027 3300037471 Bacteria 851
626 Ga0395905_0831978 3300037471 Unclassified 826
627 Ga0395905_1547780 3300037471 Unclassified 568
628 Ga0395901_0014172 3300038443 Bacteria 8118
629 Ga0395901_0015583 3300038443 Bacteria 7742
630 Ga0395901_0015672 3300038443 Bacteria 7720
631 Ga0395901_0020567 3300038443 Bacteria 6754
632 Ga0395901_0025737 3300038443 Bacteria 6040
633 Ga0395901_0032774 3300038443 Bacteria 5360
634 Ga0395901_0039704 3300038443 Bacteria 4872
635 Ga0395901_0086094 3300038443 Bacteria 3285
636 Ga0395901_0091500 3300038443 Bacteria 3184
637 Ga0395901_0105240 3300038443 Bacteria 2961
638 Ga0395901_0126280 3300038443 Bacteria 2688
639 Ga0395901_0169743 3300038443 Bacteria 2289
640 Ga0395901_0251915 3300038443 Bacteria 1839
641 Ga0395901_0300304 3300038443 Bacteria 1665
642 Ga0395901_0339712 3300038443 Bacteria 1551
643 Ga0395901_0534087 3300038443 Unclassified 1190
644 Ga0395901_0685706 3300038443 Bacteria 1024
645 Ga0395901_0846505 3300038443 Bacteria 900
646 Ga0395901_0950685 3300038443 Bacteria 838
647 Ga0395901_0999469 3300038443 Bacteria 812
648 Ga0395901_1034294 3300038443 Bacteria 795
649 Ga0395901_1266260 3300038443 Unclassified 700
650 Ga0439464_0008383 3300042439 Bacteria 2709
651 Ga0466972_0139898 3300044658 Bacteria 1139
652 Ga0466965_0202724 3300044683 Bacteria 1053
653 Ga0466966_0200409 3300044684 Bacteria 1208
654 Ga0466961_0035122 3300044693 Bacteria 3219
655 Ga0466961_0081349 3300044693 Bacteria 2049
656 Ga0466961_0197816 3300044693 Bacteria 1244
657 Ga0466963_0007693 3300044694 Bacteria 6435
658 Ga0466963_0292809 3300044694 Bacteria 1144
659 Ga0466964_0050904 3300044706 Bacteria 1699
660 Ga0466971_0037974 3300044719 Bacteria 2160
661 Ga0466971_0243909 3300044719 Bacteria 855
662 Ga0466968_0020552 3300044735 Bacteria 2666
663 Ga0466970_0182193 3300044765 Bacteria 1165
664 Ga0466970_0676844 3300044765 Bacteria 601
665 Ga0466957_0008566 3300044842 Bacteria 5821
666 Ga0466957_0047594 3300044842 Bacteria 2606
667 Ga0466957_0106764 3300044842 Bacteria 1771
668 Ga0466957_0449741 3300044842 Bacteria 888
669 Ga0466957_0546067 3300044842 Bacteria 807
670 Ga0466959_0112343 3300045049 Bacteria 1943
671 Ga0466958_0031748 3300045836 Bacteria 3139
672 Ga0466958_0041702 3300045836 Bacteria 2761
673 Ga0466958_0263435 3300045836 Bacteria 1103
674 Ga0466958_1172471 3300045836 Unclassified 502
675 Ga0466967_0001147 3300045976 Bacteria 14807
676 Ga0466967_0024434 3300045976 Bacteria 4968
677 Ga0466967_0192426 3300045976 Bacteria 1928
678 Ga0466967_1172183 3300045976 Bacteria 765
679 Ga0495582_0531031 3300046473 Bacteria 680
680 Ga0495663_0063721 3300046525 Bacteria 1163
681 Ga0495669_0008236 3300046684 Bacteria 4376
682 Ga0495669_0017245 3300046684 Bacteria 3097
683 Ga0495677_0046140 3300047445 Bacteria 1599
684 Ga0496100_0339554 3300048903 Bacteria 1132
685 Ga0496100_1163761 3300048903 Unclassified 608
686 Ga0496102_0002875 3300048905 Bacteria 14613
