F476950
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 714 | 243 | 714 | 113 |
Family's Representative Sequence
| Representative Sequence | 3300031241|Ga0265325_10014465|Ga0265325_100144654 |
| Length | 121 |
| Sequence | VKDMTQSVAPADFVAAVKFDERGLVPVIAQRHAGGEVLMLAWMTRQTLETTLASGEVTYWSRSRQQVWRKGETSGHTQRLVEALLDCDGDVVLLKVDQLGPACHTGAPTCFFRKLVRNPAV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 2 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 3 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 34 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 39 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 40 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 41 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 42 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 44 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 45 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 46 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 47 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 48 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 49 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 50 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 51 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 55 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 56 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 83 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 84 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 139 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 140 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 141 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 142 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 143 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 144 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 145 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 146 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 147 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 148 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 149 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 150 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 151 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 152 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 153 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 154 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 155 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 156 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 157 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 158 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 159 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 160 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 161 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 162 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 163 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 164 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 165 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 166 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 167 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 168 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 169 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 170 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 198 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 199 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 200 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 201 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 202 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 204 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 205 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 206 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 207 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 208 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 209 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 210 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 211 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 212 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 213 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 215 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 216 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 217 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 218 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 219 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 220 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 222 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 232 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 233 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 234 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 235 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 236 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 237 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 238 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 239 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 240 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 241 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 242 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.94 |
| Nodule | 0 |
| Rhizoplane | 0.56 |
| Rhizosphere | 94.96 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.54 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25165J46597_1000003 | 3300003214 | Bacteria | 694080 |
| 2 | JGI25153J46596_10025344 | 3300003215 | Bacteria | 2121 |
| 3 | rootH1_10164083 | 3300003323 | Bacteria | 1373 |
| 4 | Ga0070658_10029983 | 3300005327 | Bacteria | 4371 |
| 5 | Ga0070658_10035662 | 3300005327 | Bacteria | 4007 |
| 6 | Ga0070658_10043261 | 3300005327 | Bacteria | 3638 |
| 7 | Ga0070658_10135283 | 3300005327 | Bacteria | 2056 |
| 8 | Ga0070658_10148879 | 3300005327 | Bacteria | 1959 |
| 9 | Ga0070658_10481462 | 3300005327 | Bacteria | 1071 |
| 10 | Ga0070658_10639878 | 3300005327 | Bacteria | 922 |
| 11 | Ga0070658_10961002 | 3300005327 | Bacteria | 743 |
| 12 | Ga0070658_11147791 | 3300005327 | Bacteria | 676 |
| 13 | Ga0070658_11448389 | 3300005327 | Bacteria | 596 |
| 14 | Ga0070658_11669325 | 3300005327 | Bacteria | 552 |
| 15 | Ga0070676_10042600 | 3300005328 | Bacteria | 2637 |
| 16 | Ga0070676_10607215 | 3300005328 | Bacteria | 790 |
| 17 | Ga0070676_11235293 | 3300005328 | Bacteria | 569 |
| 18 | Ga0070683_100279601 | 3300005329 | Bacteria | 1588 |
| 19 | Ga0070670_100388921 | 3300005331 | Bacteria | 1229 |
| 20 | Ga0070677_10174966 | 3300005333 | Bacteria | 1018 |
| 21 | Ga0070677_10406561 | 3300005333 | Bacteria | 719 |
| 22 | Ga0068869_100200670 | 3300005334 | Bacteria | 1573 |
| 23 | Ga0068869_100209167 | 3300005334 | Bacteria | 1542 |
| 24 | Ga0068869_100422006 | 3300005334 | Bacteria | 1101 |
| 25 | Ga0068869_100468796 | 3300005334 | Bacteria | 1047 |
| 26 | Ga0070666_10041648 | 3300005335 | Bacteria | 3070 |
| 27 | Ga0070666_10589663 | 3300005335 | Bacteria | 811 |
| 28 | Ga0070680_100230057 | 3300005336 | Bacteria | 1566 |
| 29 | Ga0070680_100363452 | 3300005336 | Bacteria | 1231 |
| 30 | Ga0068868_100014115 | 3300005338 | Bacteria | 5881 |
| 31 | Ga0068868_100054692 | 3300005338 | Bacteria | 3147 |
| 32 | Ga0068868_100060392 | 3300005338 | Bacteria | 3001 |
| 33 | Ga0070660_100071191 | 3300005339 | Bacteria | 2715 |
| 34 | Ga0070660_100081619 | 3300005339 | Bacteria | 2538 |
| 35 | Ga0070660_100216857 | 3300005339 | Bacteria | 1554 |
| 36 | Ga0070691_10858314 | 3300005341 | Bacteria | 557 |
| 37 | Ga0070661_100002706 | 3300005344 | Bacteria | 12147 |
| 38 | Ga0070661_100466262 | 3300005344 | Bacteria | 1007 |
| 39 | Ga0070661_101623830 | 3300005344 | Bacteria | 547 |
| 40 | Ga0070668_101919655 | 3300005347 | Bacteria | 545 |
| 41 | Ga0070675_100043761 | 3300005354 | Bacteria | 3660 |
| 42 | Ga0070675_100370264 | 3300005354 | Bacteria | 1273 |
| 43 | Ga0070675_100752543 | 3300005354 | Bacteria | 889 |
| 44 | Ga0070671_100310698 | 3300005355 | Bacteria | 1343 |
| 45 | Ga0070674_100579917 | 3300005356 | Bacteria | 945 |
| 46 | Ga0070673_100086851 | 3300005364 | Bacteria | 2549 |
| 47 | Ga0070673_101587734 | 3300005364 | Bacteria | 618 |
| 48 | Ga0070659_100415021 | 3300005366 | Bacteria | 1138 |
| 49 | Ga0070659_100494505 | 3300005366 | Bacteria | 1042 |
| 50 | Ga0070659_101604327 | 3300005366 | Bacteria | 581 |
| 51 | Ga0070667_100159468 | 3300005367 | Bacteria | 1986 |
| 52 | Ga0070667_100485173 | 3300005367 | Unclassified | 1132 |
| 53 | Ga0070667_101655773 | 3300005367 | Bacteria | 602 |
| 54 | Ga0070667_102086695 | 3300005367 | Bacteria | 534 |
| 55 | Ga0070714_100014744 | 3300005435 | Bacteria | 6282 |
| 56 | Ga0070701_10381955 | 3300005438 | Bacteria | 888 |
| 57 | Ga0070701_10691596 | 3300005438 | Bacteria | 685 |
| 58 | Ga0070711_101004583 | 3300005439 | Bacteria | 716 |
| 59 | Ga0070700_100973038 | 3300005441 | Bacteria | 696 |
| 60 | Ga0070678_100014122 | 3300005456 | Bacteria | 5029 |
| 61 | Ga0070678_100017757 | 3300005456 | Bacteria | 4590 |
| 62 | Ga0070678_100112436 | 3300005456 | Bacteria | 2133 |
| 63 | Ga0070678_100115106 | 3300005456 | Bacteria | 2111 |
| 64 | Ga0070662_100967540 | 3300005457 | Bacteria | 728 |
| 65 | Ga0070681_10103979 | 3300005458 | Bacteria | 2783 |
| 66 | Ga0070681_10181799 | 3300005458 | Bacteria | 2024 |
| 67 | Ga0070681_10270181 | 3300005458 | Bacteria | 1612 |
| 68 | Ga0068867_100012470 | 3300005459 | Bacteria | 6016 |
| 69 | Ga0068867_100538324 | 3300005459 | Bacteria | 1010 |
| 70 | Ga0070679_100011831 | 3300005530 | Bacteria | 8323 |
| 71 | Ga0070679_100060211 | 3300005530 | Bacteria | 3784 |
| 72 | Ga0070679_100062116 | 3300005530 | Bacteria | 3723 |
| 73 | Ga0070679_100687497 | 3300005530 | Bacteria | 966 |
| 74 | Ga0070679_102083855 | 3300005530 | Bacteria | 517 |
| 75 | Ga0070684_100507155 | 3300005535 | Bacteria | 1118 |
| 76 | Ga0070684_101456157 | 3300005535 | Bacteria | 645 |
| 77 | Ga0068853_100448166 | 3300005539 | Unclassified | 1214 |
| 78 | Ga0068853_100502379 | 3300005539 | Bacteria | 1145 |
| 79 | Ga0068853_100747067 | 3300005539 | Bacteria | 935 |
| 80 | Ga0068853_100893384 | 3300005539 | Bacteria | 853 |
| 81 | Ga0070672_100199525 | 3300005543 | Bacteria | 1673 |
| 82 | Ga0070696_101229123 | 3300005546 | Bacteria | 634 |
| 83 | Ga0070693_100348657 | 3300005547 | Bacteria | 1013 |
| 84 | Ga0070693_100945245 | 3300005547 | Bacteria | 649 |
| 85 | Ga0070665_100007050 | 3300005548 | Bacteria | 11419 |
| 86 | Ga0070665_100027566 | 3300005548 | Bacteria | 5721 |
| 87 | Ga0070665_100061341 | 3300005548 | Bacteria | 3769 |
| 88 | Ga0070665_100061584 | 3300005548 | Bacteria | 3762 |
| 89 | Ga0070665_100218252 | 3300005548 | Bacteria | 1907 |
| 90 | Ga0070665_100534927 | 3300005548 | Bacteria | 1184 |
| 91 | Ga0070665_100862085 | 3300005548 | Bacteria | 919 |
| 92 | Ga0070665_101106517 | 3300005548 | Unclassified | 804 |
| 93 | Ga0068855_100000022 | 3300005563 | Bacteria | 190807 |
| 94 | Ga0068855_100021219 | 3300005563 | Bacteria | 7786 |
| 95 | Ga0068855_100022754 | 3300005563 | Bacteria | 7510 |
| 96 | Ga0068855_100102622 | 3300005563 | Bacteria | 3292 |
| 97 | Ga0068855_100215457 | 3300005563 | Bacteria | 2156 |
| 98 | Ga0068855_100891055 | 3300005563 | Bacteria | 940 |
| 99 | Ga0068855_100994498 | 3300005563 | Bacteria | 881 |
| 100 | Ga0068857_100036127 | 3300005577 | Bacteria | 4378 |
| 101 | Ga0068857_100049344 | 3300005577 | Bacteria | 3734 |
| 102 | Ga0068857_100740445 | 3300005577 | Bacteria | 936 |
| 103 | Ga0068857_101045493 | 3300005577 | Bacteria | 787 |
| 104 | Ga0068854_101031648 | 3300005578 | Bacteria | 730 |
| 105 | Ga0068856_100053489 | 3300005614 | Bacteria | 3981 |
| 106 | Ga0068856_100698264 | 3300005614 | Bacteria | 1035 |
| 107 | Ga0068856_100908069 | 3300005614 | Bacteria | 899 |
| 108 | Ga0068856_101500491 | 3300005614 | Bacteria | 688 |
| 109 | Ga0068856_101738171 | 3300005614 | Bacteria | 636 |
| 110 | Ga0070702_101130285 | 3300005615 | Bacteria | 628 |
| 111 | Ga0068852_100112097 | 3300005616 | Bacteria | 2481 |
| 112 | Ga0068852_100285476 | 3300005616 | Bacteria | 1592 |
| 113 | Ga0068852_100769561 | 3300005616 | Bacteria | 976 |
| 114 | Ga0068852_102142351 | 3300005616 | Bacteria | 581 |
| 115 | Ga0068859_100257553 | 3300005617 | Bacteria | 1836 |
| 116 | Ga0068864_100575673 | 3300005618 | Bacteria | 1091 |
| 117 | Ga0068866_10032314 | 3300005718 | Bacteria | 2530 |
| 118 | Ga0068863_100241410 | 3300005841 | Bacteria | 1744 |
| 119 | Ga0068863_101526983 | 3300005841 | Bacteria | 677 |
| 120 | Ga0068858_100027187 | 3300005842 | Bacteria | 5315 |
| 121 | Ga0068858_100511348 | 3300005842 | Bacteria | 1161 |
| 122 | Ga0068858_101674705 | 3300005842 | Bacteria | 628 |