687 Ga0496103_0001237 3300048906 Bacteria 17435
688 Ga0496104_0070332 3300048907 Bacteria 3327
689 Ga0496105_0328741 3300048908 Bacteria 1224
690 Ga0496106_0129220 3300048909 Bacteria 1980
691 Ga0496106_0637882 3300048909 Bacteria 852
692 Ga0496107_0196733 3300048910 Bacteria 1498
693 Ga0496107_0749087 3300048910 Bacteria 717
694 Ga0496117_0004454 3300048920 Bacteria 15443
695 Ga0496118_0018945 3300048921 Bacteria 6171
696 Ga0496125_0261589 3300048928 Bacteria 1084
697 Ga0501067_0254802 3300049583 Bacteria 977
698 Ga0501069_0084736 3300049585 Bacteria 1788
699 Ga0501202_022182 3300049652 Bacteria 1274
700 Ga0501209_164879 3300049656 Bacteria 672
701 Ga0501223_050241 3300049663 Bacteria 809
702 Ga0501233_038811 3300049668 Bacteria 1111
703 Ga0501240_018859 3300049673 Bacteria 1019
704 Ga0501249_028470 3300049679 Bacteria 1239
705 Ga0501250_035618 3300049680 Bacteria 710
706 Ga0501225_0054811 3300049705 Bacteria 1115
707 Ga0501268_005552 3300049765 Bacteria 1818
708 Ga0501270_032479 3300049767 Unclassified 869
709 Ga0501270_038132 3300049767 Bacteria 825
710 Ga0500566_0198508 3300053094 Bacteria 1015
711 Ga0500604_0000124 3300053151 Bacteria 23474
712 Ga0500622_0177891 3300053156 Bacteria 985
713 Ga0466962_0006197 3300061719 Bacteria 5745
714 Ga0466962_0033150 3300061719 Bacteria 2471
715 Ga0466962_0268420 3300061719 Bacteria 841
716 JGI24735J21928_10009533
717 JGI24034J14986_100862
718 JGI24736J21556_1000032
719 JGI24736J21556_1005054
720 JGI24736J21556_1077882
721 JGI24741J21665_1007050
722 JGI24741J21665_1008425
723 JGI24741J21665_1025010
724 JGI24752J21851_1002487
725 JGI24740J21852_10000725
726 JGI24740J21852_10010276
727 JGI24739J22299_10003316
728 JGI24739J22299_10013496
729 JGI24737J22298_10000448
730 JGI24737J22298_10000878
731 JGI24737J22298_10001833
732 JGI24737J22298_10001939
733 JGI24737J22298_10009454
734 JGI24737J22298_10027059
735 JGI24735J21928_10004427
736 JGI24735J21928_10013281
737 JGI24735J21928_10087415
738 JGI24735J21928_10090197
739 JGI24750J21931_1000268
740 JGI24748J21848_1000036
741 JGI24738J21930_10000356
742 JGI24738J21930_10009436
743 JGI24749J21850_1000281
744 JGI24034J26672_10000008
745 JGI24034J26672_10000038
746 JGI24034J26672_10021420
747 JGI24742J22300_10002789
748 rootH1_10140429
749 Ga0070658_10032671
750 Ga0070658_10104996
751 Ga0070658_10185130
752 Ga0070658_10216582
753 Ga0070658_10277385
754 Ga0070658_10625297
755 Ga0070658_10897739
756 Ga0070658_11134141
757 Ga0070676_10071055
758 Ga0070676_10983272
759 Ga0070683_100043021
760 Ga0070683_100182086
761 Ga0070683_101242903
762 Ga0070690_100000021
763 Ga0070690_100134088
764 Ga0070670_100026159
765 Ga0070670_100127659
766 Ga0070670_100203575
767 Ga0070670_100214157
768 Ga0070670_100227049
769 Ga0070670_100621881
770 Ga0070670_101220412
771 Ga0070677_10113251
772 Ga0068869_100002121
773 Ga0070666_10000004
774 Ga0070666_10018874
775 Ga0070666_10048933
776 Ga0070680_100113670
777 Ga0070680_100304120
778 Ga0070682_100070499
779 Ga0070682_100091012
780 Ga0070682_100338331
781 Ga0070682_100490420
782 Ga0068868_100192901
783 Ga0068868_100219703
784 Ga0068868_100310148
785 Ga0068868_100586607
786 Ga0070660_100002916
787 Ga0070660_100005333
788 Ga0070660_100041300
789 Ga0070660_100055623
790 Ga0070660_100113512
791 Ga0070660_100135960
792 Ga0070660_100221933
793 Ga0070660_100228896
794 Ga0070660_101257129
795 Ga0070660_101365799
796 Ga0070689_100024970
797 Ga0070689_100333899
798 Ga0070691_10460073
799 Ga0070661_100010886
800 Ga0070661_100076035
801 Ga0070661_100103201
802 Ga0070661_100166439
803 Ga0070661_100202437
804 Ga0070661_100304762
805 Ga0070661_100441305
806 Ga0070692_10018126
807 Ga0070692_10019433
808 Ga0070692_10691201
809 Ga0070668_100018530
810 Ga0070668_100031487
811 Ga0070668_100465940
812 Ga0070669_100000475
813 Ga0070669_100023051
814 Ga0070669_100024624
815 Ga0070675_100091703
816 Ga0070671_100021520
817 Ga0070671_100058838
818 Ga0070671_100390702
819 Ga0070674_100008949
820 Ga0070673_100000054
821 Ga0070673_100048389
822 Ga0070688_100022666
823 Ga0070659_100007541
824 Ga0070659_100010941
825 Ga0070659_100021273
826 Ga0070659_100092786
827 Ga0070659_100125663
828 Ga0070659_100213597
829 Ga0070659_100249556
830 Ga0070659_101484616
831 Ga0070667_100018468
832 Ga0070667_100112440
833 Ga0070667_100177513
834 Ga0070667_100195633
835 Ga0070667_100215262
836 Ga0070667_100463501
837 Ga0070714_100357982
838 Ga0070700_100988773
839 Ga0070663_100006700
840 Ga0070663_100015931
841 Ga0070663_100016936
842 Ga0070663_100051426
843 Ga0070663_100208412
844 Ga0070663_100333896
845 Ga0070663_100755482
846 Ga0070678_101541251
847 Ga0070662_100003794
848 Ga0070662_100014874
849 Ga0070662_100054688
850 Ga0070662_100121567
851 Ga0070662_100540503
852 Ga0070662_100641503
853 Ga0070662_100953238
854 Ga0070681_10076256
855 Ga0070681_10077824
856 Ga0070681_10217437
857 Ga0070681_10304397
858 Ga0070681_10387312
859 Ga0068867_100003158
860 Ga0068867_100111693
861 Ga0070685_10000388
862 Ga0070679_100033768
863 Ga0070679_100456390
864 Ga0070679_100810350
865 Ga0070679_101198021
866 Ga0070684_100009573
867 Ga0070684_100199805
868 Ga0070684_100823743
869 Ga0068853_100005583
870 Ga0068853_100019297
871 Ga0068853_100066021
872 Ga0068853_100093267
873 Ga0068853_100638748
874 Ga0070672_100000662
875 Ga0070686_100000012
876 Ga0070696_100039146
877 Ga0070693_100021079
878 Ga0070665_100000004
879 Ga0070665_100154236
880 Ga0068855_100057377
881 Ga0068855_100090918
882 Ga0068855_100097087
883 Ga0068855_100167544
884 Ga0068855_100483517
885 Ga0068855_101069958
886 Ga0068855_101488069
887 Ga0070664_100010008
888 Ga0070664_100011956
889 Ga0070664_100029990
890 Ga0070664_100094153
891 Ga0070664_100116654
892 Ga0068857_100004300
893 Ga0068857_100066257
894 Ga0068857_100069042
895 Ga0068857_100184685
896 Ga0068857_100199696
897 Ga0068857_100263085
898 Ga0068857_100389976