| 123 | Ga0068860_100172001 | 3300005843 | Bacteria | 2092 |
| 124 | Ga0068860_100342271 | 3300005843 | Bacteria | 1470 |
| 125 | Ga0068862_101238802 | 3300005844 | Bacteria | 746 |
| 126 | Ga0068862_102225765 | 3300005844 | Bacteria | 560 |
| 127 | Ga0070717_10766284 | 3300006028 | Bacteria | 877 |
| 128 | Ga0070712_100140201 | 3300006175 | Bacteria | 1844 |
| 129 | Ga0097621_100000101 | 3300006237 | Bacteria | 48184 |
| 130 | Ga0097621_100011653 | 3300006237 | Bacteria | 6485 |
| 131 | Ga0097621_100034035 | 3300006237 | Bacteria | 4062 |
| 132 | Ga0097621_100058087 | 3300006237 | Bacteria | 3165 |
| 133 | Ga0097621_100227440 | 3300006237 | Bacteria | 1628 |
| 134 | Ga0097621_100468125 | 3300006237 | Bacteria | 1138 |
| 135 | Ga0097621_100765146 | 3300006237 | Bacteria | 893 |
| 136 | Ga0097621_100894469 | 3300006237 | Bacteria | 827 |
| 137 | Ga0097621_101761505 | 3300006237 | Bacteria | 590 |
| 138 | Ga0068871_100000360 | 3300006358 | Bacteria | 31821 |
| 139 | Ga0068871_100019146 | 3300006358 | Bacteria | 5223 |
| 140 | Ga0068871_100029042 | 3300006358 | Bacteria | 4341 |
| 141 | Ga0068871_100081673 | 3300006358 | Unclassified | 2678 |
| 142 | Ga0068871_100467383 | 3300006358 | Bacteria | 1133 |
| 143 | Ga0068871_100790603 | 3300006358 | Unclassified | 874 |
| 144 | Ga0068871_101715783 | 3300006358 | Bacteria | 596 |
| 145 | Ga0068865_100170333 | 3300006881 | Bacteria | 1669 |
| 146 | Ga0068865_100442877 | 3300006881 | Bacteria | 1072 |
| 147 | Ga0068865_100447088 | 3300006881 | Bacteria | 1068 |
| 148 | Ga0097620_100257539 | 3300006931 | Bacteria | 1836 |
| 149 | Ga0105240_10024685 | 3300009093 | Bacteria | 7918 |
| 150 | Ga0105240_10123496 | 3300009093 | Bacteria | 3115 |
| 151 | Ga0105240_10124554 | 3300009093 | Bacteria | 3099 |
| 152 | Ga0105240_10131546 | 3300009093 | Bacteria | 3001 |
| 153 | Ga0105240_10207074 | 3300009093 | Bacteria | 2295 |
| 154 | Ga0105240_10290960 | 3300009093 | Bacteria | 1873 |
| 155 | Ga0105240_10341823 | 3300009093 | Bacteria | 1700 |
| 156 | Ga0105240_10402244 | 3300009093 | Unclassified | 1542 |
| 157 | Ga0105240_10403867 | 3300009093 | Bacteria | 1538 |
| 158 | Ga0105240_10641919 | 3300009093 | Bacteria | 1165 |
| 159 | Ga0105240_11507777 | 3300009093 | Bacteria | 705 |
| 160 | Ga0105240_11697760 | 3300009093 | Bacteria | 659 |
| 161 | Ga0105240_11963312 | 3300009093 | Bacteria | 608 |
| 162 | Ga0105245_10006665 | 3300009098 | Bacteria | 10134 |
| 163 | Ga0105245_10154755 | 3300009098 | Bacteria | 2171 |
| 164 | Ga0105245_10175333 | 3300009098 | Unclassified | 2044 |
| 165 | Ga0105245_10341064 | 3300009098 | Bacteria | 1482 |
| 166 | Ga0105245_10420102 | 3300009098 | Bacteria | 1340 |
| 167 | Ga0105245_10426352 | 3300009098 | Bacteria | 1330 |
| 168 | Ga0105245_12043017 | 3300009098 | Bacteria | 627 |
| 169 | Ga0105247_10283648 | 3300009101 | Bacteria | 1143 |
| 170 | Ga0105247_10487831 | 3300009101 | Bacteria | 895 |
| 171 | Ga0105243_10008539 | 3300009148 | Bacteria | 7860 |
| 172 | Ga0105243_10159370 | 3300009148 | Bacteria | 1944 |
| 173 | Ga0105243_10796742 | 3300009148 | Bacteria | 931 |
| 174 | Ga0105241_10007579 | 3300009174 | Bacteria | 7979 |
| 175 | Ga0105241_10128100 | 3300009174 | Bacteria | 2052 |
| 176 | Ga0105241_10294921 | 3300009174 | Bacteria | 1390 |
| 177 | Ga0105241_10310645 | 3300009174 | Bacteria | 1356 |
| 178 | Ga0105241_10663084 | 3300009174 | Bacteria | 949 |
| 179 | Ga0105241_11110554 | 3300009174 | Bacteria | 745 |
| 180 | Ga0105241_11793913 | 3300009174 | Bacteria | 599 |
| 181 | Ga0105242_10044925 | 3300009176 | Bacteria | 3578 |
| 182 | Ga0105242_10089847 | 3300009176 | Bacteria | 2583 |
| 183 | Ga0105242_10284489 | 3300009176 | Bacteria | 1503 |
| 184 | Ga0105242_10683239 | 3300009176 | Unclassified | 1002 |
| 185 | Ga0105242_10795438 | 3300009176 | Bacteria | 936 |
| 186 | Ga0105242_11074991 | 3300009176 | Bacteria | 817 |
| 187 | Ga0105242_11109514 | 3300009176 | Bacteria | 806 |
| 188 | Ga0105248_10011629 | 3300009177 | Bacteria | 9695 |
| 189 | Ga0105248_10656158 | 3300009177 | Bacteria | 1184 |
| 190 | Ga0105248_10984467 | 3300009177 | Bacteria | 953 |
| 191 | Ga0105248_11113255 | 3300009177 | Bacteria | 893 |
| 192 | Ga0105248_11439785 | 3300009177 | Bacteria | 780 |
| 193 | Ga0105248_11463128 | 3300009177 | Bacteria | 773 |
| 194 | Ga0105248_12312329 | 3300009177 | Bacteria | 612 |
| 195 | Ga0105237_10006194 | 3300009545 | Bacteria | 13347 |
| 196 | Ga0105237_10081506 | 3300009545 | Bacteria | 3227 |
| 197 | Ga0105237_10221318 | 3300009545 | Unclassified | 1893 |
| 198 | Ga0105237_10306422 | 3300009545 | Unclassified | 1591 |
| 199 | Ga0105237_10603930 | 3300009545 | Bacteria | 1104 |
| 200 | Ga0105238_10021159 | 3300009551 | Bacteria | 6630 |
| 201 | Ga0105238_10026274 | 3300009551 | Bacteria | 5934 |
| 202 | Ga0105238_10027761 | 3300009551 | Bacteria | 5769 |
| 203 | Ga0105238_10054332 | 3300009551 | Bacteria | 4023 |
| 204 | Ga0105238_10101025 | 3300009551 | Bacteria | 2867 |
| 205 | Ga0105238_10163931 | 3300009551 | Bacteria | 2198 |
| 206 | Ga0105238_10333807 | 3300009551 | Bacteria | 1503 |
| 207 | Ga0105238_10347896 | 3300009551 | Bacteria | 1471 |
| 208 | Ga0105238_10360848 | 3300009551 | Bacteria | 1442 |
| 209 | Ga0105238_11679978 | 3300009551 | Bacteria | 666 |
| 210 | Ga0105238_12652998 | 3300009551 | Bacteria | 537 |
| 211 | Ga0105238_12977158 | 3300009551 | Unclassified | 509 |
| 212 | Ga0105249_10022197 | 3300009553 | Bacteria | 5685 |
| 213 | Ga0105249_10643043 | 3300009553 | Bacteria | 1118 |
| 214 | Ga0105239_10000773 | 3300010375 | Bacteria | 45320 |
| 215 | Ga0105239_10005761 | 3300010375 | Bacteria | 14452 |
| 216 | Ga0105239_10033970 | 3300010375 | Bacteria | 5600 |
| 217 | Ga0105239_10094234 | 3300010375 | Bacteria | 3307 |
| 218 | Ga0105239_10137495 | 3300010375 | Bacteria | 2720 |
| 219 | Ga0105239_10155140 | 3300010375 | Bacteria | 2557 |
| 220 | Ga0105239_10307089 | 3300010375 | Bacteria | 1787 |
| 221 | Ga0105239_10386595 | 3300010375 | Bacteria | 1582 |
| 222 | Ga0105239_10719255 | 3300010375 | Bacteria | 1142 |
| 223 | Ga0105239_10738224 | 3300010375 | Bacteria | 1127 |
| 224 | Ga0105239_11870747 | 3300010375 | Bacteria | 696 |
| 225 | Ga0105239_12110883 | 3300010375 | Bacteria | 655 |
| 226 | Ga0105246_10007879 | 3300011119 | Bacteria | 6536 |
| 227 | Ga0105246_10025631 | 3300011119 | Bacteria | 3845 |
| 228 | Ga0105246_10250915 | 3300011119 | Bacteria | 1404 |
| 229 | Ga0105246_12050264 | 3300011119 | Bacteria | 553 |
| 230 | Ga0105246_12081611 | 3300011119 | Bacteria | 549 |
| 231 | Ga0157373_10113430 | 3300013100 | Bacteria | 1905 |
| 232 | Ga0157373_10203172 | 3300013100 | Bacteria | 1397 |
| 233 | Ga0157370_10008648 | 3300013104 | Bacteria | 10956 |
| 234 | Ga0157370_10308175 | 3300013104 | Bacteria | 1461 |
| 235 | Ga0157370_11085276 | 3300013104 | Bacteria | 724 |
| 236 | Ga0157370_11349593 | 3300013104 | Bacteria | 642 |
| 237 | Ga0157369_10006833 | 3300013105 | Bacteria | 13160 |
| 238 | Ga0157369_10093221 | 3300013105 | Bacteria | 3215 |
| 239 | Ga0157369_10308078 | 3300013105 | Bacteria | 1647 |
| 240 | Ga0157369_11218944 | 3300013105 | Bacteria | 768 |
| 241 | Ga0157369_11381272 | 3300013105 | Bacteria | 717 |
| 242 | Ga0157374_10218974 | 3300013296 | Bacteria | 1868 |
| 243 | Ga0157374_10452703 | 3300013296 | Bacteria | 1285 |
| 244 | Ga0157374_10602680 | 3300013296 | Bacteria | 1108 |
| 245 | Ga0157374_11238152 | 3300013296 | Bacteria | 768 |
| 246 | Ga0157374_11857461 | 3300013296 | Bacteria | 628 |
| 247 | Ga0157374_12011069 | 3300013296 | Bacteria | 604 |
| 248 | Ga0157378_10071851 | 3300013297 | Bacteria | 3108 |
| 249 | Ga0157378_10110509 | 3300013297 | Bacteria | 2519 |
| 250 | Ga0157378_10245859 | 3300013297 | Bacteria | 1711 |
| 251 | Ga0157378_10851818 | 3300013297 | Bacteria | 940 |
| 252 | Ga0157378_10894072 | 3300013297 | Bacteria | 919 |
| 253 | Ga0163162_10007963 | 3300013306 | Bacteria | 10330 |
| 254 | Ga0163162_10017004 | 3300013306 | Bacteria | 7116 |
| 255 | Ga0163162_10337398 | 3300013306 | Bacteria | 1640 |
| 256 | Ga0163162_10376038 | 3300013306 | Bacteria | 1554 |
| 257 | Ga0163162_10978312 | 3300013306 | Bacteria | 956 |
| 258 | Ga0157372_10599295 | 3300013307 | Bacteria | 1284 |
| 259 | Ga0157372_10989414 | 3300013307 | Bacteria | 974 |
| 260 | Ga0157372_11297056 | 3300013307 | Bacteria | 840 |
| 261 | Ga0157372_13408340 | 3300013307 | Bacteria | 506 |
| 262 | Ga0157375_10062618 | 3300013308 | Bacteria | 3697 |
| 263 | Ga0157375_10457413 | 3300013308 | Bacteria | 1442 |
| 264 | Ga0157375_11384954 | 3300013308 | Bacteria | 828 |
| 265 | Ga0157375_11454083 | 3300013308 | Unclassified | 808 |
| 266 | Ga0163163_10000002 | 3300014325 | Bacteria | 609846 |
| 267 | Ga0163163_10046548 | 3300014325 | Bacteria | 4261 |
| 268 | Ga0163163_10376517 | 3300014325 | Bacteria | 1477 |
| 269 | Ga0163163_10659927 | 3300014325 | Bacteria | 1109 |
| 270 | Ga0157380_10394813 | 3300014326 | Bacteria | 1310 |
| 271 | Ga0157380_10623189 | 3300014326 | Bacteria | 1071 |
| 272 | Ga0157379_10002165 | 3300014968 | Bacteria | 16323 |
| 273 | Ga0157379_10008033 | 3300014968 | Bacteria | 9157 |
| 274 | Ga0157379_10338991 | 3300014968 | Bacteria | 1375 |
| 275 | Ga0157379_10409263 | 3300014968 | Bacteria | 1248 |
| 276 | Ga0157379_10441522 | 3300014968 | Bacteria | 1200 |
| 277 | Ga0157376_10032666 | 3300014969 | Bacteria | 4181 |
| 278 | Ga0157376_10391557 | 3300014969 | Bacteria | 1341 |
| 279 | Ga0157376_10676179 | 3300014969 | Bacteria | 1035 |
| 280 | Ga0157376_11432646 | 3300014969 | Bacteria | 723 |
| 281 | Ga0157376_11563866 | 3300014969 | Bacteria | 693 |
| 282 | Ga0157376_11851259 | 3300014969 | Bacteria | 640 |
| 283 | Ga0163161_10012129 | 3300017792 | Bacteria | 5979 |
| 284 | Ga0163161_11816775 | 3300017792 | Bacteria | 542 |
| 285 | Ga0213872_10387999 | 3300021361 | Bacteria | 568 |
| 286 | Ga0213876_10020783 | 3300021384 | Bacteria | 3471 |
| 287 | Ga0209233_1000015 | 3300025261 | Bacteria | 980563 |
| 288 | Ga0209233_1013510 | 3300025261 | Bacteria | 2330 |
| 289 | Ga0209455_1037664 | 3300025272 | Unclassified | 759 |
| 290 | Ga0209758_1000013 | 3300025297 | Bacteria | 873003 |
| 291 | Ga0207682_10196467 | 3300025893 | Bacteria | 926 |
| 292 | Ga0207682_10286502 | 3300025893 | Bacteria | 771 |
| 293 | Ga0207692_10503768 | 3300025898 | Bacteria | 769 |
| 294 | Ga0207642_10775903 | 3300025899 | Bacteria | 608 |
| 295 | Ga0207688_10046283 | 3300025901 | Bacteria | 2429 |
| 296 | Ga0207680_10061233 | 3300025903 | Bacteria | 2295 |
| 297 | Ga0207645_10012251 | 3300025907 | Bacteria | 5824 |
| 298 | Ga0207645_10202490 | 3300025907 | Bacteria | 1306 |
| 299 | Ga0207705_10013726 | 3300025909 | Bacteria | 5844 |
| 300 | Ga0207705_10023616 | 3300025909 | Bacteria | 4386 |
| 301 | Ga0207705_10762388 | 3300025909 | Bacteria | 752 |
| 302 | Ga0207705_11000440 | 3300025909 | Bacteria | 646 |
| 303 | Ga0207654_10183605 | 3300025911 | Bacteria | 1366 |
| 304 | Ga0207654_10279973 | 3300025911 | Bacteria | 1128 |
| 305 | Ga0207654_10421701 | 3300025911 | Bacteria | 931 |
| 306 | Ga0207654_10442703 | 3300025911 | Bacteria | 910 |
| 307 | Ga0207707_10079800 | 3300025912 | Bacteria | 2858 |
| 308 | Ga0207707_10842925 | 3300025912 | Bacteria | 761 |
| 309 | Ga0207695_10009553 | 3300025913 | Bacteria | 11992 |
| 310 | Ga0207695_10014852 | 3300025913 | Bacteria | 9197 |
| 311 | Ga0207695_10086177 | 3300025913 | Bacteria | 3168 |
| 312 | Ga0207695_10094972 | 3300025913 | Bacteria | 2987 |
| 313 | Ga0207695_10095356 | 3300025913 | Bacteria | 2979 |
| 314 | Ga0207695_10196644 | 3300025913 | Bacteria | 1932 |
| 315 | Ga0207695_10223533 | 3300025913 | Bacteria | 1789 |
| 316 | Ga0207695_10280228 | 3300025913 | Bacteria | 1561 |
| 317 | Ga0207695_10331027 | 3300025913 | Bacteria | 1412 |
| 318 | Ga0207695_10814812 | 3300025913 | Bacteria | 814 |
| 319 | Ga0207695_11273852 | 3300025913 | Bacteria | 615 |
| 320 | Ga0207671_10042949 | 3300025914 | Bacteria | 3344 |
| 321 | Ga0207671_10063932 | 3300025914 | Bacteria | 2735 |
| 322 | Ga0207671_10071874 | 3300025914 | Bacteria | 2581 |
| 323 | Ga0207671_10177693 | 3300025914 | Bacteria | 1655 |
| 324 | Ga0207671_10910518 | 3300025914 | Bacteria | 695 |
| 325 | Ga0207693_11249677 | 3300025915 | Unclassified | 558 |
| 326 | Ga0207660_10075357 | 3300025917 | Bacteria | 2465 |
| 327 | Ga0207660_10599209 | 3300025917 | Bacteria | 897 |
| 328 | Ga0207657_10093351 | 3300025919 | Bacteria | 2507 |
| 329 | Ga0207657_10148135 | 3300025919 | Bacteria | 1913 |
| 330 | Ga0207657_10206830 | 3300025919 | Bacteria | 1576 |
| 331 | Ga0207657_10879797 | 3300025919 | Bacteria | 691 |
| 332 | Ga0207657_10971392 | 3300025919 | Bacteria | 652 |
| 333 | Ga0207649_10000154 | 3300025920 | Bacteria | 56342 |