899 Ga0068854_100004284
900 Ga0068854_100010697
901 Ga0068854_100101130
902 Ga0068854_100149738
903 Ga0068854_100204052
904 Ga0068854_100294168
905 Ga0068854_100606702
906 Ga0068854_101681990
907 Ga0068856_100144812
908 Ga0068856_100245549
909 Ga0068856_100723375
910 Ga0068856_101306793
911 Ga0070702_100320430
912 Ga0068852_100007127
913 Ga0068852_100063051
914 Ga0068852_100064238
915 Ga0068852_100126435
916 Ga0068852_100368991
917 Ga0068852_100449047
918 Ga0068852_100805377
919 Ga0068859_100002194
920 Ga0068859_100006732
921 Ga0068859_100030043
922 Ga0068859_100795689
923 Ga0068859_101665713
924 Ga0068864_100004002
925 Ga0068864_100011898
926 Ga0068864_100130085
927 Ga0068864_100291844
928 Ga0068866_10027758
929 Ga0068861_100190229
930 Ga0068851_10025821
931 Ga0068851_10033197
932 Ga0068851_10050023
933 Ga0068851_10086129
934 Ga0068851_10098755
935 Ga0068851_10216693
936 Ga0068870_10398299
937 Ga0068863_100000013
938 Ga0068863_100007045
939 Ga0068863_100014207
940 Ga0068863_100053243
941 Ga0068858_100003085
942 Ga0068858_100004681
943 Ga0068858_100008938
944 Ga0068858_100011972
945 Ga0068858_101355437
946 Ga0068860_100000009
947 Ga0068860_100038118
948 Ga0068860_100083047
949 Ga0068860_100579824
950 Ga0068860_101451390
951 Ga0068862_100000209
952 Ga0068862_100019582
953 Ga0068862_100044045
954 Ga0068862_100452501
955 Ga0081539_10068482
956 Ga0070712_101135059
957 Ga0075362_10145827
958 Ga0068871_101316926
959 Ga0068865_100370845
960 Ga0097620_100002194
961 Ga0097620_100006731
962 Ga0097620_100030043
963 Ga0097620_100795665
964 Ga0097620_101665797
965 Ga0105251_10195707
966 Ga0105240_10152399
967 Ga0105240_11293247
968 Ga0105247_10046982
969 Ga0105243_10012952
970 Ga0105241_10018748
971 Ga0105241_10415187
972 Ga0105241_10823792
973 Ga0105242_10912879
974 Ga0105248_10000734
975 Ga0105248_10144357
976 Ga0105237_10047879
977 Ga0105237_10604337
978 Ga0105238_10135959
979 Ga0105238_10154313
980 Ga0105238_10231241
981 Ga0105249_10000006
982 Ga0105239_10137153
983 Ga0105246_10015101
984 Ga0105246_10111916
985 Ga0157373_10016294
986 Ga0157373_10027977
987 Ga0157373_10083310
988 Ga0157373_10134156
989 Ga0157373_10138597
990 Ga0157373_10203659
991 Ga0157373_10204630
992 Ga0157373_10348518
993 Ga0157371_10008527
994 Ga0157371_10105278
995 Ga0157371_10165325
996 Ga0157371_10248968
997 Ga0157371_10258532
998 Ga0157370_10029153
999 Ga0157370_10041135
1000 Ga0157370_10065820
1001 Ga0157370_10260998
1002 Ga0157369_10047501
1003 Ga0157369_10082315
1004 Ga0157369_10420825
1005 Ga0157369_10689767
1006 Ga0157374_11072481
1007 Ga0157374_11858307
1008 Ga0157378_10000385
1009 Ga0163162_10095116
1010 Ga0163162_11109387
1011 Ga0157372_10258948
1012 Ga0157372_10333510
1013 Ga0157372_10438904
1014 Ga0157372_10657181
1015 Ga0157372_11784506
1016 Ga0157372_12071578
1017 Ga0163163_10269560
1018 Ga0163163_12770181
1019 Ga0157380_10000182
1020 Ga0182008_10274703
1021 Ga0182008_10659420