| 334 | Ga0207649_10064343 | 3300025920 | Bacteria | 2319 |
| 335 | Ga0207649_10143320 | 3300025920 | Bacteria | 1637 |
| 336 | Ga0207649_10479626 | 3300025920 | Bacteria | 943 |
| 337 | Ga0207652_10039728 | 3300025921 | Bacteria | 3994 |
| 338 | Ga0207652_10086124 | 3300025921 | Bacteria | 2754 |
| 339 | Ga0207652_10237262 | 3300025921 | Bacteria | 1644 |
| 340 | Ga0207652_10664389 | 3300025921 | Bacteria | 931 |
| 341 | Ga0207694_10000005 | 3300025924 | Bacteria | 823704 |
| 342 | Ga0207694_10062919 | 3300025924 | Bacteria | 2890 |
| 343 | Ga0207694_10245087 | 3300025924 | Bacteria | 1465 |
| 344 | Ga0207694_10326452 | 3300025924 | Bacteria | 1267 |
| 345 | Ga0207694_10497800 | 3300025924 | Bacteria | 1020 |
| 346 | Ga0207694_10802022 | 3300025924 | Bacteria | 795 |
| 347 | Ga0207650_10212763 | 3300025925 | Bacteria | 1553 |
| 348 | Ga0207650_10330052 | 3300025925 | Bacteria | 1251 |
| 349 | Ga0207659_10188169 | 3300025926 | Bacteria | 1641 |
| 350 | Ga0207659_10344040 | 3300025926 | Bacteria | 1236 |
| 351 | Ga0207659_11714851 | 3300025926 | Unclassified | 535 |
| 352 | Ga0207687_10009197 | 3300025927 | Bacteria | 6464 |
| 353 | Ga0207687_10019917 | 3300025927 | Bacteria | 4449 |
| 354 | Ga0207687_10098518 | 3300025927 | Unclassified | 2146 |
| 355 | Ga0207687_10226890 | 3300025927 | Bacteria | 1473 |
| 356 | Ga0207664_10135221 | 3300025929 | Bacteria | 2080 |
| 357 | Ga0207644_10674731 | 3300025931 | Bacteria | 861 |
| 358 | Ga0207690_10204139 | 3300025932 | Bacteria | 1503 |
| 359 | Ga0207690_10478627 | 3300025932 | Bacteria | 1004 |
| 360 | Ga0207690_10509621 | 3300025932 | Bacteria | 974 |
| 361 | Ga0207686_10064734 | 3300025934 | Bacteria | 2329 |
| 362 | Ga0207686_10078192 | 3300025934 | Bacteria | 2150 |
| 363 | Ga0207686_10110128 | 3300025934 | Bacteria | 1855 |
| 364 | Ga0207686_11269832 | 3300025934 | Bacteria | 604 |
| 365 | Ga0207709_10003554 | 3300025935 | Bacteria | 9216 |
| 366 | Ga0207670_10048540 | 3300025936 | Bacteria | 2834 |
| 367 | Ga0207669_11216068 | 3300025937 | Bacteria | 638 |
| 368 | Ga0207704_10101507 | 3300025938 | Bacteria | 1919 |
| 369 | Ga0207704_10217172 | 3300025938 | Bacteria | 1412 |
| 370 | Ga0207704_10957345 | 3300025938 | Bacteria | 722 |
| 371 | Ga0207691_10327109 | 3300025940 | Bacteria | 1314 |
| 372 | Ga0207691_10454130 | 3300025940 | Bacteria | 1090 |
| 373 | Ga0207691_11201930 | 3300025940 | Bacteria | 629 |
| 374 | Ga0207711_10017346 | 3300025941 | Bacteria | 5981 |
| 375 | Ga0207711_10733953 | 3300025941 | Bacteria | 921 |
| 376 | Ga0207689_10090030 | 3300025942 | Bacteria | 2521 |
| 377 | Ga0207689_10197182 | 3300025942 | Bacteria | 1662 |
| 378 | Ga0207689_10221631 | 3300025942 | Bacteria | 1563 |
| 379 | Ga0207661_10334937 | 3300025944 | Bacteria | 1363 |
| 380 | Ga0207661_10412591 | 3300025944 | Bacteria | 1226 |
| 381 | Ga0207661_11436908 | 3300025944 | Bacteria | 633 |
| 382 | Ga0207667_10000061 | 3300025949 | Bacteria | 190818 |
| 383 | Ga0207667_10020392 | 3300025949 | Bacteria | 7373 |
| 384 | Ga0207667_10102112 | 3300025949 | Bacteria | 2958 |
| 385 | Ga0207667_10209669 | 3300025949 | Bacteria | 1997 |
| 386 | Ga0207667_11210835 | 3300025949 | Bacteria | 734 |
| 387 | Ga0207651_10121242 | 3300025960 | Bacteria | 1983 |
| 388 | Ga0207651_10207970 | 3300025960 | Bacteria | 1573 |
| 389 | Ga0207651_11276443 | 3300025960 | Bacteria | 660 |
| 390 | Ga0207712_10590589 | 3300025961 | Bacteria | 959 |
| 391 | Ga0207712_10965382 | 3300025961 | Unclassified | 755 |
| 392 | Ga0207668_11215984 | 3300025972 | Bacteria | 677 |
| 393 | Ga0207658_10123750 | 3300025986 | Bacteria | 2066 |
| 394 | Ga0207658_10205232 | 3300025986 | Bacteria | 1648 |
| 395 | Ga0207658_10306719 | 3300025986 | Bacteria | 1370 |
| 396 | Ga0207658_10495163 | 3300025986 | Unclassified | 1088 |
| 397 | Ga0207677_10037356 | 3300026023 | Bacteria | 3174 |
| 398 | Ga0207677_10300917 | 3300026023 | Bacteria | 1325 |
| 399 | Ga0207677_10655283 | 3300026023 | Bacteria | 927 |
| 400 | Ga0207677_10764671 | 3300026023 | Bacteria | 862 |
| 401 | Ga0207703_10148001 | 3300026035 | Bacteria | 2045 |
| 402 | Ga0207703_10661906 | 3300026035 | Bacteria | 991 |
| 403 | Ga0207703_11329333 | 3300026035 | Bacteria | 691 |
| 404 | Ga0207639_10077628 | 3300026041 | Bacteria | 2618 |
| 405 | Ga0207639_10225952 | 3300026041 | Bacteria | 1620 |
| 406 | Ga0207639_10792242 | 3300026041 | Bacteria | 883 |
| 407 | Ga0207639_10854120 | 3300026041 | Unclassified | 850 |
| 408 | Ga0207639_10899508 | 3300026041 | Bacteria | 827 |
| 409 | Ga0207639_11475173 | 3300026041 | Unclassified | 638 |
| 410 | Ga0207708_10825482 | 3300026075 | Bacteria | 799 |
| 411 | Ga0207702_10322797 | 3300026078 | Bacteria | 1471 |
| 412 | Ga0207702_10513293 | 3300026078 | Bacteria | 1169 |
| 413 | Ga0207702_10605112 | 3300026078 | Bacteria | 1076 |
| 414 | Ga0207702_10747563 | 3300026078 | Bacteria | 965 |
| 415 | Ga0207702_11287772 | 3300026078 | Bacteria | 725 |
| 416 | Ga0207702_12083602 | 3300026078 | Unclassified | 557 |
| 417 | Ga0207641_10574161 | 3300026088 | Bacteria | 1102 |
| 418 | Ga0207641_10835318 | 3300026088 | Bacteria | 912 |
| 419 | Ga0207641_12268575 | 3300026088 | Bacteria | 543 |
| 420 | Ga0207648_10044599 | 3300026089 | Bacteria | 3890 |
| 421 | Ga0207648_10305595 | 3300026089 | Bacteria | 1427 |
| 422 | Ga0207648_10910601 | 3300026089 | Bacteria | 822 |
| 423 | Ga0207674_10019842 | 3300026116 | Bacteria | 7274 |
| 424 | Ga0207674_10101739 | 3300026116 | Bacteria | 2854 |
| 425 | Ga0207674_10189883 | 3300026116 | Bacteria | 2004 |
| 426 | Ga0207674_10489372 | 3300026116 | Bacteria | 1189 |
| 427 | Ga0207674_11440775 | 3300026116 | Unclassified | 658 |
| 428 | Ga0207675_100773438 | 3300026118 | Bacteria | 972 |
| 429 | Ga0207675_101417446 | 3300026118 | Bacteria | 715 |
| 430 | Ga0207683_10008807 | 3300026121 | Bacteria | 8613 |
| 431 | Ga0207683_10019373 | 3300026121 | Bacteria | 5809 |
| 432 | Ga0207683_10142869 | 3300026121 | Bacteria | 2157 |
| 433 | Ga0207683_10336105 | 3300026121 | Bacteria | 1385 |
| 434 | Ga0207683_10848938 | 3300026121 | Bacteria | 848 |
| 435 | Ga0207698_10104179 | 3300026142 | Bacteria | 2360 |
| 436 | Ga0207698_10181392 | 3300026142 | Bacteria | 1865 |
| 437 | Ga0207698_10206210 | 3300026142 | Bacteria | 1765 |
| 438 | Ga0207698_11545910 | 3300026142 | Bacteria | 679 |
| 439 | Ga0207698_11580649 | 3300026142 | Bacteria | 671 |
| 440 | Ga0268266_10000695 | 3300028379 | Bacteria | 45341 |
| 441 | Ga0268266_10022016 | 3300028379 | Bacteria | 5433 |
| 442 | Ga0268266_10131661 | 3300028379 | Bacteria | 2237 |
| 443 | Ga0268266_10139343 | 3300028379 | Bacteria | 2176 |
| 444 | Ga0268266_10169932 | 3300028379 | Bacteria | 1978 |
| 445 | Ga0268266_10230934 | 3300028379 | Bacteria | 1704 |
| 446 | Ga0268266_10238747 | 3300028379 | Bacteria | 1676 |
| 447 | Ga0268266_10389306 | 3300028379 | Bacteria | 1316 |
| 448 | Ga0268266_10594696 | 3300028379 | Bacteria | 1062 |
| 449 | Ga0268266_10942418 | 3300028379 | Unclassified | 835 |
| 450 | Ga0268265_10842929 | 3300028380 | Bacteria | 896 |
| 451 | Ga0268264_10873627 | 3300028381 | Bacteria | 901 |
| 452 | Ga0265334_10347447 | 3300028573 | Bacteria | 507 |
| 453 | Ga0265318_10003384 | 3300028577 | Bacteria | 8036 |
| 454 | Ga0265318_10366214 | 3300028577 | Bacteria | 526 |
| 455 | Ga0265338_10022918 | 3300028800 | Bacteria | 6442 |
| 456 | Ga0265330_10004583 | 3300031235 | Bacteria | 6991 |
| 457 | Ga0265330_10025693 | 3300031235 | Bacteria | 2669 |
| 458 | Ga0265330_10129090 | 3300031235 | Bacteria | 1076 |
| 459 | Ga0265330_10198576 | 3300031235 | Bacteria | 848 |
| 460 | Ga0265332_10098715 | 3300031238 | Bacteria | 1233 |
| 461 | Ga0265332_10120360 | 3300031238 | Bacteria | 1103 |
| 462 | Ga0265332_10411277 | 3300031238 | Unclassified | 559 |
| 463 | Ga0265328_10072595 | 3300031239 | Bacteria | 1265 |
| 464 | Ga0265328_10343895 | 3300031239 | Bacteria | 580 |
| 465 | Ga0265320_10289178 | 3300031240 | Bacteria | 725 |
| 466 | Ga0265325_10014465 | 3300031241 | Bacteria | 4457 |
| 467 | Ga0265325_10033117 | 3300031241 | Bacteria | 2755 |
| 468 | Ga0265325_10142454 | 3300031241 | Bacteria | 1139 |
| 469 | Ga0265325_10234422 | 3300031241 | Bacteria | 836 |
| 470 | Ga0265340_10000045 | 3300031247 | Bacteria | 56451 |
| 471 | Ga0265340_10245018 | 3300031247 | Bacteria | 799 |
| 472 | Ga0265340_10407665 | 3300031247 | Bacteria | 599 |
| 473 | Ga0265339_10011572 | 3300031249 | Bacteria | 5422 |
| 474 | Ga0265339_10094711 | 3300031249 | Bacteria | 1561 |
| 475 | Ga0265339_10184775 | 3300031249 | Bacteria | 1036 |
| 476 | Ga0265339_10357942 | 3300031249 | Bacteria | 687 |
| 477 | Ga0265339_10607311 | 3300031249 | Bacteria | 501 |
| 478 | Ga0265331_10000113 | 3300031250 | Bacteria | 105472 |
| 479 | Ga0265331_10032183 | 3300031250 | Bacteria | 2601 |
| 480 | Ga0265331_10073193 | 3300031250 | Bacteria | 1600 |
| 481 | Ga0265331_10126046 | 3300031250 | Bacteria | 1170 |
| 482 | Ga0265316_10021874 | 3300031344 | Bacteria | 5406 |
| 483 | Ga0265316_10089537 | 3300031344 | Bacteria | 2348 |
| 484 | Ga0265316_10135749 | 3300031344 | Bacteria | 1851 |
| 485 | Ga0265316_10265375 | 3300031344 | Bacteria | 1258 |
| 486 | Ga0265316_10390079 | 3300031344 | Bacteria | 1004 |
| 487 | Ga0307513_10519726 | 3300031456 | Unclassified | 906 |
| 488 | Ga0265313_10002892 | 3300031595 | Bacteria | 14371 |
| 489 | Ga0265313_10016173 | 3300031595 | Bacteria | 4301 |
| 490 | Ga0265313_10017499 | 3300031595 | Bacteria | 4071 |
| 491 | Ga0265313_10198786 | 3300031595 | Bacteria | 835 |
| 492 | Ga0265314_10006495 | 3300031711 | Bacteria | 10339 |
| 493 | Ga0265314_10029553 | 3300031711 | Bacteria | 4071 |
| 494 | Ga0265314_10033294 | 3300031711 | Bacteria | 3782 |
| 495 | Ga0265314_10045594 | 3300031711 | Bacteria | 3098 |
| 496 | Ga0265314_10097346 | 3300031711 | Bacteria | 1901 |
| 497 | Ga0265314_10247942 | 3300031711 | Bacteria | 1024 |
| 498 | Ga0265314_10601940 | 3300031711 | Bacteria | 566 |
| 499 | Ga0265342_10018674 | 3300031712 | Bacteria | 4482 |
| 500 | Ga0265342_10045634 | 3300031712 | Bacteria | 2637 |
| 501 | Ga0265342_10069717 | 3300031712 | Bacteria | 2052 |
| 502 | Ga0265342_10145502 | 3300031712 | Bacteria | 1320 |
| 503 | Ga0265342_10163821 | 3300031712 | Unclassified | 1227 |
| 504 | Ga0307516_10059575 | 3300031730 | Bacteria | 3713 |
| 505 | Ga0307516_10192641 | 3300031730 | Bacteria | 1763 |
| 506 | Ga0307516_10231713 | 3300031730 | Bacteria | 1550 |
| 507 | Ga0307413_11513331 | 3300031824 | Bacteria | 594 |
| 508 | Ga0373932_0243788 | 3300035112 | Bacteria | 654 |
| 509 | Ga0373935_0659309 | 3300035692 | Bacteria | 768 |
| 510 | Ga0373937_0744256 | 3300036401 | Bacteria | 928 |
| 511 | Ga0395899_0069184 | 3300037312 | Bacteria | 2586 |
| 512 | Ga0395900_0010488 | 3300037418 | Bacteria | 9478 |
| 513 | Ga0395900_0218624 | 3300037418 | Bacteria | 1921 |
| 514 | Ga0395898_0008354 | 3300037466 | Bacteria | 10947 |
| 515 | Ga0395898_0045250 | 3300037466 | Bacteria | 4327 |
| 516 | Ga0395901_0167509 | 3300038443 | Bacteria | 2306 |
| 517 | Ga0436365_0322570 | 3300039437 | Bacteria | 8765 |
| 518 | Ga0436365_1687461 | 3300039437 | Bacteria | 886 |
| 519 | Ga0436361_0180372 | 3300039447 | Bacteria | 807 |
| 520 | Ga0436362_0053635 | 3300039453 | Bacteria | 974 |
| 521 | Ga0451787_799516 | 3300041441 | Bacteria | 525 |
| 522 | Ga0466963_1218914 | 3300044694 | Bacteria | 529 |
| 523 | Ga0466957_0457269 | 3300044842 | Bacteria | 880 |
| 524 | Ga0466967_0748036 | 3300045976 | Unclassified | 969 |
| 525 | Ga0495592_0715296 | 3300046454 | Bacteria | 601 |
| 526 | Ga0495650_0334024 | 3300046471 | Bacteria | 503 |
| 527 | Ga0495585_0412578 | 3300046492 | Bacteria | 649 |
| 528 | Ga0495594_0371709 | 3300046499 | Bacteria | 814 |
| 529 | Ga0495606_0320179 | 3300046507 | Bacteria | 833 |
| 530 | Ga0495618_0555183 | 3300046514 | Bacteria | 687 |
| 531 | Ga0495620_0198172 | 3300046515 | Bacteria | 773 |
| 532 | Ga0495620_0382723 | 3300046515 | Bacteria | 533 |
| 533 | Ga0495644_0073952 | 3300046523 | Bacteria | 1282 |
| 534 | Ga0495648_0103502 | 3300046524 | Bacteria | 1566 |
| 535 | Ga0495652_0090157 | 3300046529 | Bacteria | 2509 |
| 536 | Ga0495652_0227147 | 3300046529 | Bacteria | 1399 |
| 537 | Ga0495654_0070804 | 3300046530 | Bacteria | 1653 |
| 538 | Ga0495587_0318924 | 3300046536 | Bacteria | 868 |
| 539 | Ga0495587_0582405 | 3300046536 | Bacteria | 617 |
| 540 | Ga0495609_0022902 | 3300046538 | Bacteria | 2876 |
| 541 | Ga0495621_0063918 | 3300046539 | Bacteria | 1342 |
| 542 | Ga0495622_0012617 | 3300046557 | Bacteria | 3915 |
| 543 | Ga0495667_0423198 | 3300046559 | Bacteria | 838 |
| 544 | Ga0495634_0816620 | 3300046642 | Bacteria | 531 |
| 545 | Ga0495611_0324553 | 3300046648 | Bacteria | 708 |
| 546 | Ga0495657_0425743 | 3300046675 | Unclassified | 779 |
| 547 | Ga0495657_0511511 | 3300046675 | Bacteria | 700 |
| 548 | Ga0495623_0169952 | 3300046679 | Bacteria | 1274 |
| 549 | Ga0495613_0234497 | 3300046689 | Bacteria | 1285 |
| 550 | Ga0495624_0690953 | 3300046690 | Unclassified | 606 |
| 551 | Ga0495649_0182687 | 3300046694 | Bacteria | 1094 |
| 552 | Ga0495604_0806832 | 3300047317 | Bacteria | 591 |
| 553 | Ga0495672_0147535 | 3300047320 | Bacteria | 1223 |
| 554 | Ga0495672_0313084 | 3300047320 | Bacteria | 740 |
| 555 | Ga0495676_0696077 | 3300047321 | Bacteria | 658 |
| 556 | Ga0495602_0023569 | 3300048088 | Bacteria | 5994 |
| 557 | Ga0495602_0719205 | 3300048088 | Bacteria | 676 |
| 558 | Ga0496100_1094406 | 3300048903 | Unclassified | 628 |
| 559 | Ga0496101_0877094 | 3300048904 | Unclassified | 707 |
| 560 | Ga0496107_1105017 | 3300048910 | Bacteria | 573 |
| 561 | Ga0496121_0000527 | 3300048924 | Bacteria | 72759 |
| 562 | Ga0496121_0522411 | 3300048924 | Unclassified | 749 |
| 563 | Ga0496126_0128976 | 3300048929 | Bacteria | 2187 |
| 564 | Ga0495682_0001570 | 3300049460 | Bacteria | 11922 |
| 565 | Ga0501031_0010452 | 3300049568 | Bacteria | 6045 |
| 566 | Ga0501031_0248295 | 3300049568 | Bacteria | 1157 |
| 567 | Ga0501031_0290003 | 3300049568 | Bacteria | 1061 |
| 568 | Ga0501031_0504673 | 3300049568 | Bacteria | 780 |
| 569 | Ga0501031_0894323 | 3300049568 | Bacteria | 568 |
| 570 | Ga0501032_0005257 | 3300049569 | Bacteria | 9631 |
| 571 | Ga0501032_0208279 | 3300049569 | Bacteria | 1275 |
| 572 | Ga0501032_0241709 | 3300049569 | Bacteria | 1173 |
| 573 | Ga0501032_0420884 | 3300049569 | Bacteria | 857 |
| 574 | Ga0501032_0513743 | 3300049569 | Bacteria | 765 |
| 575 | Ga0501033_0018503 | 3300049570 | Bacteria | 5264 |
| 576 | Ga0501033_0030587 | 3300049570 | Bacteria | 4045 |
| 577 | Ga0501033_0033037 | 3300049570 | Bacteria | 3885 |
| 578 | Ga0501033_0035122 | 3300049570 | Bacteria | 3758 |
| 579 | Ga0501033_0042807 | 3300049570 | Bacteria | 3376 |
| 580 | Ga0501033_0048041 | 3300049570 | Bacteria | 3171 |
| 581 | Ga0501033_0191720 | 3300049570 | Bacteria | 1462 |
| 582 | Ga0501033_0210770 | 3300049570 | Bacteria | 1385 |
| 583 | Ga0501033_0250301 | 3300049570 | Bacteria | 1256 |
| 584 | Ga0501033_0425434 | 3300049570 | Bacteria | 924 |
| 585 | Ga0501033_0436740 | 3300049570 | Bacteria | 910 |
| 586 | Ga0501033_0473224 | 3300049570 | Bacteria | 868 |
| 587 | Ga0501034_0014485 | 3300049571 | Bacteria | 8121 |
| 588 | Ga0501034_0020591 | 3300049571 | Bacteria | 6737 |
| 589 | Ga0501034_0026236 | 3300049571 | Bacteria | 5934 |
| 590 | Ga0501034_0069108 | 3300049571 | Bacteria | 3543 |
| 591 | Ga0501034_0075264 | 3300049571 | Bacteria | 3384 |
| 592 | Ga0501034_0115624 | 3300049571 | Bacteria | 2671 |
| 593 | Ga0501034_0171340 | 3300049571 | Bacteria | 2138 |
| 594 | Ga0501034_0265856 | 3300049571 | Bacteria | 1657 |
| 595 | Ga0501034_0649476 | 3300049571 | Bacteria | 957 |
| 596 | Ga0501034_0803192 | 3300049571 | Bacteria | 833 |
| 597 | Ga0501034_0971349 | 3300049571 | Bacteria | 734 |
| 598 | Ga0501034_1175288 | 3300049571 | Bacteria | 646 |
| 599 | Ga0501036_0004837 | 3300049572 | Bacteria | 10879 |
| 600 | Ga0501036_0086475 | 3300049572 | Bacteria | 2650 |
| 601 | Ga0501036_0139317 | 3300049572 | Bacteria | 2048 |
| 602 | Ga0501036_0182086 | 3300049572 | Bacteria | 1769 |
| 603 | Ga0501036_0252789 | 3300049572 | Bacteria | 1477 |
| 604 | Ga0501036_1004522 | 3300049572 | Bacteria | 683 |
| 605 | Ga0501037_0034928 | 3300049573 | Bacteria | 3708 |
| 606 | Ga0501037_0075325 | 3300049573 | Bacteria | 2451 |
| 607 | Ga0501037_0137764 | 3300049573 | Bacteria | 1748 |
| 608 | Ga0501037_0310692 | 3300049573 | Bacteria | 1093 |
| 609 | Ga0501037_0990662 | 3300049573 | Bacteria | 548 |
| 610 | Ga0501038_0021951 | 3300049574 | Bacteria | 5725 |
| 611 | Ga0501038_0049270 | 3300049574 | Bacteria | 3643 |
| 612 | Ga0501038_0088552 | 3300049574 | Bacteria | 2598 |
| 613 | Ga0501038_0111908 | 3300049574 | Bacteria | 2261 |
| 614 | Ga0501039_0041675 | 3300049575 | Bacteria | 3547 |
| 615 | Ga0501039_0126740 | 3300049575 | Bacteria | 2003 |
| 616 | Ga0501039_1156317 | 3300049575 | Bacteria | 599 |
| 617 | Ga0501040_0114960 | 3300049576 | Bacteria | 1884 |
| 618 | Ga0501042_0067410 | 3300049578 | Bacteria | 2558 |
| 619 | Ga0501043_0019544 | 3300049579 | Bacteria | 5316 |
| 620 | Ga0501043_0312139 | 3300049579 | Bacteria | 1200 |
| 621 | Ga0501043_0363296 | 3300049579 | Bacteria | 1098 |
| 622 | Ga0501043_0619888 | 3300049579 | Bacteria | 797 |
| 623 | Ga0501046_0006506 | 3300049580 | Bacteria | 10332 |
| 624 | Ga0501046_0007976 | 3300049580 | Bacteria | 9260 |
| 625 | Ga0501046_0133396 | 3300049580 | Bacteria | 1882 |
| 626 | Ga0501046_1068265 | 3300049580 | Bacteria | 558 |
| 627 | Ga0501047_0005573 | 3300049581 | Bacteria | 11854 |
| 628 | Ga0501047_0012160 | 3300049581 | Bacteria | 8147 |
| 629 | Ga0501047_0024719 | 3300049581 | Bacteria | 5767 |
| 630 | Ga0501047_0051529 | 3300049581 | Bacteria | 3978 |
| 631 | Ga0501047_0055987 | 3300049581 | Bacteria | 3812 |
| 632 | Ga0501047_0058311 | 3300049581 | Bacteria | 3730 |
| 633 | Ga0501047_0062071 | 3300049581 | Bacteria | 3605 |
| 634 | Ga0501047_0079600 | 3300049581 | Bacteria | 3150 |
| 635 | Ga0501047_0281357 | 3300049581 | Bacteria | 1508 |
| 636 | Ga0501047_0422663 | 3300049581 | Bacteria | 1164 |
| 637 | Ga0501047_0532185 | 3300049581 | Bacteria | 1000 |
| 638 | Ga0501047_0639114 | 3300049581 | Bacteria | 884 |
| 639 | Ga0501048_0009781 | 3300049582 | Bacteria | 7189 |
| 640 | Ga0501048_0011718 | 3300049582 | Bacteria | 6540 |
| 641 | Ga0501067_0002975 | 3300049583 | Bacteria | 9351 |
| 642 | Ga0501067_0014512 | 3300049583 | Bacteria | 4362 |
| 643 | Ga0501068_0099997 | 3300049584 | Bacteria | 1797 |
| 644 | Ga0501068_0846855 | 3300049584 | Bacteria | 601 |
| 645 | Ga0501069_0010175 | 3300049585 | Bacteria | 4975 |
| 646 | Ga0501069_0168117 | 3300049585 | Bacteria | 1264 |
| 647 | Ga0501070_0001596 | 3300049586 | Bacteria | 20105 |
| 648 | Ga0501070_0010156 | 3300049586 | Bacteria | 7968 |
| 649 | Ga0501070_0504077 | 3300049586 | Unclassified | 972 |
| 650 | Ga0501070_1181614 | 3300049586 | Bacteria | 588 |
| 651 | Ga0501072_0029247 | 3300049588 | Bacteria | 4302 |
| 652 | Ga0501072_0124768 | 3300049588 | Bacteria | 2051 |
| 653 | Ga0501073_0008387 | 3300049589 | Bacteria | 7666 |
| 654 | Ga0501073_0128979 | 3300049589 | Bacteria | 1753 |
| 655 | Ga0501073_0230136 | 3300049589 | Bacteria | 1280 |
| 656 | Ga0501073_0491811 | 3300049589 | Bacteria | 848 |
| 657 | Ga0501074_0022031 | 3300049590 | Bacteria | 4628 |
| 658 | Ga0501074_0154709 | 3300049590 | Bacteria | 1638 |
| 659 | Ga0501076_0874976 | 3300049592 | Bacteria | 741 |
| 660 | Ga0501079_0009686 | 3300049741 | Bacteria | 7304 |
| 661 | Ga0501079_0068919 | 3300049741 | Bacteria | 2730 |
| 662 | Ga0501080_0044620 | 3300049742 | Bacteria | 4127 |
| 663 | Ga0501080_0081720 | 3300049742 | Bacteria | 3001 |
| 664 | Ga0501080_0161758 | 3300049742 | Bacteria | 2067 |
| 665 | Ga0501080_0325419 | 3300049742 | Bacteria | 1391 |
| 666 | Ga0501080_0345073 | 3300049742 | Bacteria | 1345 |
| 667 | Ga0501080_0444054 | 3300049742 | Bacteria | 1164 |
| 668 | Ga0501083_0002469 | 3300049744 | Bacteria | 12669 |
| 669 | Ga0501083_0054975 | 3300049744 | Bacteria | 2670 |
| 670 | Ga0501083_0134421 | 3300049744 | Bacteria | 1621 |
| 671 | Ga0501035_0081616 | 3300049822 | Bacteria | 2854 |
| 672 | Ga0501035_0084164 | 3300049822 | Bacteria | 2805 |
| 673 | Ga0501035_0103141 | 3300049822 | Bacteria | 2502 |
| 674 | Ga0501035_0104314 | 3300049822 | Bacteria | 2486 |
| 675 | Ga0501035_0105357 | 3300049822 | Bacteria | 2472 |
| 676 | Ga0501035_0108946 | 3300049822 | Bacteria | 2428 |
| 677 | Ga0501035_0135193 | 3300049822 | Bacteria | 2147 |
| 678 | Ga0501035_0179992 | 3300049822 | Bacteria | 1821 |
| 679 | Ga0501035_0248191 | 3300049822 | Bacteria | 1512 |
| 680 | Ga0501035_0276308 | 3300049822 | Bacteria | 1421 |
| 681 | Ga0501044_0008181 | 3300049823 | Bacteria | 11477 |
| 682 | Ga0501044_0024973 | 3300049823 | Bacteria | 6335 |
| 683 | Ga0501044_0051027 | 3300049823 | Bacteria | 4266 |
| 684 | Ga0501044_0071373 | 3300049823 | Bacteria | 3531 |
| 685 | Ga0501044_0090489 | 3300049823 | Bacteria | 3087 |
| 686 | Ga0501044_0105596 | 3300049823 | Bacteria | 2829 |
| 687 | Ga0501044_0151801 | 3300049823 | Bacteria | 2298 |
| 688 | Ga0501044_0196576 | 3300049823 | Bacteria | 1976 |
| 689 | Ga0501044_0321554 | 3300049823 | Bacteria | 1471 |
| 690 | Ga0501044_0681360 | 3300049823 | Bacteria | 915 |
| 691 | Ga0501044_0924242 | 3300049823 | Bacteria | 746 |
| 692 | Ga0501044_0940804 | 3300049823 | Bacteria | 738 |
| 693 | Ga0501044_1047589 | 3300049823 | Bacteria | 686 |
| 694 | Ga0501044_1069443 | 3300049823 | Bacteria | 677 |
| 695 | Ga0501045_0440132 | 3300049824 | Bacteria | 969 |
| 696 | Ga0500643_000003 | 3300053087 | Bacteria | 876659 |
| 697 | Ga0500646_0138052 | 3300053090 | Bacteria | 798 |
| 698 | Ga0500555_125407 | 3300053103 | Bacteria | 639 |
| 699 | Ga0500595_001154 | 3300053119 | Bacteria | 14653 |
| 700 | Ga0500595_021631 | 3300053119 | Bacteria | 2292 |
| 701 | Ga0500595_026422 | 3300053119 | Bacteria | 2001 |
| 702 | Ga0500595_044650 | 3300053119 | Bacteria | 1403 |
| 703 | Ga0500642_0203143 | 3300053130 | Bacteria | 922 |
| 704 | Ga0500655_027659 | 3300053133 | Bacteria | 1083 |
| 705 | Ga0500559_0024113 | 3300053136 | Bacteria | 2586 |
| 706 | Ga0500559_0024947 | 3300053136 | Bacteria | 2545 |
| 707 | Ga0500568_0130986 | 3300053139 | Bacteria | 932 |
| 708 | Ga0500573_0000025 | 3300053140 | Bacteria | 144473 |
| 709 | Ga0500639_223115 | 3300053163 | Bacteria | 784 |
| 710 | Ga0500645_019051 | 3300053730 | Bacteria | 2138 |
| 711 | Ga0501084_0163445 | 3300054114 | Bacteria | 1878 |
| 712 | Ga0501082_0035263 | 3300060353 | Bacteria | 4312 |
| 713 | Ga0501082_0066011 | 3300060353 | Bacteria | 3116 |
| 714 | Ga0501082_0278461 | 3300060353 | Bacteria | 1456 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300021384 | Ga0213876_10020783 | Ga0213876_100207833 | 101 |
| 2 | 3300039437 | Ga0436365_0322570 | Ga0436365_0322570_5309_5686 | 101 |
| 3 | 3300039453 | Ga0436362_0053635 | Ga0436362_0053635_254_631 | 101 |
| 4 | 3300049585 | Ga0501069_0168117 | Ga0501069_0168117_923_1237 | 103 |
| 5 | 3300009551 | Ga0105238_12652998 | Ga0105238_126529981 | 106 |
| 6 | 3300031241 | Ga0265325_10234422 | Ga0265325_102344222 | 106 |
| 7 | 3300031595 | Ga0265313_10002892 | Ga0265313_1000289213 | 106 |
| 8 | 3300049575 | Ga0501039_0126740 | Ga0501039_0126740_1178_1534 | 109 |
| 9 | 3300053163 | Ga0500639_223115 | Ga0500639_223115_315_644 | 109 |
| 10 | 3300005563 | Ga0068855_100021219 | Ga0068855_1000212194 | 110 |
| 11 | 3300013104 | Ga0157370_10008648 | Ga0157370_100086487 | 110 |
| 12 | 3300013105 | Ga0157369_11381272 | Ga0157369_113812722 | 110 |
| 13 | 3300025949 | Ga0207667_10020392 | Ga0207667_100203924 | 110 |
| 14 | 3300031249 | Ga0265339_10357942 | Ga0265339_103579422 | 110 |
| 15 | 3300026118 | Ga0207675_100773438 | Ga0207675_1007734382 | 112 |
| 16 | 3300003214 | JGI25165J46597_1000003 | JGI25165J46597_1000003651 | 113 |
| 17 | 3300003215 | JGI25153J46596_10025344 | JGI25153J46596_100253442 | 113 |
| 18 | 3300003323 | rootH1_10164083 | rootH1_101640832 | 113 |
| 19 | 3300005327 | Ga0070658_10029983 | Ga0070658_100299834 | 113 |
| 20 | 3300005327 | Ga0070658_10035662 | Ga0070658_100356621 | 113 |
| 21 | 3300005327 | Ga0070658_10043261 | Ga0070658_100432612 | 113 |
| 22 | 3300005327 | Ga0070658_10135283 | Ga0070658_101352831 | 113 |
| 23 | 3300005327 | Ga0070658_10148879 | Ga0070658_101488792 | 113 |
| 24 | 3300005327 | Ga0070658_10481462 | Ga0070658_104814622 | 113 |
| 25 | 3300005327 | Ga0070658_10639878 | Ga0070658_106398781 | 113 |
| 26 | 3300005327 | Ga0070658_10961002 | Ga0070658_109610022 | 113 |
| 27 | 3300005327 | Ga0070658_11147791 | Ga0070658_111477912 | 113 |
| 28 | 3300005327 | Ga0070658_11448389 | Ga0070658_114483892 | 113 |
| 29 | 3300005327 | Ga0070658_11669325 | Ga0070658_116693251 | 113 |
| 30 | 3300005328 | Ga0070676_10042600 | Ga0070676_100426002 | 113 |
| 31 | 3300005328 | Ga0070676_10607215 | Ga0070676_106072152 | 113 |
| 32 | 3300005328 | Ga0070676_11235293 | Ga0070676_112352932 | 113 |
| 33 | 3300005329 | Ga0070683_100279601 | Ga0070683_1002796013 | 113 |
| 34 | 3300005331 | Ga0070670_100388921 | Ga0070670_1003889212 | 113 |
| 35 | 3300005333 | Ga0070677_10174966 | Ga0070677_101749662 | 113 |
| 36 | 3300005333 | Ga0070677_10406561 | Ga0070677_104065612 | 113 |
| 37 | 3300005334 | Ga0068869_100200670 | Ga0068869_1002006702 | 113 |
| 38 | 3300005334 | Ga0068869_100209167 | Ga0068869_1002091672 | 113 |
| 39 | 3300005334 | Ga0068869_100422006 | Ga0068869_1004220062 | 113 |