1022 Ga0157379_10153468
1023 Ga0163161_10000101
1024 Ga0207672_1000247
1025 Ga0207697_10001196
1026 Ga0207656_10005761
1027 Ga0207656_10057162
1028 Ga0207656_10094353
1029 Ga0207656_10106279
1030 Ga0207682_10161370
1031 Ga0207642_10213303
1032 Ga0207710_10038414
1033 Ga0207710_10188914
1034 Ga0207688_10005303
1035 Ga0207680_10000010
1036 Ga0207680_10144206
1037 Ga0207647_10003861
1038 Ga0207647_10015108
1039 Ga0207647_10031747
1040 Ga0207647_10037339
1041 Ga0207647_10044036
1042 Ga0207647_10063695
1043 Ga0207647_10078027
1044 Ga0207647_10129971
1045 Ga0207647_10246073
1046 Ga0207645_10006757
1047 Ga0207645_10010932
1048 Ga0207645_10011850
1049 Ga0207645_10323674
1050 Ga0207643_10544915
1051 Ga0207705_10000853
1052 Ga0207705_10010637
1053 Ga0207705_10025542
1054 Ga0207705_10040163
1055 Ga0207705_10105202
1056 Ga0207705_10353522
1057 Ga0207705_10643107
1058 Ga0207705_10954206
1059 Ga0207705_10997379
1060 Ga0207654_10002849
1061 Ga0207707_10373105
1062 Ga0207707_10374131
1063 Ga0207707_10798952
1064 Ga0207695_10081929
1065 Ga0207695_10335069
1066 Ga0207671_10002150
1067 Ga0207663_10304213
1068 Ga0207660_10010098
1069 Ga0207660_10150839
1070 Ga0207660_10291266
1071 Ga0207657_10006863
1072 Ga0207657_10013608
1073 Ga0207657_10014626
1074 Ga0207657_10022348
1075 Ga0207657_10059993
1076 Ga0207657_10072538
1077 Ga0207657_10076614
1078 Ga0207657_10080804
1079 Ga0207657_10147331
1080 Ga0207657_10223048
1081 Ga0207657_10267637
1082 Ga0207657_10365635
1083 Ga0207657_10851213
1084 Ga0207649_10063461
1085 Ga0207649_10082722
1086 Ga0207649_10312605
1087 Ga0207649_10775748
1088 Ga0207652_10009067
1089 Ga0207652_10229422
1090 Ga0207652_10232300
1091 Ga0207652_10367050
1092 Ga0207681_10000183
1093 Ga0207681_10000837
1094 Ga0207681_10022424
1095 Ga0207694_10013396
1096 Ga0207694_10014268
1097 Ga0207694_10105726
1098 Ga0207694_10140227
1099 Ga0207694_10211203
1100 Ga0207650_10056392
1101 Ga0207650_10379077
1102 Ga0207650_10929043
1103 Ga0207659_10039297
1104 Ga0207659_10090598
1105 Ga0207687_10041900
1106 Ga0207687_10242113
1107 Ga0207644_10009011
1108 Ga0207644_10390360
1109 Ga0207690_10004904
1110 Ga0207690_10008921
1111 Ga0207690_10048664
1112 Ga0207690_10076699
1113 Ga0207690_10093029
1114 Ga0207690_10106849
1115 Ga0207690_10301849
1116 Ga0207690_10314564
1117 Ga0207690_10989297
1118 Ga0207690_11008615
1119 Ga0207706_10006510
1120 Ga0207706_10017971
1121 Ga0207706_10030874
1122 Ga0207706_10116307
1123 Ga0207706_10181899
1124 Ga0207706_10234825
1125 Ga0207706_10500823
1126 Ga0207706_10502239
1127 Ga0207706_10872805
1128 Ga0207706_11690193
1129 Ga0207709_10081973
1130 Ga0207670_10066832
1131 Ga0207670_10294517
1132 Ga0207669_10085830
1133 Ga0207704_10021708
1134 Ga0207704_10591497
1135 Ga0207691_10013722
1136 Ga0207711_10009860
1137 Ga0207711_10082654
1138 Ga0207689_10003528
1139 Ga0207661_11807996
1140 Ga0207679_10020031
1141 Ga0207679_10025974
1142 Ga0207679_10172881