| 40 | 3300005334 | Ga0068869_100468796 | Ga0068869_1004687962 | 113 |
| 41 | 3300005335 | Ga0070666_10041648 | Ga0070666_100416482 | 113 |
| 42 | 3300005335 | Ga0070666_10589663 | Ga0070666_105896632 | 113 |
| 43 | 3300005336 | Ga0070680_100230057 | Ga0070680_1002300572 | 113 |
| 44 | 3300005336 | Ga0070680_100363452 | Ga0070680_1003634522 | 113 |
| 45 | 3300005338 | Ga0068868_100014115 | Ga0068868_1000141151 | 113 |
| 46 | 3300005338 | Ga0068868_100054692 | Ga0068868_1000546923 | 113 |
| 47 | 3300005338 | Ga0068868_100060392 | Ga0068868_1000603924 | 113 |
| 48 | 3300005339 | Ga0070660_100071191 | Ga0070660_1000711913 | 113 |
| 49 | 3300005339 | Ga0070660_100081619 | Ga0070660_1000816192 | 113 |
| 50 | 3300005339 | Ga0070660_100216857 | Ga0070660_1002168572 | 113 |
| 51 | 3300005341 | Ga0070691_10858314 | Ga0070691_108583142 | 113 |
| 52 | 3300005344 | Ga0070661_100002706 | Ga0070661_1000027066 | 113 |
| 53 | 3300005344 | Ga0070661_100466262 | Ga0070661_1004662622 | 113 |
| 54 | 3300005344 | Ga0070661_101623830 | Ga0070661_1016238302 | 113 |
| 55 | 3300005347 | Ga0070668_101919655 | Ga0070668_1019196551 | 113 |
| 56 | 3300005354 | Ga0070675_100043761 | Ga0070675_1000437612 | 113 |
| 57 | 3300005354 | Ga0070675_100370264 | Ga0070675_1003702641 | 113 |
| 58 | 3300005354 | Ga0070675_100752543 | Ga0070675_1007525432 | 113 |
| 59 | 3300005355 | Ga0070671_100310698 | Ga0070671_1003106982 | 113 |
| 60 | 3300005356 | Ga0070674_100579917 | Ga0070674_1005799172 | 113 |
| 61 | 3300005364 | Ga0070673_100086851 | Ga0070673_1000868512 | 113 |
| 62 | 3300005364 | Ga0070673_101587734 | Ga0070673_1015877342 | 113 |
| 63 | 3300005366 | Ga0070659_100415021 | Ga0070659_1004150212 | 113 |
| 64 | 3300005366 | Ga0070659_100494505 | Ga0070659_1004945052 | 113 |
| 65 | 3300005366 | Ga0070659_101604327 | Ga0070659_1016043271 | 113 |
| 66 | 3300005367 | Ga0070667_100159468 | Ga0070667_1001594681 | 113 |
| 67 | 3300005367 | Ga0070667_100485173 | Ga0070667_1004851732 | 113 |
| 68 | 3300005367 | Ga0070667_101655773 | Ga0070667_1016557731 | 113 |
| 69 | 3300005367 | Ga0070667_102086695 | Ga0070667_1020866952 | 113 |
| 70 | 3300005435 | Ga0070714_100014744 | Ga0070714_1000147445 | 113 |
| 71 | 3300005438 | Ga0070701_10381955 | Ga0070701_103819551 | 113 |
| 72 | 3300005438 | Ga0070701_10691596 | Ga0070701_106915962 | 113 |
| 73 | 3300005439 | Ga0070711_101004583 | Ga0070711_1010045831 | 113 |
| 74 | 3300005441 | Ga0070700_100973038 | Ga0070700_1009730382 | 113 |
| 75 | 3300005456 | Ga0070678_100014122 | Ga0070678_1000141228 | 113 |
| 76 | 3300005456 | Ga0070678_100017757 | Ga0070678_1000177575 | 113 |
| 77 | 3300005456 | Ga0070678_100112436 | Ga0070678_1001124363 | 113 |
| 78 | 3300005456 | Ga0070678_100115106 | Ga0070678_1001151062 | 113 |
| 79 | 3300005457 | Ga0070662_100967540 | Ga0070662_1009675401 | 113 |
| 80 | 3300005458 | Ga0070681_10103979 | Ga0070681_101039792 | 113 |
| 81 | 3300005458 | Ga0070681_10181799 | Ga0070681_101817992 | 113 |
| 82 | 3300005458 | Ga0070681_10270181 | Ga0070681_102701812 | 113 |
| 83 | 3300005459 | Ga0068867_100012470 | Ga0068867_1000124704 | 113 |
| 84 | 3300005459 | Ga0068867_100538324 | Ga0068867_1005383242 | 113 |
| 85 | 3300005530 | Ga0070679_100011831 | Ga0070679_1000118314 | 113 |
| 86 | 3300005530 | Ga0070679_100060211 | Ga0070679_1000602113 | 113 |
| 87 | 3300005530 | Ga0070679_100062116 | Ga0070679_1000621164 | 113 |
| 88 | 3300005530 | Ga0070679_100687497 | Ga0070679_1006874972 | 113 |
| 89 | 3300005530 | Ga0070679_102083855 | Ga0070679_1020838551 | 113 |
| 90 | 3300005535 | Ga0070684_100507155 | Ga0070684_1005071552 | 113 |
| 91 | 3300005535 | Ga0070684_101456157 | Ga0070684_1014561572 | 113 |
| 92 | 3300005539 | Ga0068853_100448166 | Ga0068853_1004481662 | 113 |
| 93 | 3300005539 | Ga0068853_100502379 | Ga0068853_1005023792 | 113 |
| 94 | 3300005539 | Ga0068853_100747067 | Ga0068853_1007470671 | 113 |
| 95 | 3300005539 | Ga0068853_100893384 | Ga0068853_1008933842 | 113 |
| 96 | 3300005543 | Ga0070672_100199525 | Ga0070672_1001995252 | 113 |
| 97 | 3300005546 | Ga0070696_101229123 | Ga0070696_1012291231 | 113 |
| 98 | 3300005547 | Ga0070693_100348657 | Ga0070693_1003486572 | 113 |
| 99 | 3300005547 | Ga0070693_100945245 | Ga0070693_1009452451 | 113 |
| 100 | 3300005548 | Ga0070665_100007050 | Ga0070665_10000705012 | 113 |
| 101 | 3300005548 | Ga0070665_100027566 | Ga0070665_1000275663 | 113 |
| 102 | 3300005548 | Ga0070665_100061341 | Ga0070665_1000613413 | 113 |
| 103 | 3300005548 | Ga0070665_100061584 | Ga0070665_1000615842 | 113 |
| 104 | 3300005548 | Ga0070665_100218252 | Ga0070665_1002182522 | 113 |
| 105 | 3300005548 | Ga0070665_100534927 | Ga0070665_1005349272 | 113 |
| 106 | 3300005548 | Ga0070665_100862085 | Ga0070665_1008620852 | 113 |
| 107 | 3300005548 | Ga0070665_101106517 | Ga0070665_1011065171 | 113 |
| 108 | 3300005563 | Ga0068855_100000022 | Ga0068855_100000022161 | 113 |
| 109 | 3300005563 | Ga0068855_100022754 | Ga0068855_1000227543 | 113 |
| 110 | 3300005563 | Ga0068855_100102622 | Ga0068855_1001026224 | 113 |
| 111 | 3300005563 | Ga0068855_100215457 | Ga0068855_1002154572 | 113 |
| 112 | 3300005563 | Ga0068855_100891055 | Ga0068855_1008910552 | 113 |
| 113 | 3300005563 | Ga0068855_100994498 | Ga0068855_1009944982 | 113 |
| 114 | 3300005577 | Ga0068857_100036127 | Ga0068857_1000361272 | 113 |
| 115 | 3300005577 | Ga0068857_100049344 | Ga0068857_1000493444 | 113 |
| 116 | 3300005577 | Ga0068857_100740445 | Ga0068857_1007404452 | 113 |
| 117 | 3300005577 | Ga0068857_101045493 | Ga0068857_1010454932 | 113 |
| 118 | 3300005578 | Ga0068854_101031648 | Ga0068854_1010316482 | 113 |
| 119 | 3300005614 | Ga0068856_100053489 | Ga0068856_1000534891 | 113 |
| 120 | 3300005614 | Ga0068856_100698264 | Ga0068856_1006982642 | 113 |
| 121 | 3300005614 | Ga0068856_100908069 | Ga0068856_1009080692 | 113 |
| 122 | 3300005614 | Ga0068856_101500491 | Ga0068856_1015004912 | 113 |
| 123 | 3300005614 | Ga0068856_101738171 | Ga0068856_1017381711 | 113 |
| 124 | 3300005615 | Ga0070702_101130285 | Ga0070702_1011302851 | 113 |
| 125 | 3300005616 | Ga0068852_100112097 | Ga0068852_1001120972 | 113 |
| 126 | 3300005616 | Ga0068852_100285476 | Ga0068852_1002854761 | 113 |
| 127 | 3300005616 | Ga0068852_100769561 | Ga0068852_1007695611 | 113 |
| 128 | 3300005616 | Ga0068852_102142351 | Ga0068852_1021423511 | 113 |
| 129 | 3300005617 | Ga0068859_100257553 | Ga0068859_1002575532 | 113 |
| 130 | 3300005618 | Ga0068864_100575673 | Ga0068864_1005756732 | 113 |
| 131 | 3300005718 | Ga0068866_10032314 | Ga0068866_100323143 | 113 |
| 132 | 3300005841 | Ga0068863_100241410 | Ga0068863_1002414102 | 113 |
| 133 | 3300005841 | Ga0068863_101526983 | Ga0068863_1015269831 | 113 |
| 134 | 3300005842 | Ga0068858_100027187 | Ga0068858_1000271874 | 113 |
| 135 | 3300005842 | Ga0068858_100511348 | Ga0068858_1005113481 | 113 |
| 136 | 3300005842 | Ga0068858_101674705 | Ga0068858_1016747052 | 113 |
| 137 | 3300005843 | Ga0068860_100172001 | Ga0068860_1001720013 | 113 |
| 138 | 3300005843 | Ga0068860_100342271 | Ga0068860_1003422712 | 113 |
| 139 | 3300005844 | Ga0068862_101238802 | Ga0068862_1012388022 | 113 |
| 140 | 3300005844 | Ga0068862_102225765 | Ga0068862_1022257652 | 113 |
| 141 | 3300006028 | Ga0070717_10766284 | Ga0070717_107662843 | 113 |
| 142 | 3300006175 | Ga0070712_100140201 | Ga0070712_1001402011 | 113 |
| 143 | 3300006237 | Ga0097621_100000101 | Ga0097621_10000010119 | 113 |
| 144 | 3300006237 | Ga0097621_100011653 | Ga0097621_10001165311 | 113 |
| 145 | 3300006237 | Ga0097621_100034035 | Ga0097621_1000340354 | 113 |
| 146 | 3300006237 | Ga0097621_100058087 | Ga0097621_1000580873 | 113 |
| 147 | 3300006237 | Ga0097621_100227440 | Ga0097621_1002274402 | 113 |
| 148 | 3300006237 | Ga0097621_100468125 | Ga0097621_1004681252 | 113 |
| 149 | 3300006237 | Ga0097621_100765146 | Ga0097621_1007651462 | 113 |
| 150 | 3300006237 | Ga0097621_100894469 | Ga0097621_1008944692 | 113 |
| 151 | 3300006237 | Ga0097621_101761505 | Ga0097621_1017615051 | 113 |
| 152 | 3300006358 | Ga0068871_100000360 | Ga0068871_10000036027 | 113 |
| 153 | 3300006358 | Ga0068871_100019146 | Ga0068871_1000191462 | 113 |
| 154 | 3300006358 | Ga0068871_100029042 | Ga0068871_1000290427 | 113 |
| 155 | 3300006358 | Ga0068871_100081673 | Ga0068871_1000816733 | 113 |
| 156 | 3300006358 | Ga0068871_100467383 | Ga0068871_1004673832 | 113 |
| 157 | 3300006358 | Ga0068871_100790603 | Ga0068871_1007906032 | 113 |
| 158 | 3300006358 | Ga0068871_101715783 | Ga0068871_1017157831 | 113 |
| 159 | 3300006881 | Ga0068865_100170333 | Ga0068865_1001703332 | 113 |
| 160 | 3300006881 | Ga0068865_100442877 | Ga0068865_1004428772 | 113 |
| 161 | 3300006881 | Ga0068865_100447088 | Ga0068865_1004470882 | 113 |
| 162 | 3300006931 | Ga0097620_100257539 | Ga0097620_1002575392 | 113 |
| 163 | 3300009093 | Ga0105240_10024685 | Ga0105240_100246853 | 113 |
| 164 | 3300009093 | Ga0105240_10123496 | Ga0105240_101234964 | 113 |
| 165 | 3300009093 | Ga0105240_10124554 | Ga0105240_101245543 | 113 |
| 166 | 3300009093 | Ga0105240_10131546 | Ga0105240_101315462 | 113 |
| 167 | 3300009093 | Ga0105240_10207074 | Ga0105240_102070742 | 113 |
| 168 | 3300009093 | Ga0105240_10290960 | Ga0105240_102909601 | 113 |
| 169 | 3300009093 | Ga0105240_10341823 | Ga0105240_103418232 | 113 |
| 170 | 3300009093 | Ga0105240_10402244 | Ga0105240_104022442 | 113 |
| 171 | 3300009093 | Ga0105240_10403867 | Ga0105240_104038672 | 113 |
| 172 | 3300009093 | Ga0105240_10641919 | Ga0105240_106419192 | 113 |
| 173 | 3300009093 | Ga0105240_11507777 | Ga0105240_115077772 | 113 |
| 174 | 3300009093 | Ga0105240_11697760 | Ga0105240_116977602 | 113 |
| 175 | 3300009093 | Ga0105240_11963312 | Ga0105240_119633121 | 113 |
| 176 | 3300009098 | Ga0105245_10006665 | Ga0105245_1000666510 | 113 |
| 177 | 3300009098 | Ga0105245_10154755 | Ga0105245_101547551 | 113 |
| 178 | 3300009098 | Ga0105245_10175333 | Ga0105245_101753332 | 113 |
| 179 | 3300009098 | Ga0105245_10341064 | Ga0105245_103410642 | 113 |
| 180 | 3300009098 | Ga0105245_10420102 | Ga0105245_104201022 | 113 |
| 181 | 3300009098 | Ga0105245_10426352 | Ga0105245_104263521 | 113 |
| 182 | 3300009098 | Ga0105245_12043017 | Ga0105245_120430172 | 113 |
| 183 | 3300009101 | Ga0105247_10283648 | Ga0105247_102836482 | 113 |
| 184 | 3300009101 | Ga0105247_10487831 | Ga0105247_104878312 | 113 |
| 185 | 3300009148 | Ga0105243_10008539 | Ga0105243_100085394 | 113 |
| 186 | 3300009148 | Ga0105243_10159370 | Ga0105243_101593701 | 113 |
| 187 | 3300009148 | Ga0105243_10796742 | Ga0105243_107967422 | 113 |
| 188 | 3300009174 | Ga0105241_10007579 | Ga0105241_100075797 | 113 |
| 189 | 3300009174 | Ga0105241_10128100 | Ga0105241_101281002 | 113 |
| 190 | 3300009174 | Ga0105241_10294921 | Ga0105241_102949212 | 113 |
| 191 | 3300009174 | Ga0105241_10310645 | Ga0105241_103106452 | 113 |
| 192 | 3300009174 | Ga0105241_10663084 | Ga0105241_106630842 | 113 |
| 193 | 3300009174 | Ga0105241_11110554 | Ga0105241_111105542 | 113 |
| 194 | 3300009174 | Ga0105241_11793913 | Ga0105241_117939132 | 113 |
| 195 | 3300009176 | Ga0105242_10044925 | Ga0105242_100449254 | 113 |
| 196 | 3300009176 | Ga0105242_10089847 | Ga0105242_100898472 | 113 |
| 197 | 3300009176 | Ga0105242_10284489 | Ga0105242_102844892 | 113 |
| 198 | 3300009176 | Ga0105242_10683239 | Ga0105242_106832392 | 113 |
| 199 | 3300009176 | Ga0105242_10795438 | Ga0105242_107954382 | 113 |
| 200 | 3300009176 | Ga0105242_11074991 | Ga0105242_110749912 | 113 |
| 201 | 3300009176 | Ga0105242_11109514 | Ga0105242_111095142 | 113 |
| 202 | 3300009177 | Ga0105248_10011629 | Ga0105248_100116299 | 113 |
| 203 | 3300009177 | Ga0105248_10656158 | Ga0105248_106561582 | 113 |
| 204 | 3300009177 | Ga0105248_10984467 | Ga0105248_109844672 | 113 |
| 205 | 3300009177 | Ga0105248_11113255 | Ga0105248_111132552 | 113 |
| 206 | 3300009177 | Ga0105248_11439785 | Ga0105248_114397852 | 113 |
| 207 | 3300009177 | Ga0105248_11463128 | Ga0105248_114631282 | 113 |
| 208 | 3300009177 | Ga0105248_12312329 | Ga0105248_123123291 | 113 |
| 209 | 3300009545 | Ga0105237_10006194 | Ga0105237_100061947 | 113 |
| 210 | 3300009545 | Ga0105237_10081506 | Ga0105237_100815062 | 113 |
| 211 | 3300009545 | Ga0105237_10221318 | Ga0105237_102213182 | 113 |
| 212 | 3300009545 | Ga0105237_10306422 | Ga0105237_103064222 | 113 |
| 213 | 3300009545 | Ga0105237_10603930 | Ga0105237_106039302 | 113 |
| 214 | 3300009551 | Ga0105238_10021159 | Ga0105238_100211592 | 113 |
| 215 | 3300009551 | Ga0105238_10026274 | Ga0105238_100262742 | 113 |
| 216 | 3300009551 | Ga0105238_10027761 | Ga0105238_100277613 | 113 |
| 217 | 3300009551 | Ga0105238_10054332 | Ga0105238_100543324 | 113 |
| 218 | 3300009551 | Ga0105238_10101025 | Ga0105238_101010252 | 113 |
| 219 | 3300009551 | Ga0105238_10163931 | Ga0105238_101639312 | 113 |
| 220 | 3300009551 | Ga0105238_10333807 | Ga0105238_103338072 | 113 |
| 221 | 3300009551 | Ga0105238_10347896 | Ga0105238_103478962 | 113 |
| 222 | 3300009551 | Ga0105238_10360848 | Ga0105238_103608482 | 113 |
| 223 | 3300009551 | Ga0105238_11679978 | Ga0105238_116799782 | 113 |
| 224 | 3300009551 | Ga0105238_12977158 | Ga0105238_129771581 | 113 |
| 225 | 3300009553 | Ga0105249_10022197 | Ga0105249_100221979 | 113 |
| 226 | 3300009553 | Ga0105249_10643043 | Ga0105249_106430432 | 113 |
| 227 | 3300010375 | Ga0105239_10000773 | Ga0105239_1000077310 | 113 |
| 228 | 3300010375 | Ga0105239_10005761 | Ga0105239_1000576115 | 113 |
| 229 | 3300010375 | Ga0105239_10033970 | Ga0105239_100339709 | 113 |
| 230 | 3300010375 | Ga0105239_10094234 | Ga0105239_100942342 | 113 |
| 231 | 3300010375 | Ga0105239_10137495 | Ga0105239_101374953 | 113 |
| 232 | 3300010375 | Ga0105239_10155140 | Ga0105239_101551402 | 113 |
| 233 | 3300010375 | Ga0105239_10307089 | Ga0105239_103070891 | 113 |
| 234 | 3300010375 | Ga0105239_10386595 | Ga0105239_103865952 | 113 |
| 235 | 3300010375 | Ga0105239_10719255 | Ga0105239_107192552 | 113 |
| 236 | 3300010375 | Ga0105239_10738224 | Ga0105239_107382242 | 113 |
| 237 | 3300010375 | Ga0105239_11870747 | Ga0105239_118707472 | 113 |
| 238 | 3300010375 | Ga0105239_12110883 | Ga0105239_121108831 | 113 |
| 239 | 3300011119 | Ga0105246_10007879 | Ga0105246_100078792 | 113 |
| 240 | 3300011119 | Ga0105246_10025631 | Ga0105246_100256314 | 113 |
| 241 | 3300011119 | Ga0105246_10250915 | Ga0105246_102509152 | 113 |
| 242 | 3300011119 | Ga0105246_12050264 | Ga0105246_120502641 | 113 |
| 243 | 3300011119 | Ga0105246_12081611 | Ga0105246_120816111 | 113 |
| 244 | 3300013100 | Ga0157373_10113430 | Ga0157373_101134302 | 113 |
| 245 | 3300013100 | Ga0157373_10203172 | Ga0157373_102031723 | 113 |
| 246 | 3300013104 | Ga0157370_10308175 | Ga0157370_103081751 | 113 |
| 247 | 3300013104 | Ga0157370_11085276 | Ga0157370_110852762 | 113 |
| 248 | 3300013104 | Ga0157370_11349593 | Ga0157370_113495931 | 113 |
| 249 | 3300013105 | Ga0157369_10006833 | Ga0157369_100068337 | 113 |
| 250 | 3300013105 | Ga0157369_10093221 | Ga0157369_100932212 | 113 |
| 251 | 3300013105 | Ga0157369_10308078 | Ga0157369_103080782 | 113 |
| 252 | 3300013105 | Ga0157369_11218944 | Ga0157369_112189442 | 113 |
| 253 | 3300013296 | Ga0157374_10218974 | Ga0157374_102189742 | 113 |
| 254 | 3300013296 | Ga0157374_10452703 | Ga0157374_104527032 | 113 |
| 255 | 3300013296 | Ga0157374_10602680 | Ga0157374_106026801 | 113 |
| 256 | 3300013296 | Ga0157374_11238152 | Ga0157374_112381522 | 113 |
| 257 | 3300013296 | Ga0157374_11857461 | Ga0157374_118574611 | 113 |
| 258 | 3300013296 | Ga0157374_12011069 | Ga0157374_120110692 | 113 |
| 259 | 3300013297 | Ga0157378_10071851 | Ga0157378_100718512 | 113 |
| 260 | 3300013297 | Ga0157378_10110509 | Ga0157378_101105092 | 113 |
| 261 | 3300013297 | Ga0157378_10245859 | Ga0157378_102458592 | 113 |
| 262 | 3300013297 | Ga0157378_10851818 | Ga0157378_108518182 | 113 |
| 263 | 3300013297 | Ga0157378_10894072 | Ga0157378_108940722 | 113 |
| 264 | 3300013306 | Ga0163162_10007963 | Ga0163162_100079637 | 113 |
| 265 | 3300013306 | Ga0163162_10017004 | Ga0163162_1001700412 | 113 |
| 266 | 3300013306 | Ga0163162_10337398 | Ga0163162_103373982 | 113 |
| 267 | 3300013306 | Ga0163162_10376038 | Ga0163162_103760382 | 113 |
| 268 | 3300013306 | Ga0163162_10978312 | Ga0163162_109783122 | 113 |
| 269 | 3300013307 | Ga0157372_10599295 | Ga0157372_105992952 | 113 |
| 270 | 3300013307 | Ga0157372_10989414 | Ga0157372_109894142 | 113 |
| 271 | 3300013307 | Ga0157372_11297056 | Ga0157372_112970562 | 113 |
| 272 | 3300013307 | Ga0157372_13408340 | Ga0157372_134083401 | 113 |
| 273 | 3300013308 | Ga0157375_10062618 | Ga0157375_100626184 | 113 |
| 274 | 3300013308 | Ga0157375_10457413 | Ga0157375_104574132 | 113 |
| 275 | 3300013308 | Ga0157375_11384954 | Ga0157375_113849541 | 113 |
| 276 | 3300013308 | Ga0157375_11454083 | Ga0157375_114540832 | 113 |
| 277 | 3300014325 | Ga0163163_10000002 | Ga0163163_10000002531 | 113 |
| 278 | 3300014325 | Ga0163163_10046548 | Ga0163163_100465482 | 113 |
| 279 | 3300014325 | Ga0163163_10376517 | Ga0163163_103765172 | 113 |
| 280 | 3300014325 | Ga0163163_10659927 | Ga0163163_106599272 | 113 |
| 281 | 3300014326 | Ga0157380_10394813 | Ga0157380_103948132 | 113 |
| 282 | 3300014326 | Ga0157380_10623189 | Ga0157380_106231892 | 113 |
| 283 | 3300014968 | Ga0157379_10002165 | Ga0157379_100021652 | 113 |
| 284 | 3300014968 | Ga0157379_10008033 | Ga0157379_1000803310 | 113 |
| 285 | 3300014968 | Ga0157379_10338991 | Ga0157379_103389912 | 113 |
| 286 | 3300014968 | Ga0157379_10409263 | Ga0157379_104092631 | 113 |
| 287 | 3300014968 | Ga0157379_10441522 | Ga0157379_104415222 | 113 |
| 288 | 3300014969 | Ga0157376_10032666 | Ga0157376_100326662 | 113 |
| 289 | 3300014969 | Ga0157376_10391557 | Ga0157376_103915572 | 113 |
| 290 | 3300014969 | Ga0157376_10676179 | Ga0157376_106761792 | 113 |
| 291 | 3300014969 | Ga0157376_11432646 | Ga0157376_114326461 | 113 |
| 292 | 3300014969 | Ga0157376_11563866 | Ga0157376_115638662 | 113 |
| 293 | 3300014969 | Ga0157376_11851259 | Ga0157376_118512591 | 113 |
| 294 | 3300017792 | Ga0163161_10012129 | Ga0163161_100121298 | 113 |
| 295 | 3300017792 | Ga0163161_11816775 | Ga0163161_118167752 | 113 |
| 296 | 3300021361 | Ga0213872_10387999 | Ga0213872_103879991 | 113 |
| 297 | 3300025261 | Ga0209233_1000015 | Ga0209233_1000015133 | 113 |
| 298 | 3300025261 | Ga0209233_1013510 | Ga0209233_10135102 | 113 |
| 299 | 3300025272 | Ga0209455_1037664 | Ga0209455_10376642 | 113 |
| 300 | 3300025297 | Ga0209758_1000013 | Ga0209758_1000013653 | 113 |
| 301 | 3300025893 | Ga0207682_10196467 | Ga0207682_101964672 | 113 |
| 302 | 3300025893 | Ga0207682_10286502 | Ga0207682_102865022 | 113 |
| 303 | 3300025898 | Ga0207692_10503768 | Ga0207692_105037682 | 113 |
| 304 | 3300025899 | Ga0207642_10775903 | Ga0207642_107759032 | 113 |
| 305 | 3300025901 | Ga0207688_10046283 | Ga0207688_100462832 | 113 |
| 306 | 3300025903 | Ga0207680_10061233 | Ga0207680_100612332 | 113 |
| 307 | 3300025907 | Ga0207645_10012251 | Ga0207645_100122512 | 113 |
| 308 | 3300025907 | Ga0207645_10202490 | Ga0207645_102024902 | 113 |
| 309 | 3300025909 | Ga0207705_10013726 | Ga0207705_100137262 | 113 |
| 310 | 3300025909 | Ga0207705_10023616 | Ga0207705_100236162 | 113 |
| 311 | 3300025909 | Ga0207705_10762388 | Ga0207705_107623882 | 113 |
| 312 | 3300025909 | Ga0207705_11000440 | Ga0207705_110004402 | 113 |
| 313 | 3300025911 | Ga0207654_10183605 | Ga0207654_101836052 | 113 |
| 314 | 3300025911 | Ga0207654_10279973 | Ga0207654_102799732 | 113 |
| 315 | 3300025911 | Ga0207654_10421701 | Ga0207654_104217012 | 113 |
| 316 | 3300025911 | Ga0207654_10442703 | Ga0207654_104427032 | 113 |
| 317 | 3300025912 | Ga0207707_10079800 | Ga0207707_100798004 | 113 |
| 318 | 3300025912 | Ga0207707_10842925 | Ga0207707_108429252 | 113 |
| 319 | 3300025913 | Ga0207695_10009553 | Ga0207695_1000955312 | 113 |
| 320 | 3300025913 | Ga0207695_10014852 | Ga0207695_100148526 | 113 |
| 321 | 3300025913 | Ga0207695_10086177 | Ga0207695_100861771 | 113 |
| 322 | 3300025913 | Ga0207695_10094972 | Ga0207695_100949722 | 113 |
| 323 | 3300025913 | Ga0207695_10095356 | Ga0207695_100953563 | 113 |
| 324 | 3300025913 | Ga0207695_10196644 | Ga0207695_101966442 | 113 |
| 325 | 3300025913 | Ga0207695_10223533 | Ga0207695_102235332 | 113 |
| 326 | 3300025913 | Ga0207695_10280228 | Ga0207695_102802282 | 113 |
| 327 | 3300025913 | Ga0207695_10331027 | Ga0207695_103310272 | 113 |
| 328 | 3300025913 | Ga0207695_10814812 | Ga0207695_108148122 | 113 |
| 329 | 3300025913 | Ga0207695_11273852 | Ga0207695_112738521 | 113 |
| 330 | 3300025914 | Ga0207671_10042949 | Ga0207671_100429493 | 113 |
| 331 | 3300025914 | Ga0207671_10063932 | Ga0207671_100639322 | 113 |
| 332 | 3300025914 | Ga0207671_10071874 | Ga0207671_100718742 | 113 |
| 333 | 3300025914 | Ga0207671_10177693 | Ga0207671_101776932 | 113 |
| 334 | 3300025914 | Ga0207671_10910518 | Ga0207671_109105182 | 113 |
| 335 | 3300025915 | Ga0207693_11249677 | Ga0207693_112496771 | 113 |
| 336 | 3300025917 | Ga0207660_10075357 | Ga0207660_100753573 | 113 |
| 337 | 3300025917 | Ga0207660_10599209 | Ga0207660_105992092 | 113 |
| 338 | 3300025919 | Ga0207657_10093351 | Ga0207657_100933512 | 113 |
| 339 | 3300025919 | Ga0207657_10148135 | Ga0207657_101481352 | 113 |
| 340 | 3300025919 | Ga0207657_10206830 | Ga0207657_102068302 | 113 |
| 341 | 3300025919 | Ga0207657_10879797 | Ga0207657_108797972 | 113 |
| 342 | 3300025919 | Ga0207657_10971392 | Ga0207657_109713922 | 113 |
| 343 | 3300025920 | Ga0207649_10000154 | Ga0207649_1000015427 | 113 |
| 344 | 3300025920 | Ga0207649_10064343 | Ga0207649_100643432 | 113 |
| 345 | 3300025920 | Ga0207649_10143320 | Ga0207649_101433202 | 113 |
| 346 | 3300025920 | Ga0207649_10479626 | Ga0207649_104796261 | 113 |
| 347 | 3300025921 | Ga0207652_10039728 | Ga0207652_100397283 | 113 |
| 348 | 3300025921 | Ga0207652_10086124 | Ga0207652_100861242 | 113 |
| 349 | 3300025921 | Ga0207652_10237262 | Ga0207652_102372622 | 113 |
| 350 | 3300025921 | Ga0207652_10664389 | Ga0207652_106643891 | 113 |
| 351 | 3300025924 | Ga0207694_10000005 | Ga0207694_10000005112 | 113 |
| 352 | 3300025924 | Ga0207694_10062919 | Ga0207694_100629192 | 113 |
| 353 | 3300025924 | Ga0207694_10245087 | Ga0207694_102450872 | 113 |
| 354 | 3300025924 | Ga0207694_10326452 | Ga0207694_103264521 | 113 |
| 355 | 3300025924 | Ga0207694_10497800 | Ga0207694_104978002 | 113 |
| 356 | 3300025924 | Ga0207694_10802022 | Ga0207694_108020222 | 113 |
| 357 | 3300025925 | Ga0207650_10212763 | Ga0207650_102127632 | 113 |
| 358 | 3300025925 | Ga0207650_10330052 | Ga0207650_103300522 | 113 |
| 359 | 3300025926 | Ga0207659_10188169 | Ga0207659_101881692 | 113 |
| 360 | 3300025926 | Ga0207659_10344040 | Ga0207659_103440402 | 113 |
| 361 | 3300025926 | Ga0207659_11714851 | Ga0207659_117148511 | 113 |
| 362 | 3300025927 | Ga0207687_10009197 | Ga0207687_100091976 | 113 |
| 363 | 3300025927 | Ga0207687_10019917 | Ga0207687_100199174 | 113 |
| 364 | 3300025927 | Ga0207687_10098518 | Ga0207687_100985182 | 113 |
| 365 | 3300025927 | Ga0207687_10226890 | Ga0207687_102268902 | 113 |
| 366 | 3300025929 | Ga0207664_10135221 | Ga0207664_101352212 | 113 |
| 367 | 3300025931 | Ga0207644_10674731 | Ga0207644_106747312 | 113 |
| 368 | 3300025932 | Ga0207690_10204139 | Ga0207690_102041392 | 113 |
| 369 | 3300025932 | Ga0207690_10478627 | Ga0207690_104786272 | 113 |
| 370 | 3300025932 | Ga0207690_10509621 | Ga0207690_105096212 | 113 |
| 371 | 3300025934 | Ga0207686_10064734 | Ga0207686_100647343 | 113 |
| 372 | 3300025934 | Ga0207686_10078192 | Ga0207686_100781923 | 113 |
| 373 | 3300025934 | Ga0207686_10110128 | Ga0207686_101101282 | 113 |
| 374 | 3300025934 | Ga0207686_11269832 | Ga0207686_112698322 | 113 |
| 375 | 3300025935 | Ga0207709_10003554 | Ga0207709_100035545 | 113 |
| 376 | 3300025936 | Ga0207670_10048540 | Ga0207670_100485402 | 113 |
| 377 | 3300025937 | Ga0207669_11216068 | Ga0207669_112160681 | 113 |
| 378 | 3300025938 | Ga0207704_10101507 | Ga0207704_101015072 | 113 |
| 379 | 3300025938 | Ga0207704_10217172 | Ga0207704_102171722 | 113 |
| 380 | 3300025938 | Ga0207704_10957345 | Ga0207704_109573452 | 113 |
| 381 | 3300025940 | Ga0207691_10327109 | Ga0207691_103271092 | 113 |
| 382 | 3300025940 | Ga0207691_10454130 | Ga0207691_104541302 | 113 |
| 383 | 3300025940 | Ga0207691_11201930 | Ga0207691_112019302 | 113 |
| 384 | 3300025941 | Ga0207711_10017346 | Ga0207711_100173463 | 113 |
| 385 | 3300025941 | Ga0207711_10733953 | Ga0207711_107339532 | 113 |
| 386 | 3300025942 | Ga0207689_10090030 | Ga0207689_100900302 | 113 |
| 387 | 3300025942 | Ga0207689_10197182 | Ga0207689_101971822 | 113 |
| 388 | 3300025942 | Ga0207689_10221631 | Ga0207689_102216312 | 113 |
| 389 | 3300025944 | Ga0207661_10334937 | Ga0207661_103349373 | 113 |
| 390 | 3300025944 | Ga0207661_10412591 | Ga0207661_104125912 | 113 |
| 391 | 3300025944 | Ga0207661_11436908 | Ga0207661_114369082 | 113 |
| 392 | 3300025949 | Ga0207667_10000061 | Ga0207667_10000061158 | 113 |
| 393 | 3300025949 | Ga0207667_10102112 | Ga0207667_101021122 | 113 |
| 394 | 3300025949 | Ga0207667_10209669 | Ga0207667_102096693 | 113 |
| 395 | 3300025949 | Ga0207667_11210835 | Ga0207667_112108352 | 113 |
| 396 | 3300025960 | Ga0207651_10121242 | Ga0207651_101212422 | 113 |
| 397 | 3300025960 | Ga0207651_10207970 | Ga0207651_102079702 | 113 |
| 398 | 3300025960 | Ga0207651_11276443 | Ga0207651_112764432 | 113 |
| 399 | 3300025961 | Ga0207712_10590589 | Ga0207712_105905891 | 113 |