1143 Ga0207679_10189629
1144 Ga0207679_11155310
1145 Ga0207667_10025213
1146 Ga0207667_10086190
1147 Ga0207667_10120112
1148 Ga0207667_10137642
1149 Ga0207667_10248299
1150 Ga0207667_10495135
1151 Ga0207667_10503670
1152 Ga0207667_10748826
1153 Ga0207667_10811612
1154 Ga0207667_11370339
1155 Ga0207651_10017017
1156 Ga0207712_10000014
1157 Ga0207668_10011675
1158 Ga0207668_10185961
1159 Ga0207668_10361033
1160 Ga0207640_10007845
1161 Ga0207640_10023016
1162 Ga0207640_10125514
1163 Ga0207640_10156573
1164 Ga0207640_10166583
1165 Ga0207640_10170973
1166 Ga0207640_11317943
1167 Ga0207658_10000739
1168 Ga0207658_10009550
1169 Ga0207658_10491540
1170 Ga0207658_11042819
1171 Ga0207677_10012887
1172 Ga0207677_10063883
1173 Ga0207677_10154084
1174 Ga0207703_10000985
1175 Ga0207703_10014035
1176 Ga0207703_10016769
1177 Ga0207703_10041642
1178 Ga0207639_10002096
1179 Ga0207639_10023116
1180 Ga0207639_10053144
1181 Ga0207639_10154448
1182 Ga0207639_10185956
1183 Ga0207639_10252939
1184 Ga0207639_10268793
1185 Ga0207678_10014746
1186 Ga0207678_10015371
1187 Ga0207678_10049714
1188 Ga0207678_10066320
1189 Ga0207678_10158708
1190 Ga0207678_10298185
1191 Ga0207702_10005432
1192 Ga0207702_10018861
1193 Ga0207702_10114945
1194 Ga0207702_10585065
1195 Ga0207702_10850598
1196 Ga0207702_11040948
1197 Ga0207641_10000099
1198 Ga0207641_10006633
1199 Ga0207641_10022752
1200 Ga0207648_10007186
1201 Ga0207676_10004316
1202 Ga0207676_10014654
1203 Ga0207676_10016807
1204 Ga0207676_10769556
1205 Ga0207674_10006137
1206 Ga0207674_10008725
1207 Ga0207674_10012558
1208 Ga0207674_10040610
1209 Ga0207674_10097238
1210 Ga0207674_10142146
1211 Ga0207674_10158194
1212 Ga0207674_10355228
1213 Ga0207674_10881153
1214 Ga0207675_100001918
1215 Ga0207675_100070792
1216 Ga0207683_11096335
1217 Ga0207698_10007378
1218 Ga0207698_10073726
1219 Ga0207698_10274021
1220 Ga0207698_10293431
1221 Ga0207698_10369944
1222 Ga0207698_10442579
1223 Ga0207698_10449195
1224 Ga0207698_10770303
1225 Ga0207698_10915347
1226 Ga0268266_10000009
1227 Ga0268266_10036375
1228 Ga0268266_10053575
1229 Ga0268266_11505594
1230 Ga0268265_10000047
1231 Ga0268265_10002288
1232 Ga0268265_10230337
1233 Ga0268265_10330897
1234 Ga0268264_10000023
1235 Ga0268264_10008874
1236 Ga0268264_10048773
1237 Ga0268264_10543352
1238 Ga0307408_100037753
1239 Ga0307408_100058616
1240 Ga0307408_100967791
1241 Ga0307405_10016316
1242 Ga0307405_10054214
1243 Ga0307405_10110489
1244 Ga0307405_10235387
1245 Ga0307413_10087233
1246 Ga0307413_10185634
1247 Ga0307410_10061161
1248 Ga0307406_10051414
1249 Ga0307406_10265686
1250 Ga0307406_10691408
1251 Ga0307406_11488084
1252 Ga0307406_11684500
1253 Ga0307407_10003974
1254 Ga0307407_10055682
1255 Ga0307407_10488424
1256 Ga0307409_100006010
1257 Ga0307409_100100992
1258 Ga0307409_101354004
1259 Ga0307416_100009204
1260 Ga0307416_100077987
1261 Ga0307416_100556011
1262 Ga0307414_10099214
1263 Ga0307414_11363588