| 400 | 3300025961 | Ga0207712_10965382 | Ga0207712_109653821 | 113 |
| 401 | 3300025972 | Ga0207668_11215984 | Ga0207668_112159842 | 113 |
| 402 | 3300025986 | Ga0207658_10123750 | Ga0207658_101237502 | 113 |
| 403 | 3300025986 | Ga0207658_10205232 | Ga0207658_102052322 | 113 |
| 404 | 3300025986 | Ga0207658_10306719 | Ga0207658_103067191 | 113 |
| 405 | 3300025986 | Ga0207658_10495163 | Ga0207658_104951632 | 113 |
| 406 | 3300026023 | Ga0207677_10037356 | Ga0207677_100373563 | 113 |
| 407 | 3300026023 | Ga0207677_10300917 | Ga0207677_103009172 | 113 |
| 408 | 3300026023 | Ga0207677_10655283 | Ga0207677_106552832 | 113 |
| 409 | 3300026023 | Ga0207677_10764671 | Ga0207677_107646712 | 113 |
| 410 | 3300026035 | Ga0207703_10148001 | Ga0207703_101480012 | 113 |
| 411 | 3300026035 | Ga0207703_10661906 | Ga0207703_106619062 | 113 |
| 412 | 3300026035 | Ga0207703_11329333 | Ga0207703_113293331 | 113 |
| 413 | 3300026041 | Ga0207639_10077628 | Ga0207639_100776282 | 113 |
| 414 | 3300026041 | Ga0207639_10225952 | Ga0207639_102259521 | 113 |
| 415 | 3300026041 | Ga0207639_10792242 | Ga0207639_107922422 | 113 |
| 416 | 3300026041 | Ga0207639_10854120 | Ga0207639_108541202 | 113 |
| 417 | 3300026041 | Ga0207639_10899508 | Ga0207639_108995082 | 113 |
| 418 | 3300026041 | Ga0207639_11475173 | Ga0207639_114751732 | 113 |
| 419 | 3300026075 | Ga0207708_10825482 | Ga0207708_108254822 | 113 |
| 420 | 3300026078 | Ga0207702_10322797 | Ga0207702_103227972 | 113 |
| 421 | 3300026078 | Ga0207702_10513293 | Ga0207702_105132932 | 113 |
| 422 | 3300026078 | Ga0207702_10605112 | Ga0207702_106051122 | 113 |
| 423 | 3300026078 | Ga0207702_10747563 | Ga0207702_107475631 | 113 |
| 424 | 3300026078 | Ga0207702_11287772 | Ga0207702_112877722 | 113 |
| 425 | 3300026078 | Ga0207702_12083602 | Ga0207702_120836022 | 113 |
| 426 | 3300026088 | Ga0207641_10574161 | Ga0207641_105741612 | 113 |
| 427 | 3300026088 | Ga0207641_10835318 | Ga0207641_108353182 | 113 |
| 428 | 3300026088 | Ga0207641_12268575 | Ga0207641_122685751 | 113 |
| 429 | 3300026089 | Ga0207648_10044599 | Ga0207648_100445994 | 113 |
| 430 | 3300026089 | Ga0207648_10305595 | Ga0207648_103055952 | 113 |
| 431 | 3300026089 | Ga0207648_10910601 | Ga0207648_109106012 | 113 |
| 432 | 3300026116 | Ga0207674_10019842 | Ga0207674_100198425 | 113 |
| 433 | 3300026116 | Ga0207674_10101739 | Ga0207674_101017392 | 113 |
| 434 | 3300026116 | Ga0207674_10189883 | Ga0207674_101898833 | 113 |
| 435 | 3300026116 | Ga0207674_10489372 | Ga0207674_104893722 | 113 |
| 436 | 3300026116 | Ga0207674_11440775 | Ga0207674_114407752 | 113 |
| 437 | 3300026118 | Ga0207675_101417446 | Ga0207675_1014174462 | 113 |
| 438 | 3300026121 | Ga0207683_10008807 | Ga0207683_1000880713 | 113 |
| 439 | 3300026121 | Ga0207683_10019373 | Ga0207683_100193735 | 113 |
| 440 | 3300026121 | Ga0207683_10142869 | Ga0207683_101428692 | 113 |
| 441 | 3300026121 | Ga0207683_10336105 | Ga0207683_103361053 | 113 |
| 442 | 3300026121 | Ga0207683_10848938 | Ga0207683_108489382 | 113 |
| 443 | 3300026142 | Ga0207698_10104179 | Ga0207698_101041792 | 113 |
| 444 | 3300026142 | Ga0207698_10181392 | Ga0207698_101813922 | 113 |
| 445 | 3300026142 | Ga0207698_10206210 | Ga0207698_102062102 | 113 |
| 446 | 3300026142 | Ga0207698_11545910 | Ga0207698_115459102 | 113 |
| 447 | 3300026142 | Ga0207698_11580649 | Ga0207698_115806492 | 113 |
| 448 | 3300028379 | Ga0268266_10000695 | Ga0268266_1000069513 | 113 |
| 449 | 3300028379 | Ga0268266_10022016 | Ga0268266_100220164 | 113 |
| 450 | 3300028379 | Ga0268266_10131661 | Ga0268266_101316612 | 113 |
| 451 | 3300028379 | Ga0268266_10139343 | Ga0268266_101393432 | 113 |
| 452 | 3300028379 | Ga0268266_10169932 | Ga0268266_101699323 | 113 |
| 453 | 3300028379 | Ga0268266_10230934 | Ga0268266_102309342 | 113 |
| 454 | 3300028379 | Ga0268266_10238747 | Ga0268266_102387472 | 113 |
| 455 | 3300028379 | Ga0268266_10389306 | Ga0268266_103893062 | 113 |
| 456 | 3300028379 | Ga0268266_10594696 | Ga0268266_105946962 | 113 |
| 457 | 3300028379 | Ga0268266_10942418 | Ga0268266_109424182 | 113 |
| 458 | 3300028380 | Ga0268265_10842929 | Ga0268265_108429291 | 113 |
| 459 | 3300028381 | Ga0268264_10873627 | Ga0268264_108736272 | 113 |
| 460 | 3300028573 | Ga0265334_10347447 | Ga0265334_103474471 | 113 |
| 461 | 3300028577 | Ga0265318_10003384 | Ga0265318_100033844 | 113 |
| 462 | 3300028577 | Ga0265318_10366214 | Ga0265318_103662142 | 113 |
| 463 | 3300028800 | Ga0265338_10022918 | Ga0265338_100229182 | 113 |
| 464 | 3300031235 | Ga0265330_10004583 | Ga0265330_100045832 | 113 |
| 465 | 3300031235 | Ga0265330_10025693 | Ga0265330_100256932 | 113 |
| 466 | 3300031235 | Ga0265330_10129090 | Ga0265330_101290902 | 113 |
| 467 | 3300031235 | Ga0265330_10198576 | Ga0265330_101985762 | 113 |
| 468 | 3300031238 | Ga0265332_10098715 | Ga0265332_100987151 | 113 |
| 469 | 3300031238 | Ga0265332_10120360 | Ga0265332_101203601 | 113 |
| 470 | 3300031238 | Ga0265332_10411277 | Ga0265332_104112772 | 113 |
| 471 | 3300031239 | Ga0265328_10072595 | Ga0265328_100725952 | 113 |
| 472 | 3300031239 | Ga0265328_10343895 | Ga0265328_103438952 | 113 |
| 473 | 3300031240 | Ga0265320_10289178 | Ga0265320_102891782 | 113 |
| 474 | 3300031241 | Ga0265325_10014465 | Ga0265325_100144654 | 113 |
| 475 | 3300031241 | Ga0265325_10033117 | Ga0265325_100331173 | 113 |
| 476 | 3300031241 | Ga0265325_10142454 | Ga0265325_101424542 | 113 |
| 477 | 3300031247 | Ga0265340_10000045 | Ga0265340_1000004535 | 113 |
| 478 | 3300031247 | Ga0265340_10245018 | Ga0265340_102450182 | 113 |
| 479 | 3300031247 | Ga0265340_10407665 | Ga0265340_104076652 | 113 |
| 480 | 3300031249 | Ga0265339_10011572 | Ga0265339_100115724 | 113 |
| 481 | 3300031249 | Ga0265339_10094711 | Ga0265339_100947111 | 113 |
| 482 | 3300031249 | Ga0265339_10184775 | Ga0265339_101847751 | 113 |
| 483 | 3300031249 | Ga0265339_10607311 | Ga0265339_106073112 | 113 |
| 484 | 3300031250 | Ga0265331_10000113 | Ga0265331_1000011385 | 113 |
| 485 | 3300031250 | Ga0265331_10032183 | Ga0265331_100321832 | 113 |
| 486 | 3300031250 | Ga0265331_10073193 | Ga0265331_100731932 | 113 |
| 487 | 3300031250 | Ga0265331_10126046 | Ga0265331_101260462 | 113 |
| 488 | 3300031344 | Ga0265316_10021874 | Ga0265316_100218743 | 113 |
| 489 | 3300031344 | Ga0265316_10089537 | Ga0265316_100895372 | 113 |
| 490 | 3300031344 | Ga0265316_10135749 | Ga0265316_101357493 | 113 |
| 491 | 3300031344 | Ga0265316_10265375 | Ga0265316_102653752 | 113 |
| 492 | 3300031344 | Ga0265316_10390079 | Ga0265316_103900791 | 113 |
| 493 | 3300031456 | Ga0307513_10519726 | Ga0307513_105197262 | 113 |
| 494 | 3300031595 | Ga0265313_10016173 | Ga0265313_100161732 | 113 |
| 495 | 3300031595 | Ga0265313_10017499 | Ga0265313_100174992 | 113 |
| 496 | 3300031595 | Ga0265313_10198786 | Ga0265313_101987862 | 113 |
| 497 | 3300031711 | Ga0265314_10006495 | Ga0265314_100064958 | 113 |
| 498 | 3300031711 | Ga0265314_10029553 | Ga0265314_100295532 | 113 |
| 499 | 3300031711 | Ga0265314_10033294 | Ga0265314_100332942 | 113 |
| 500 | 3300031711 | Ga0265314_10045594 | Ga0265314_100455943 | 113 |
| 501 | 3300031711 | Ga0265314_10097346 | Ga0265314_100973462 | 113 |
| 502 | 3300031711 | Ga0265314_10247942 | Ga0265314_102479422 | 113 |
| 503 | 3300031711 | Ga0265314_10601940 | Ga0265314_106019401 | 113 |
| 504 | 3300031712 | Ga0265342_10018674 | Ga0265342_100186747 | 113 |
| 505 | 3300031712 | Ga0265342_10045634 | Ga0265342_100456342 | 113 |
| 506 | 3300031712 | Ga0265342_10069717 | Ga0265342_100697172 | 113 |
| 507 | 3300031712 | Ga0265342_10145502 | Ga0265342_101455022 | 113 |
| 508 | 3300031712 | Ga0265342_10163821 | Ga0265342_101638212 | 113 |
| 509 | 3300031730 | Ga0307516_10059575 | Ga0307516_100595754 | 113 |
| 510 | 3300031730 | Ga0307516_10192641 | Ga0307516_101926412 | 113 |
| 511 | 3300031730 | Ga0307516_10231713 | Ga0307516_102317132 | 113 |
| 512 | 3300031824 | Ga0307413_11513331 | Ga0307413_115133312 | 113 |
| 513 | 3300035112 | Ga0373932_0243788 | Ga0373932_0243788_248_589 | 113 |
| 514 | 3300035692 | Ga0373935_0659309 | Ga0373935_0659309_400_744 | 113 |
| 515 | 3300036401 | Ga0373937_0744256 | Ga0373937_0744256_130_471 | 113 |
| 516 | 3300037312 | Ga0395899_0069184 | Ga0395899_0069184_1593_1934 | 113 |
| 517 | 3300037418 | Ga0395900_0010488 | Ga0395900_0010488_4977_5318 | 113 |
| 518 | 3300037418 | Ga0395900_0218624 | Ga0395900_0218624_1294_1635 | 113 |
| 519 | 3300037466 | Ga0395898_0008354 | Ga0395898_0008354_766_1107 | 113 |
| 520 | 3300037466 | Ga0395898_0045250 | Ga0395898_0045250_1801_2142 | 113 |
| 521 | 3300038443 | Ga0395901_0167509 | Ga0395901_0167509_661_1002 | 113 |
| 522 | 3300039437 | Ga0436365_1687461 | Ga0436365_1687461_280_621 | 113 |
| 523 | 3300039447 | Ga0436361_0180372 | Ga0436361_0180372_188_529 | 113 |
| 524 | 3300041441 | Ga0451787_799516 | Ga0451787_799516_62_403 | 113 |
| 525 | 3300044694 | Ga0466963_1218914 | Ga0466963_1218914_172_513 | 113 |
| 526 | 3300044842 | Ga0466957_0457269 | Ga0466957_0457269_154_495 | 113 |
| 527 | 3300045976 | Ga0466967_0748036 | Ga0466967_0748036_49_390 | 113 |
| 528 | 3300046454 | Ga0495592_0715296 | Ga0495592_0715296_60_401 | 113 |
| 529 | 3300046471 | Ga0495650_0334024 | Ga0495650_0334024_35_376 | 113 |
| 530 | 3300046492 | Ga0495585_0412578 | Ga0495585_0412578_56_397 | 113 |
| 531 | 3300046499 | Ga0495594_0371709 | Ga0495594_0371709_76_417 | 113 |
| 532 | 3300046507 | Ga0495606_0320179 | Ga0495606_0320179_297_638 | 113 |
| 533 | 3300046514 | Ga0495618_0555183 | Ga0495618_0555183_247_588 | 113 |
| 534 | 3300046515 | Ga0495620_0198172 | Ga0495620_0198172_11_352 | 113 |
| 535 | 3300046515 | Ga0495620_0382723 | Ga0495620_0382723_73_414 | 113 |
| 536 | 3300046523 | Ga0495644_0073952 | Ga0495644_0073952_611_952 | 113 |
| 537 | 3300046524 | Ga0495648_0103502 | Ga0495648_0103502_262_603 | 113 |
| 538 | 3300046529 | Ga0495652_0090157 | Ga0495652_0090157_2037_2381 | 113 |
| 539 | 3300046529 | Ga0495652_0227147 | Ga0495652_0227147_903_1244 | 113 |
| 540 | 3300046530 | Ga0495654_0070804 | Ga0495654_0070804_24_365 | 113 |
| 541 | 3300046536 | Ga0495587_0318924 | Ga0495587_0318924_133_477 | 113 |
| 542 | 3300046536 | Ga0495587_0582405 | Ga0495587_0582405_95_436 | 113 |
| 543 | 3300046538 | Ga0495609_0022902 | Ga0495609_0022902_207_548 | 113 |
| 544 | 3300046539 | Ga0495621_0063918 | Ga0495621_0063918_192_533 | 113 |
| 545 | 3300046557 | Ga0495622_0012617 | Ga0495622_0012617_1397_1738 | 113 |
| 546 | 3300046559 | Ga0495667_0423198 | Ga0495667_0423198_454_798 | 113 |
| 547 | 3300046642 | Ga0495634_0816620 | Ga0495634_0816620_49_390 | 113 |
| 548 | 3300046648 | Ga0495611_0324553 | Ga0495611_0324553_326_667 | 113 |
| 549 | 3300046675 | Ga0495657_0425743 | Ga0495657_0425743_13_354 | 113 |
| 550 | 3300046675 | Ga0495657_0511511 | Ga0495657_0511511_13_354 | 113 |
| 551 | 3300046679 | Ga0495623_0169952 | Ga0495623_0169952_790_1131 | 113 |
| 552 | 3300046689 | Ga0495613_0234497 | Ga0495613_0234497_734_1075 | 113 |
| 553 | 3300046690 | Ga0495624_0690953 | Ga0495624_0690953_144_485 | 113 |
| 554 | 3300046694 | Ga0495649_0182687 | Ga0495649_0182687_345_686 | 113 |
| 555 | 3300047317 | Ga0495604_0806832 | Ga0495604_0806832_46_387 | 113 |
| 556 | 3300047320 | Ga0495672_0147535 | Ga0495672_0147535_400_741 | 113 |
| 557 | 3300047320 | Ga0495672_0313084 | Ga0495672_0313084_140_481 | 113 |
| 558 | 3300047321 | Ga0495676_0696077 | Ga0495676_0696077_79_420 | 113 |
| 559 | 3300048088 | Ga0495602_0023569 | Ga0495602_0023569_1863_2204 | 113 |
| 560 | 3300048088 | Ga0495602_0719205 | Ga0495602_0719205_93_434 | 113 |
| 561 | 3300048903 | Ga0496100_1094406 | Ga0496100_1094406_237_596 | 113 |
| 562 | 3300048904 | Ga0496101_0877094 | Ga0496101_0877094_76_417 | 113 |
| 563 | 3300048910 | Ga0496107_1105017 | Ga0496107_1105017_118_459 | 113 |
| 564 | 3300048924 | Ga0496121_0000527 | Ga0496121_0000527_31014_31355 | 113 |
| 565 | 3300048924 | Ga0496121_0522411 | Ga0496121_0522411_259_600 | 113 |
| 566 | 3300048929 | Ga0496126_0128976 | Ga0496126_0128976_334_675 | 113 |
| 567 | 3300049460 | Ga0495682_0001570 | Ga0495682_0001570_9309_9653 | 113 |
| 568 | 3300049568 | Ga0501031_0010452 | Ga0501031_0010452_278_619 | 113 |
| 569 | 3300049568 | Ga0501031_0248295 | Ga0501031_0248295_30_371 | 113 |
| 570 | 3300049568 | Ga0501031_0290003 | Ga0501031_0290003_547_891 | 113 |
| 571 | 3300049568 | Ga0501031_0504673 | Ga0501031_0504673_378_719 | 113 |
| 572 | 3300049568 | Ga0501031_0894323 | Ga0501031_0894323_64_405 | 113 |
| 573 | 3300049569 | Ga0501032_0005257 | Ga0501032_0005257_6240_6581 | 113 |
| 574 | 3300049569 | Ga0501032_0208279 | Ga0501032_0208279_618_962 | 113 |
| 575 | 3300049569 | Ga0501032_0241709 | Ga0501032_0241709_696_1037 | 113 |
| 576 | 3300049569 | Ga0501032_0420884 | Ga0501032_0420884_281_622 | 113 |