1264 Ga0307411_10014955
1265 Ga0307411_10148141
1266 Ga0307411_10338586
1267 Ga0307415_100001510
1268 Ga0307415_100001605
1269 Ga0307415_100554186
1270 Ga0307415_101079215
1271 Ga0373943_0001968
1272 Ga0373946_0001564
1273 Ga0373927_0014491
1274 Ga0373925_0081955
1275 Ga0395899_0010997
1276 Ga0395899_0011491
1277 Ga0395899_0028954
1278 Ga0395899_0044155
1279 Ga0395899_0592265
1280 Ga0395900_0008433
1281 Ga0395900_0009176
1282 Ga0395900_0021034
1283 Ga0395900_0021542
1284 Ga0395900_0037468
1285 Ga0395900_0046161
1286 Ga0395900_0082818
1287 Ga0395900_0094609
1288 Ga0395900_0139432
1289 Ga0395900_0155326
1290 Ga0395900_0185836
1291 Ga0395900_0201274
1292 Ga0395900_0245969
1293 Ga0395900_0281606
1294 Ga0395900_0290401
1295 Ga0395900_0296296
1296 Ga0395900_0351486
1297 Ga0395900_0359944
1298 Ga0395900_0385951
1299 Ga0395900_0409914
1300 Ga0395900_0583545
1301 Ga0395900_0841062
1302 Ga0395900_1225155
1303 Ga0395898_0009943
1304 Ga0395898_0023445
1305 Ga0395898_0080373
1306 Ga0395898_0081294
1307 Ga0395898_0140030
1308 Ga0395898_0145201
1309 Ga0395898_0193377
1310 Ga0395898_0207143
1311 Ga0395898_0210440
1312 Ga0395898_0225701
1313 Ga0395898_0240770
1314 Ga0395898_0313133
1315 Ga0395898_0323480
1316 Ga0395898_0377889
1317 Ga0395898_0521698
1318 Ga0395898_0656925
1319 Ga0395905_0001939
1320 Ga0395905_0005920
1321 Ga0395905_0006816
1322 Ga0395905_0008208
1323 Ga0395905_0020979
1324 Ga0395905_0022898
1325 Ga0395905_0027424
1326 Ga0395905_0035354
1327 Ga0395905_0035655
1328 Ga0395905_0037759
1329 Ga0395905_0041452
1330 Ga0395905_0072140
1331 Ga0395905_0089372
1332 Ga0395905_0090087
1333 Ga0395905_0122440
1334 Ga0395905_0212251
1335 Ga0395905_0284058
1336 Ga0395905_0299881
1337 Ga0395905_0349400
1338 Ga0395905_0465375
1339 Ga0395905_0534411
1340 Ga0395905_0791027
1341 Ga0395905_0831978
1342 Ga0395905_1547780
1343 Ga0395901_0014172
1344 Ga0395901_0015583
1345 Ga0395901_0015672
1346 Ga0395901_0020567
1347 Ga0395901_0025737
1348 Ga0395901_0032774
1349 Ga0395901_0039704
1350 Ga0395901_0086094
1351 Ga0395901_0091500
1352 Ga0395901_0105240
1353 Ga0395901_0126280
1354 Ga0395901_0169743
1355 Ga0395901_0251915
1356 Ga0395901_0300304
1357 Ga0395901_0339712
1358 Ga0395901_0534087
1359 Ga0395901_0685706
1360 Ga0395901_0846505
1361 Ga0395901_0950685
1362 Ga0395901_0999469
1363 Ga0395901_1034294
1364 Ga0395901_1266260
1365 Ga0439464_0008383
1366 Ga0466972_0139898
1367 Ga0466965_0202724
1368 Ga0466966_0200409
1369 Ga0466961_0035122
1370 Ga0466961_0081349
1371 Ga0466961_0197816
1372 Ga0466963_0007693
1373 Ga0466963_0292809
1374 Ga0466964_0050904
1375 Ga0466971_0037974
1376 Ga0466971_0243909
1377 Ga0466968_0020552
1378 Ga0466970_0182193
1379 Ga0466970_0676844
1380 Ga0466957_0008566
1381 Ga0466957_0047594
1382 Ga0466957_0106764
1383 Ga0466957_0449741
1384 Ga0466957_0546067
1385 Ga0466959_0112343
1386 Ga0466958_0031748
1387 Ga0466958_0041702
1388 Ga0466958_0263435
1389 Ga0466958_1172471
1390 Ga0466967_0001147
1391 Ga0466967_0024434
1392 Ga0466967_0192426
1393 Ga0466967_1172183
1394 Ga0495582_0531031
1395 Ga0495663_0063721
1396 Ga0495669_0008236
1397 Ga0495669_0017245
1398 Ga0495677_0046140
1399 Ga0496100_0339554
1400 Ga0496100_1163761
1401 Ga0496102_0002875
1402 Ga0496103_0001237
1403 Ga0496104_0070332
1404 Ga0496105_0328741
1405 Ga0496106_0129220
1406 Ga0496106_0637882
1407 Ga0496107_0196733
1408 Ga0496107_0749087
1409 Ga0496117_0004454
1410 Ga0496118_0018945
1411 Ga0496125_0261589
1412 Ga0501067_0254802
1413 Ga0501069_0084736
1414 Ga0501202_022182
1415 Ga0501209_164879
1416 Ga0501223_050241
1417 Ga0501233_038811
1418 Ga0501240_018859
1419 Ga0501249_028470
1420 Ga0501250_035618
1421 Ga0501225_0054811
1422 Ga0501268_005552
1423 Ga0501270_032479
1424 Ga0501270_038132
1425 Ga0500566_0198508
1426 Ga0500604_0000124
1427 Ga0500622_0177891
1428 Ga0466962_0006197
1429 Ga0466962_0033150
1430 Ga0466962_0268420

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06718

DUF1203

Protein of unknown function (DUF1203)

66

181

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1yd6-assembly1.cif.gz_D crystal structure of the giy-yig n-terminal endonuclease domain of uvrc from bacillus caldotenax 0.7174 95 146
1yd6-assembly1.cif.gz_B crystal structure of the giy-yig n-terminal endonuclease domain of uvrc from bacillus caldotenax 0.6851 95 130
7s6h-assembly2.cif.gz_C human parp1 deltav687-e688 bound to nad+ analog eb-47 and to a dna double strand break. 0.6451 29 77
7s6h-assembly1.cif.gz_A human parp1 deltav687-e688 bound to nad+ analog eb-47 and to a dna double strand break. 0.645 29 77
5hy3-assembly1.cif.gz_B crystal structure of escherichia coli toxin lsoa in complex with t4 phage antitoxin dmd 0.6167 98 155
ID Description Score Start End Superfamily
af_Q2FZD0_4_102_3.40.1440.10 Alpha Beta;3-Layer(aba) Sandwich;GIY-YIG endonuclease;GIY-YIG endonuclease 0.7588 95 144 3.40.1440.10
1yd6B00 Alpha Beta;3-Layer(aba) Sandwich;GIY-YIG endonuclease;GIY-YIG endonuclease 0.6851 95 130 3.40.1440.10
af_Q8I4S6_53_187_3.30.1740.10 Alpha Beta;2-Layer Sandwich;first zn-finger domain of poly(adp-ribose) polymerase-1;Zinc finger, PARP-type 0.6779 29 77 3.30.1740.10
af_Q4E4N3_21_114_3.30.1740.10 Alpha Beta;2-Layer Sandwich;first zn-finger domain of poly(adp-ribose) polymerase-1;Zinc finger, PARP-type 0.667 29 77 3.30.1740.10
af_Q54XI2_1_101_3.30.1740.10 Alpha Beta;2-Layer Sandwich;first zn-finger domain of poly(adp-ribose) polymerase-1;Zinc finger, PARP-type 0.653 29 77 3.30.1740.10
ID Description Score Start End GO Terms
AF-A0A2D8AXD9-F1-model_v4 DUF1203 domain-containing protein 0.9879 1 155
AF-A0A7G9SCH6-F1-model_v4 DUF1203 domain-containing protein 0.9867 1 155
AF-A0A4U5JLN4-F1-model_v4 DUF1203 domain-containing protein 0.9837 1 155
AF-A0A840Y001-F1-model_v4 deleted 0.9837 1 155
AF-A0A4S1XEZ5-F1-model_v4 DUF1203 domain-containing protein 0.9836 1 155

Map