| 577 | 3300049569 | Ga0501032_0513743 | Ga0501032_0513743_334_675 | 113 |
| 578 | 3300049570 | Ga0501033_0018503 | Ga0501033_0018503_770_1111 | 113 |
| 579 | 3300049570 | Ga0501033_0030587 | Ga0501033_0030587_2298_2639 | 113 |
| 580 | 3300049570 | Ga0501033_0033037 | Ga0501033_0033037_2652_2993 | 113 |
| 581 | 3300049570 | Ga0501033_0035122 | Ga0501033_0035122_3134_3475 | 113 |
| 582 | 3300049570 | Ga0501033_0042807 | Ga0501033_0042807_1093_1434 | 113 |
| 583 | 3300049570 | Ga0501033_0048041 | Ga0501033_0048041_38_379 | 113 |
| 584 | 3300049570 | Ga0501033_0191720 | Ga0501033_0191720_561_902 | 113 |
| 585 | 3300049570 | Ga0501033_0210770 | Ga0501033_0210770_594_935 | 113 |
| 586 | 3300049570 | Ga0501033_0250301 | Ga0501033_0250301_541_882 | 113 |
| 587 | 3300049570 | Ga0501033_0425434 | Ga0501033_0425434_375_716 | 113 |
| 588 | 3300049570 | Ga0501033_0436740 | Ga0501033_0436740_528_869 | 113 |
| 589 | 3300049570 | Ga0501033_0473224 | Ga0501033_0473224_95_436 | 113 |
| 590 | 3300049571 | Ga0501034_0014485 | Ga0501034_0014485_1669_2010 | 113 |
| 591 | 3300049571 | Ga0501034_0020591 | Ga0501034_0020591_4381_4722 | 113 |
| 592 | 3300049571 | Ga0501034_0026236 | Ga0501034_0026236_3687_4028 | 113 |
| 593 | 3300049571 | Ga0501034_0069108 | Ga0501034_0069108_2364_2708 | 113 |
| 594 | 3300049571 | Ga0501034_0075264 | Ga0501034_0075264_1951_2295 | 113 |
| 595 | 3300049571 | Ga0501034_0115624 | Ga0501034_0115624_884_1225 | 113 |
| 596 | 3300049571 | Ga0501034_0171340 | Ga0501034_0171340_1703_2044 | 113 |
| 597 | 3300049571 | Ga0501034_0265856 | Ga0501034_0265856_335_676 | 113 |
| 598 | 3300049571 | Ga0501034_0649476 | Ga0501034_0649476_264_605 | 113 |
| 599 | 3300049571 | Ga0501034_0803192 | Ga0501034_0803192_36_377 | 113 |
| 600 | 3300049571 | Ga0501034_0971349 | Ga0501034_0971349_303_644 | 113 |
| 601 | 3300049571 | Ga0501034_1175288 | Ga0501034_1175288_234_575 | 113 |
| 602 | 3300049572 | Ga0501036_0004837 | Ga0501036_0004837_6494_6835 | 113 |
| 603 | 3300049572 | Ga0501036_0086475 | Ga0501036_0086475_1647_1988 | 113 |
| 604 | 3300049572 | Ga0501036_0139317 | Ga0501036_0139317_1366_1710 | 113 |
| 605 | 3300049572 | Ga0501036_0182086 | Ga0501036_0182086_120_461 | 113 |
| 606 | 3300049572 | Ga0501036_0252789 | Ga0501036_0252789_253_594 | 113 |
| 607 | 3300049572 | Ga0501036_1004522 | Ga0501036_1004522_30_371 | 113 |
| 608 | 3300049573 | Ga0501037_0034928 | Ga0501037_0034928_36_377 | 113 |
| 609 | 3300049573 | Ga0501037_0075325 | Ga0501037_0075325_92_433 | 113 |
| 610 | 3300049573 | Ga0501037_0137764 | Ga0501037_0137764_757_1098 | 113 |
| 611 | 3300049573 | Ga0501037_0310692 | Ga0501037_0310692_392_733 | 113 |
| 612 | 3300049573 | Ga0501037_0990662 | Ga0501037_0990662_129_473 | 113 |
| 613 | 3300049574 | Ga0501038_0021951 | Ga0501038_0021951_4310_4651 | 113 |
| 614 | 3300049574 | Ga0501038_0049270 | Ga0501038_0049270_2339_2680 | 113 |
| 615 | 3300049574 | Ga0501038_0088552 | Ga0501038_0088552_1887_2228 | 113 |
| 616 | 3300049574 | Ga0501038_0111908 | Ga0501038_0111908_480_821 | 113 |
| 617 | 3300049575 | Ga0501039_0041675 | Ga0501039_0041675_1691_2032 | 113 |
| 618 | 3300049575 | Ga0501039_1156317 | Ga0501039_1156317_147_488 | 113 |
| 619 | 3300049576 | Ga0501040_0114960 | Ga0501040_0114960_272_613 | 113 |
| 620 | 3300049578 | Ga0501042_0067410 | Ga0501042_0067410_1796_2137 | 113 |
| 621 | 3300049579 | Ga0501043_0019544 | Ga0501043_0019544_4645_4986 | 113 |
| 622 | 3300049579 | Ga0501043_0312139 | Ga0501043_0312139_442_783 | 113 |
| 623 | 3300049579 | Ga0501043_0363296 | Ga0501043_0363296_725_1066 | 113 |
| 624 | 3300049579 | Ga0501043_0619888 | Ga0501043_0619888_366_707 | 113 |
| 625 | 3300049580 | Ga0501046_0006506 | Ga0501046_0006506_2836_3177 | 113 |
| 626 | 3300049580 | Ga0501046_0007976 | Ga0501046_0007976_5223_5564 | 113 |
| 627 | 3300049580 | Ga0501046_0133396 | Ga0501046_0133396_885_1226 | 113 |
| 628 | 3300049580 | Ga0501046_1068265 | Ga0501046_1068265_124_465 | 113 |
| 629 | 3300049581 | Ga0501047_0005573 | Ga0501047_0005573_5669_6010 | 113 |
| 630 | 3300049581 | Ga0501047_0012160 | Ga0501047_0012160_4557_4898 | 113 |
| 631 | 3300049581 | Ga0501047_0024719 | Ga0501047_0024719_595_936 | 113 |
| 632 | 3300049581 | Ga0501047_0051529 | Ga0501047_0051529_3016_3357 | 113 |
| 633 | 3300049581 | Ga0501047_0055987 | Ga0501047_0055987_1828_2169 | 113 |
| 634 | 3300049581 | Ga0501047_0058311 | Ga0501047_0058311_2252_2593 | 113 |
| 635 | 3300049581 | Ga0501047_0062071 | Ga0501047_0062071_1477_1821 | 113 |
| 636 | 3300049581 | Ga0501047_0079600 | Ga0501047_0079600_2539_2880 | 113 |
| 637 | 3300049581 | Ga0501047_0281357 | Ga0501047_0281357_242_583 | 113 |
| 638 | 3300049581 | Ga0501047_0422663 | Ga0501047_0422663_486_827 | 113 |
| 639 | 3300049581 | Ga0501047_0532185 | Ga0501047_0532185_231_572 | 113 |
| 640 | 3300049581 | Ga0501047_0639114 | Ga0501047_0639114_470_811 | 113 |
| 641 | 3300049582 | Ga0501048_0009781 | Ga0501048_0009781_411_752 | 113 |
| 642 | 3300049582 | Ga0501048_0011718 | Ga0501048_0011718_296_640 | 113 |
| 643 | 3300049583 | Ga0501067_0002975 | Ga0501067_0002975_3454_3795 | 113 |
| 644 | 3300049583 | Ga0501067_0014512 | Ga0501067_0014512_2809_3153 | 113 |
| 645 | 3300049584 | Ga0501068_0099997 | Ga0501068_0099997_317_658 | 113 |
| 646 | 3300049584 | Ga0501068_0846855 | Ga0501068_0846855_154_495 | 113 |
| 647 | 3300049585 | Ga0501069_0010175 | Ga0501069_0010175_629_970 | 113 |
| 648 | 3300049586 | Ga0501070_0001596 | Ga0501070_0001596_4113_4457 | 113 |
| 649 | 3300049586 | Ga0501070_0010156 | Ga0501070_0010156_1062_1403 | 113 |
| 650 | 3300049586 | Ga0501070_0504077 | Ga0501070_0504077_535_876 | 113 |
| 651 | 3300049586 | Ga0501070_1181614 | Ga0501070_1181614_185_526 | 113 |
| 652 | 3300049588 | Ga0501072_0029247 | Ga0501072_0029247_3468_3812 | 113 |
| 653 | 3300049588 | Ga0501072_0124768 | Ga0501072_0124768_1107_1448 | 113 |
| 654 | 3300049589 | Ga0501073_0008387 | Ga0501073_0008387_5301_5642 | 113 |
| 655 | 3300049589 | Ga0501073_0128979 | Ga0501073_0128979_579_920 | 113 |
| 656 | 3300049589 | Ga0501073_0230136 | Ga0501073_0230136_267_611 | 113 |
| 657 | 3300049589 | Ga0501073_0491811 | Ga0501073_0491811_141_482 | 113 |
| 658 | 3300049590 | Ga0501074_0022031 | Ga0501074_0022031_653_994 | 113 |
| 659 | 3300049590 | Ga0501074_0154709 | Ga0501074_0154709_695_1039 | 113 |
| 660 | 3300049592 | Ga0501076_0874976 | Ga0501076_0874976_377_718 | 113 |
| 661 | 3300049741 | Ga0501079_0009686 | Ga0501079_0009686_4191_4532 | 113 |
| 662 | 3300049741 | Ga0501079_0068919 | Ga0501079_0068919_1117_1461 | 113 |
| 663 | 3300049742 | Ga0501080_0044620 | Ga0501080_0044620_525_866 | 113 |
| 664 | 3300049742 | Ga0501080_0081720 | Ga0501080_0081720_1108_1449 | 113 |
| 665 | 3300049742 | Ga0501080_0161758 | Ga0501080_0161758_607_951 | 113 |
| 666 | 3300049742 | Ga0501080_0325419 | Ga0501080_0325419_324_665 | 113 |
| 667 | 3300049742 | Ga0501080_0345073 | Ga0501080_0345073_855_1196 | 113 |
| 668 | 3300049742 | Ga0501080_0444054 | Ga0501080_0444054_658_999 | 113 |
| 669 | 3300049744 | Ga0501083_0002469 | Ga0501083_0002469_7733_8074 | 113 |
| 670 | 3300049744 | Ga0501083_0054975 | Ga0501083_0054975_2271_2612 | 113 |
| 671 | 3300049744 | Ga0501083_0134421 | Ga0501083_0134421_968_1309 | 113 |
| 672 | 3300049822 | Ga0501035_0081616 | Ga0501035_0081616_2387_2728 | 113 |
| 673 | 3300049822 | Ga0501035_0084164 | Ga0501035_0084164_1702_2043 | 113 |
| 674 | 3300049822 | Ga0501035_0103141 | Ga0501035_0103141_1642_1983 | 113 |
| 675 | 3300049822 | Ga0501035_0104314 | Ga0501035_0104314_1898_2239 | 113 |
| 676 | 3300049822 | Ga0501035_0105357 | Ga0501035_0105357_1050_1391 | 113 |
| 677 | 3300049822 | Ga0501035_0108946 | Ga0501035_0108946_706_1047 | 113 |
| 678 | 3300049822 | Ga0501035_0135193 | Ga0501035_0135193_1427_1768 | 113 |
| 679 | 3300049822 | Ga0501035_0179992 | Ga0501035_0179992_1330_1671 | 113 |
| 680 | 3300049822 | Ga0501035_0248191 | Ga0501035_0248191_825_1166 | 113 |
| 681 | 3300049822 | Ga0501035_0276308 | Ga0501035_0276308_734_1075 | 113 |
| 682 | 3300049823 | Ga0501044_0008181 | Ga0501044_0008181_2334_2675 | 113 |
| 683 | 3300049823 | Ga0501044_0024973 | Ga0501044_0024973_4363_4707 | 113 |
| 684 | 3300049823 | Ga0501044_0051027 | Ga0501044_0051027_3401_3742 | 113 |
| 685 | 3300049823 | Ga0501044_0071373 | Ga0501044_0071373_2839_3180 | 113 |
| 686 | 3300049823 | Ga0501044_0090489 | Ga0501044_0090489_14_355 | 113 |
| 687 | 3300049823 | Ga0501044_0105596 | Ga0501044_0105596_1869_2210 | 113 |
| 688 | 3300049823 | Ga0501044_0151801 | Ga0501044_0151801_614_955 | 113 |
| 689 | 3300049823 | Ga0501044_0196576 | Ga0501044_0196576_633_974 | 113 |
| 690 | 3300049823 | Ga0501044_0321554 | Ga0501044_0321554_343_684 | 113 |
| 691 | 3300049823 | Ga0501044_0681360 | Ga0501044_0681360_95_436 | 113 |
| 692 | 3300049823 | Ga0501044_0924242 | Ga0501044_0924242_303_644 | 113 |
| 693 | 3300049823 | Ga0501044_0940804 | Ga0501044_0940804_61_402 | 113 |
| 694 | 3300049823 | Ga0501044_1047589 | Ga0501044_1047589_94_435 | 113 |
| 695 | 3300049823 | Ga0501044_1069443 | Ga0501044_1069443_35_376 | 113 |
| 696 | 3300049824 | Ga0501045_0440132 | Ga0501045_0440132_111_452 | 113 |
| 697 | 3300053087 | Ga0500643_000003 | Ga0500643_000003_326888_327229 | 113 |
| 698 | 3300053090 | Ga0500646_0138052 | Ga0500646_0138052_265_606 | 113 |
| 699 | 3300053103 | Ga0500555_125407 | Ga0500555_125407_101_442 | 113 |
| 700 | 3300053119 | Ga0500595_001154 | Ga0500595_001154_4912_5253 | 113 |
| 701 | 3300053119 | Ga0500595_021631 | Ga0500595_021631_1662_2003 | 113 |
| 702 | 3300053119 | Ga0500595_026422 | Ga0500595_026422_1064_1405 | 113 |
| 703 | 3300053119 | Ga0500595_044650 | Ga0500595_044650_853_1194 | 113 |
| 704 | 3300053130 | Ga0500642_0203143 | Ga0500642_0203143_203_544 | 113 |
| 705 | 3300053133 | Ga0500655_027659 | Ga0500655_027659_233_577 | 113 |
| 706 | 3300053136 | Ga0500559_0024113 | Ga0500559_0024113_2154_2495 | 113 |
| 707 | 3300053136 | Ga0500559_0024947 | Ga0500559_0024947_2160_2501 | 113 |
| 708 | 3300053139 | Ga0500568_0130986 | Ga0500568_0130986_161_502 | 113 |
| 709 | 3300053140 | Ga0500573_0000025 | Ga0500573_0000025_34601_34942 | 113 |
| 710 | 3300053730 | Ga0500645_019051 | Ga0500645_019051_511_852 | 113 |
| 711 | 3300054114 | Ga0501084_0163445 | Ga0501084_0163445_586_930 | 113 |
| 712 | 3300060353 | Ga0501082_0035263 | Ga0501082_0035263_525_866 | 113 |
| 713 | 3300060353 | Ga0501082_0066011 | Ga0501082_0066011_127_471 | 113 |
| 714 | 3300060353 | Ga0501082_0278461 | Ga0501082_0278461_565_906 | 113 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7bgn-assembly3.cif.gz_F | crystal structure of mthisn2-amp complex, a bifunctional enzyme from the histidine biosynthetic pathway | 0.9114 | 11 | 112 |
| 7bgn-assembly2.cif.gz_C | crystal structure of mthisn2-amp complex, a bifunctional enzyme from the histidine biosynthetic pathway | 0.909 | 11 | 112 |
| 7bgn-assembly3.cif.gz_E | crystal structure of mthisn2-amp complex, a bifunctional enzyme from the histidine biosynthetic pathway | 0.9069 | 11 | 112 |
| 7bgn-assembly2.cif.gz_D | crystal structure of mthisn2-amp complex, a bifunctional enzyme from the histidine biosynthetic pathway | 0.9009 | 8 | 112 |
| 7bgn-assembly1.cif.gz_A | crystal structure of mthisn2-amp complex, a bifunctional enzyme from the histidine biosynthetic pathway | 0.8973 | 8 | 112 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WMM7_1_97_3.10.20.810 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase | 0.9619 | 10 | 100 | 3.10.20.810 |
| af_C6TGF5_46_140_3.10.20.810 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase | 0.9477 | 8 | 100 | 3.10.20.810 |
| 1zpsA01 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase | 0.946 | 11 | 100 | 3.10.20.810 |
| af_C6TGF5_46_140_3.10.20.810 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase | 0.9193 | 8 | 100 | 3.10.20.810 |
| af_Q2FUU3_250_343_3.10.20.810 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase | 0.9147 | 12 | 100 | 3.10.20.810 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q4CI81-F1-model_v4 | phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19) | 0.9863 | 8 | 96 |
GO:0000105
GO:0004635 |
| AF-A0A3D0G834-F1-model_v4 | phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19) | 0.9706 | 11 | 102 |
GO:0000105
GO:0004635 |
| AF-A0A3M2FVE2-F1-model_v4 | phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19) | 0.9665 | 5 | 98 |
GO:0000105
GO:0004635 |
| AF-A0A7W1SMB6-F1-model_v4 | phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19) | 0.9608 | 5 | 96 |
GO:0000105
GO:0004635 |
| AF-A0A7X8RFN4-F1-model_v4 | phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19) | 0.9596 | 12 | 103 |
GO:0000105
GO:0004635 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar