F476950

General Info

Members Datasets Scaffolds Average Seq Length
714 243 714 113

Family's Representative Sequence

Representative Sequence 3300031241|Ga0265325_10014465|Ga0265325_100144654
Length 121
Sequence VKDMTQSVAPADFVAAVKFDERGLVPVIAQRHAGGEVLMLAWMTRQTLETTLASGEVTYWSRSRQQVWRKGETSGHTQRLVEALLDCDGDVVLLKVDQLGPACHTGAPTCFFRKLVRNPAV

Samples

Sample ID Description Type Environment
1 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
83 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
84 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
85 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
87 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
139 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
140 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
141 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
142 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
143 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
144 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
145 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
146 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
147 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
148 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
149 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
150 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
151 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
152 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
153 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
154 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
155 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
156 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
157 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
158 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
160 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
161 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
162 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
163 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
164 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
165 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
166 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
167 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
168 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
169 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
170 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
171 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
172 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
173 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
174 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
175 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
176 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
177 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
178 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
179 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
180 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
181 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
182 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
183 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
184 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
185 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
186 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
187 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
188 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
189 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
190 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
191 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
192 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
193 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
194 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
195 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
196 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
197 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
198 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
199 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
200 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
201 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
202 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
203 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
218 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
219 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
220 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
221 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
222 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
223 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
224 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
225 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
226 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
227 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
228 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
231 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
232 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
233 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
234 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
235 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
236 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
237 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
238 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
239 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
240 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
241 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
242 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
243 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.94
Nodule 0
Rhizoplane 0.56
Rhizosphere 94.96
Stem 0
Stem Tuber 0
Unclassified 1.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1000003 3300003214 Bacteria 694080
2 JGI25153J46596_10025344 3300003215 Bacteria 2121
3 rootH1_10164083 3300003323 Bacteria 1373
4 Ga0070658_10029983 3300005327 Bacteria 4371
5 Ga0070658_10035662 3300005327 Bacteria 4007
6 Ga0070658_10043261 3300005327 Bacteria 3638
7 Ga0070658_10135283 3300005327 Bacteria 2056
8 Ga0070658_10148879 3300005327 Bacteria 1959
9 Ga0070658_10481462 3300005327 Bacteria 1071
10 Ga0070658_10639878 3300005327 Bacteria 922
11 Ga0070658_10961002 3300005327 Bacteria 743
12 Ga0070658_11147791 3300005327 Bacteria 676
13 Ga0070658_11448389 3300005327 Bacteria 596
14 Ga0070658_11669325 3300005327 Bacteria 552
15 Ga0070676_10042600 3300005328 Bacteria 2637
16 Ga0070676_10607215 3300005328 Bacteria 790
17 Ga0070676_11235293 3300005328 Bacteria 569
18 Ga0070683_100279601 3300005329 Bacteria 1588
19 Ga0070670_100388921 3300005331 Bacteria 1229
20 Ga0070677_10174966 3300005333 Bacteria 1018
21 Ga0070677_10406561 3300005333 Bacteria 719
22 Ga0068869_100200670 3300005334 Bacteria 1573
23 Ga0068869_100209167 3300005334 Bacteria 1542
24 Ga0068869_100422006 3300005334 Bacteria 1101
25 Ga0068869_100468796 3300005334 Bacteria 1047
26 Ga0070666_10041648 3300005335 Bacteria 3070
27 Ga0070666_10589663 3300005335 Bacteria 811
28 Ga0070680_100230057 3300005336 Bacteria 1566
29 Ga0070680_100363452 3300005336 Bacteria 1231
30 Ga0068868_100014115 3300005338 Bacteria 5881
31 Ga0068868_100054692 3300005338 Bacteria 3147
32 Ga0068868_100060392 3300005338 Bacteria 3001
33 Ga0070660_100071191 3300005339 Bacteria 2715
34 Ga0070660_100081619 3300005339 Bacteria 2538
35 Ga0070660_100216857 3300005339 Bacteria 1554
36 Ga0070691_10858314 3300005341 Bacteria 557
37 Ga0070661_100002706 3300005344 Bacteria 12147
38 Ga0070661_100466262 3300005344 Bacteria 1007
39 Ga0070661_101623830 3300005344 Bacteria 547
40 Ga0070668_101919655 3300005347 Bacteria 545
41 Ga0070675_100043761 3300005354 Bacteria 3660
42 Ga0070675_100370264 3300005354 Bacteria 1273
43 Ga0070675_100752543 3300005354 Bacteria 889
44 Ga0070671_100310698 3300005355 Bacteria 1343
45 Ga0070674_100579917 3300005356 Bacteria 945
46 Ga0070673_100086851 3300005364 Bacteria 2549
47 Ga0070673_101587734 3300005364 Bacteria 618
48 Ga0070659_100415021 3300005366 Bacteria 1138
49 Ga0070659_100494505 3300005366 Bacteria 1042
50 Ga0070659_101604327 3300005366 Bacteria 581
51 Ga0070667_100159468 3300005367 Bacteria 1986
52 Ga0070667_100485173 3300005367 Unclassified 1132
53 Ga0070667_101655773 3300005367 Bacteria 602
54 Ga0070667_102086695 3300005367 Bacteria 534
55 Ga0070714_100014744 3300005435 Bacteria 6282
56 Ga0070701_10381955 3300005438 Bacteria 888
57 Ga0070701_10691596 3300005438 Bacteria 685
58 Ga0070711_101004583 3300005439 Bacteria 716
59 Ga0070700_100973038 3300005441 Bacteria 696
60 Ga0070678_100014122 3300005456 Bacteria 5029
61 Ga0070678_100017757 3300005456 Bacteria 4590
62 Ga0070678_100112436 3300005456 Bacteria 2133
63 Ga0070678_100115106 3300005456 Bacteria 2111
64 Ga0070662_100967540 3300005457 Bacteria 728
65 Ga0070681_10103979 3300005458 Bacteria 2783
66 Ga0070681_10181799 3300005458 Bacteria 2024
67 Ga0070681_10270181 3300005458 Bacteria 1612
68 Ga0068867_100012470 3300005459 Bacteria 6016
69 Ga0068867_100538324 3300005459 Bacteria 1010
70 Ga0070679_100011831 3300005530 Bacteria 8323
71 Ga0070679_100060211 3300005530 Bacteria 3784
72 Ga0070679_100062116 3300005530 Bacteria 3723
73 Ga0070679_100687497 3300005530 Bacteria 966
74 Ga0070679_102083855 3300005530 Bacteria 517
75 Ga0070684_100507155 3300005535 Bacteria 1118
76 Ga0070684_101456157 3300005535 Bacteria 645
77 Ga0068853_100448166 3300005539 Unclassified 1214
78 Ga0068853_100502379 3300005539 Bacteria 1145
79 Ga0068853_100747067 3300005539 Bacteria 935
80 Ga0068853_100893384 3300005539 Bacteria 853
81 Ga0070672_100199525 3300005543 Bacteria 1673
82 Ga0070696_101229123 3300005546 Bacteria 634
83 Ga0070693_100348657 3300005547 Bacteria 1013
84 Ga0070693_100945245 3300005547 Bacteria 649
85 Ga0070665_100007050 3300005548 Bacteria 11419
86 Ga0070665_100027566 3300005548 Bacteria 5721
87 Ga0070665_100061341 3300005548 Bacteria 3769
88 Ga0070665_100061584 3300005548 Bacteria 3762
89 Ga0070665_100218252 3300005548 Bacteria 1907
90 Ga0070665_100534927 3300005548 Bacteria 1184
91 Ga0070665_100862085 3300005548 Bacteria 919
92 Ga0070665_101106517 3300005548 Unclassified 804
93 Ga0068855_100000022 3300005563 Bacteria 190807
94 Ga0068855_100021219 3300005563 Bacteria 7786
95 Ga0068855_100022754 3300005563 Bacteria 7510
96 Ga0068855_100102622 3300005563 Bacteria 3292
97 Ga0068855_100215457 3300005563 Bacteria 2156
98 Ga0068855_100891055 3300005563 Bacteria 940
99 Ga0068855_100994498 3300005563 Bacteria 881
100 Ga0068857_100036127 3300005577 Bacteria 4378
101 Ga0068857_100049344 3300005577 Bacteria 3734
102 Ga0068857_100740445 3300005577 Bacteria 936
103 Ga0068857_101045493 3300005577 Bacteria 787
104 Ga0068854_101031648 3300005578 Bacteria 730
105 Ga0068856_100053489 3300005614 Bacteria 3981
106 Ga0068856_100698264 3300005614 Bacteria 1035
107 Ga0068856_100908069 3300005614 Bacteria 899
108 Ga0068856_101500491 3300005614 Bacteria 688
109 Ga0068856_101738171 3300005614 Bacteria 636
110 Ga0070702_101130285 3300005615 Bacteria 628
111 Ga0068852_100112097 3300005616 Bacteria 2481
112 Ga0068852_100285476 3300005616 Bacteria 1592
113 Ga0068852_100769561 3300005616 Bacteria 976
114 Ga0068852_102142351 3300005616 Bacteria 581
115 Ga0068859_100257553 3300005617 Bacteria 1836
116 Ga0068864_100575673 3300005618 Bacteria 1091
117 Ga0068866_10032314 3300005718 Bacteria 2530
118 Ga0068863_100241410 3300005841 Bacteria 1744
119 Ga0068863_101526983 3300005841 Bacteria 677
120 Ga0068858_100027187 3300005842 Bacteria 5315
121 Ga0068858_100511348 3300005842 Bacteria 1161
122 Ga0068858_101674705 3300005842 Bacteria 628
123 Ga0068860_100172001 3300005843 Bacteria 2092
124 Ga0068860_100342271 3300005843 Bacteria 1470
125 Ga0068862_101238802 3300005844 Bacteria 746
126 Ga0068862_102225765 3300005844 Bacteria 560
127 Ga0070717_10766284 3300006028 Bacteria 877
128 Ga0070712_100140201 3300006175 Bacteria 1844
129 Ga0097621_100000101 3300006237 Bacteria 48184
130 Ga0097621_100011653 3300006237 Bacteria 6485
131 Ga0097621_100034035 3300006237 Bacteria 4062
132 Ga0097621_100058087 3300006237 Bacteria 3165
133 Ga0097621_100227440 3300006237 Bacteria 1628
134 Ga0097621_100468125 3300006237 Bacteria 1138
135 Ga0097621_100765146 3300006237 Bacteria 893
136 Ga0097621_100894469 3300006237 Bacteria 827
137 Ga0097621_101761505 3300006237 Bacteria 590
138 Ga0068871_100000360 3300006358 Bacteria 31821
139 Ga0068871_100019146 3300006358 Bacteria 5223
140 Ga0068871_100029042 3300006358 Bacteria 4341
141 Ga0068871_100081673 3300006358 Unclassified 2678
142 Ga0068871_100467383 3300006358 Bacteria 1133
143 Ga0068871_100790603 3300006358 Unclassified 874
144 Ga0068871_101715783 3300006358 Bacteria 596
145 Ga0068865_100170333 3300006881 Bacteria 1669
146 Ga0068865_100442877 3300006881 Bacteria 1072
147 Ga0068865_100447088 3300006881 Bacteria 1068
148 Ga0097620_100257539 3300006931 Bacteria 1836
149 Ga0105240_10024685 3300009093 Bacteria 7918
150 Ga0105240_10123496 3300009093 Bacteria 3115
151 Ga0105240_10124554 3300009093 Bacteria 3099
152 Ga0105240_10131546 3300009093 Bacteria 3001
153 Ga0105240_10207074 3300009093 Bacteria 2295
154 Ga0105240_10290960 3300009093 Bacteria 1873
155 Ga0105240_10341823 3300009093 Bacteria 1700
156 Ga0105240_10402244 3300009093 Unclassified 1542
157 Ga0105240_10403867 3300009093 Bacteria 1538
158 Ga0105240_10641919 3300009093 Bacteria 1165
159 Ga0105240_11507777 3300009093 Bacteria 705
160 Ga0105240_11697760 3300009093 Bacteria 659
161 Ga0105240_11963312 3300009093 Bacteria 608
162 Ga0105245_10006665 3300009098 Bacteria 10134
163 Ga0105245_10154755 3300009098 Bacteria 2171
164 Ga0105245_10175333 3300009098 Unclassified 2044
165 Ga0105245_10341064 3300009098 Bacteria 1482
166 Ga0105245_10420102 3300009098 Bacteria 1340
167 Ga0105245_10426352 3300009098 Bacteria 1330
168 Ga0105245_12043017 3300009098 Bacteria 627
169 Ga0105247_10283648 3300009101 Bacteria 1143
170 Ga0105247_10487831 3300009101 Bacteria 895
171 Ga0105243_10008539 3300009148 Bacteria 7860
172 Ga0105243_10159370 3300009148 Bacteria 1944
173 Ga0105243_10796742 3300009148 Bacteria 931
174 Ga0105241_10007579 3300009174 Bacteria 7979
175 Ga0105241_10128100 3300009174 Bacteria 2052
176 Ga0105241_10294921 3300009174 Bacteria 1390
177 Ga0105241_10310645 3300009174 Bacteria 1356
178 Ga0105241_10663084 3300009174 Bacteria 949
179 Ga0105241_11110554 3300009174 Bacteria 745
180 Ga0105241_11793913 3300009174 Bacteria 599
181 Ga0105242_10044925 3300009176 Bacteria 3578
182 Ga0105242_10089847 3300009176 Bacteria 2583
183 Ga0105242_10284489 3300009176 Bacteria 1503
184 Ga0105242_10683239 3300009176 Unclassified 1002
185 Ga0105242_10795438 3300009176 Bacteria 936
186 Ga0105242_11074991 3300009176 Bacteria 817
187 Ga0105242_11109514 3300009176 Bacteria 806
188 Ga0105248_10011629 3300009177 Bacteria 9695
189 Ga0105248_10656158 3300009177 Bacteria 1184
190 Ga0105248_10984467 3300009177 Bacteria 953
191 Ga0105248_11113255 3300009177 Bacteria 893
192 Ga0105248_11439785 3300009177 Bacteria 780
193 Ga0105248_11463128 3300009177 Bacteria 773
194 Ga0105248_12312329 3300009177 Bacteria 612
195 Ga0105237_10006194 3300009545 Bacteria 13347
196 Ga0105237_10081506 3300009545 Bacteria 3227
197 Ga0105237_10221318 3300009545 Unclassified 1893
198 Ga0105237_10306422 3300009545 Unclassified 1591
199 Ga0105237_10603930 3300009545 Bacteria 1104
200 Ga0105238_10021159 3300009551 Bacteria 6630
201 Ga0105238_10026274 3300009551 Bacteria 5934
202 Ga0105238_10027761 3300009551 Bacteria 5769
203 Ga0105238_10054332 3300009551 Bacteria 4023
204 Ga0105238_10101025 3300009551 Bacteria 2867
205 Ga0105238_10163931 3300009551 Bacteria 2198
206 Ga0105238_10333807 3300009551 Bacteria 1503
207 Ga0105238_10347896 3300009551 Bacteria 1471
208 Ga0105238_10360848 3300009551 Bacteria 1442
209 Ga0105238_11679978 3300009551 Bacteria 666
210 Ga0105238_12652998 3300009551 Bacteria 537
211 Ga0105238_12977158 3300009551 Unclassified 509
212 Ga0105249_10022197 3300009553 Bacteria 5685
213 Ga0105249_10643043 3300009553 Bacteria 1118
214 Ga0105239_10000773 3300010375 Bacteria 45320
215 Ga0105239_10005761 3300010375 Bacteria 14452
216 Ga0105239_10033970 3300010375 Bacteria 5600
217 Ga0105239_10094234 3300010375 Bacteria 3307
218 Ga0105239_10137495 3300010375 Bacteria 2720
219 Ga0105239_10155140 3300010375 Bacteria 2557
220 Ga0105239_10307089 3300010375 Bacteria 1787
221 Ga0105239_10386595 3300010375 Bacteria 1582
222 Ga0105239_10719255 3300010375 Bacteria 1142
223 Ga0105239_10738224 3300010375 Bacteria 1127
224 Ga0105239_11870747 3300010375 Bacteria 696
225 Ga0105239_12110883 3300010375 Bacteria 655
226 Ga0105246_10007879 3300011119 Bacteria 6536
227 Ga0105246_10025631 3300011119 Bacteria 3845
228 Ga0105246_10250915 3300011119 Bacteria 1404
229 Ga0105246_12050264 3300011119 Bacteria 553
230 Ga0105246_12081611 3300011119 Bacteria 549
231 Ga0157373_10113430 3300013100 Bacteria 1905
232 Ga0157373_10203172 3300013100 Bacteria 1397
233 Ga0157370_10008648 3300013104 Bacteria 10956
234 Ga0157370_10308175 3300013104 Bacteria 1461
235 Ga0157370_11085276 3300013104 Bacteria 724
236 Ga0157370_11349593 3300013104 Bacteria 642
237 Ga0157369_10006833 3300013105 Bacteria 13160
238 Ga0157369_10093221 3300013105 Bacteria 3215
239 Ga0157369_10308078 3300013105 Bacteria 1647
240 Ga0157369_11218944 3300013105 Bacteria 768
241 Ga0157369_11381272 3300013105 Bacteria 717
242 Ga0157374_10218974 3300013296 Bacteria 1868
243 Ga0157374_10452703 3300013296 Bacteria 1285
244 Ga0157374_10602680 3300013296 Bacteria 1108
245 Ga0157374_11238152 3300013296 Bacteria 768
246 Ga0157374_11857461 3300013296 Bacteria 628
247 Ga0157374_12011069 3300013296 Bacteria 604
248 Ga0157378_10071851 3300013297 Bacteria 3108
249 Ga0157378_10110509 3300013297 Bacteria 2519
250 Ga0157378_10245859 3300013297 Bacteria 1711
251 Ga0157378_10851818 3300013297 Bacteria 940
252 Ga0157378_10894072 3300013297 Bacteria 919
253 Ga0163162_10007963 3300013306 Bacteria 10330
254 Ga0163162_10017004 3300013306 Bacteria 7116
255 Ga0163162_10337398 3300013306 Bacteria 1640
256 Ga0163162_10376038 3300013306 Bacteria 1554
257 Ga0163162_10978312 3300013306 Bacteria 956
258 Ga0157372_10599295 3300013307 Bacteria 1284
259 Ga0157372_10989414 3300013307 Bacteria 974
260 Ga0157372_11297056 3300013307 Bacteria 840
261 Ga0157372_13408340 3300013307 Bacteria 506
262 Ga0157375_10062618 3300013308 Bacteria 3697
263 Ga0157375_10457413 3300013308 Bacteria 1442
264 Ga0157375_11384954 3300013308 Bacteria 828
265 Ga0157375_11454083 3300013308 Unclassified 808
266 Ga0163163_10000002 3300014325 Bacteria 609846
267 Ga0163163_10046548 3300014325 Bacteria 4261
268 Ga0163163_10376517 3300014325 Bacteria 1477
269 Ga0163163_10659927 3300014325 Bacteria 1109
270 Ga0157380_10394813 3300014326 Bacteria 1310
271 Ga0157380_10623189 3300014326 Bacteria 1071
272 Ga0157379_10002165 3300014968 Bacteria 16323
273 Ga0157379_10008033 3300014968 Bacteria 9157
274 Ga0157379_10338991 3300014968 Bacteria 1375
275 Ga0157379_10409263 3300014968 Bacteria 1248
276 Ga0157379_10441522 3300014968 Bacteria 1200
277 Ga0157376_10032666 3300014969 Bacteria 4181
278 Ga0157376_10391557 3300014969 Bacteria 1341
279 Ga0157376_10676179 3300014969 Bacteria 1035
280 Ga0157376_11432646 3300014969 Bacteria 723
281 Ga0157376_11563866 3300014969 Bacteria 693
282 Ga0157376_11851259 3300014969 Bacteria 640
283 Ga0163161_10012129 3300017792 Bacteria 5979
284 Ga0163161_11816775 3300017792 Bacteria 542
285 Ga0213872_10387999 3300021361 Bacteria 568
286 Ga0213876_10020783 3300021384 Bacteria 3471
287 Ga0209233_1000015 3300025261 Bacteria 980563
288 Ga0209233_1013510 3300025261 Bacteria 2330
289 Ga0209455_1037664 3300025272 Unclassified 759
290 Ga0209758_1000013 3300025297 Bacteria 873003
291 Ga0207682_10196467 3300025893 Bacteria 926
292 Ga0207682_10286502 3300025893 Bacteria 771
293 Ga0207692_10503768 3300025898 Bacteria 769
294 Ga0207642_10775903 3300025899 Bacteria 608
295 Ga0207688_10046283 3300025901 Bacteria 2429
296 Ga0207680_10061233 3300025903 Bacteria 2295
297 Ga0207645_10012251 3300025907 Bacteria 5824
298 Ga0207645_10202490 3300025907 Bacteria 1306
299 Ga0207705_10013726 3300025909 Bacteria 5844
300 Ga0207705_10023616 3300025909 Bacteria 4386
301 Ga0207705_10762388 3300025909 Bacteria 752
302 Ga0207705_11000440 3300025909 Bacteria 646
303 Ga0207654_10183605 3300025911 Bacteria 1366
304 Ga0207654_10279973 3300025911 Bacteria 1128
305 Ga0207654_10421701 3300025911 Bacteria 931
306 Ga0207654_10442703 3300025911 Bacteria 910
307 Ga0207707_10079800 3300025912 Bacteria 2858
308 Ga0207707_10842925 3300025912 Bacteria 761
309 Ga0207695_10009553 3300025913 Bacteria 11992
310 Ga0207695_10014852 3300025913 Bacteria 9197
311 Ga0207695_10086177 3300025913 Bacteria 3168
312 Ga0207695_10094972 3300025913 Bacteria 2987
313 Ga0207695_10095356 3300025913 Bacteria 2979
314 Ga0207695_10196644 3300025913 Bacteria 1932
315 Ga0207695_10223533 3300025913 Bacteria 1789
316 Ga0207695_10280228 3300025913 Bacteria 1561
317 Ga0207695_10331027 3300025913 Bacteria 1412
318 Ga0207695_10814812 3300025913 Bacteria 814
319 Ga0207695_11273852 3300025913 Bacteria 615
320 Ga0207671_10042949 3300025914 Bacteria 3344
321 Ga0207671_10063932 3300025914 Bacteria 2735
322 Ga0207671_10071874 3300025914 Bacteria 2581
323 Ga0207671_10177693 3300025914 Bacteria 1655
324 Ga0207671_10910518 3300025914 Bacteria 695
325 Ga0207693_11249677 3300025915 Unclassified 558
326 Ga0207660_10075357 3300025917 Bacteria 2465
327 Ga0207660_10599209 3300025917 Bacteria 897
328 Ga0207657_10093351 3300025919 Bacteria 2507
329 Ga0207657_10148135 3300025919 Bacteria 1913
330 Ga0207657_10206830 3300025919 Bacteria 1576
331 Ga0207657_10879797 3300025919 Bacteria 691
332 Ga0207657_10971392 3300025919 Bacteria 652
333 Ga0207649_10000154 3300025920 Bacteria 56342
334 Ga0207649_10064343 3300025920 Bacteria 2319
335 Ga0207649_10143320 3300025920 Bacteria 1637
336 Ga0207649_10479626 3300025920 Bacteria 943
337 Ga0207652_10039728 3300025921 Bacteria 3994
338 Ga0207652_10086124 3300025921 Bacteria 2754
339 Ga0207652_10237262 3300025921 Bacteria 1644
340 Ga0207652_10664389 3300025921 Bacteria 931
341 Ga0207694_10000005 3300025924 Bacteria 823704
342 Ga0207694_10062919 3300025924 Bacteria 2890
343 Ga0207694_10245087 3300025924 Bacteria 1465
344 Ga0207694_10326452 3300025924 Bacteria 1267
345 Ga0207694_10497800 3300025924 Bacteria 1020
346 Ga0207694_10802022 3300025924 Bacteria 795
347 Ga0207650_10212763 3300025925 Bacteria 1553
348 Ga0207650_10330052 3300025925 Bacteria 1251
349 Ga0207659_10188169 3300025926 Bacteria 1641
350 Ga0207659_10344040 3300025926 Bacteria 1236
351 Ga0207659_11714851 3300025926 Unclassified 535
352 Ga0207687_10009197 3300025927 Bacteria 6464
353 Ga0207687_10019917 3300025927 Bacteria 4449
354 Ga0207687_10098518 3300025927 Unclassified 2146
355 Ga0207687_10226890 3300025927 Bacteria 1473
356 Ga0207664_10135221 3300025929 Bacteria 2080
357 Ga0207644_10674731 3300025931 Bacteria 861
358 Ga0207690_10204139 3300025932 Bacteria 1503
359 Ga0207690_10478627 3300025932 Bacteria 1004
360 Ga0207690_10509621 3300025932 Bacteria 974
361 Ga0207686_10064734 3300025934 Bacteria 2329
362 Ga0207686_10078192 3300025934 Bacteria 2150
363 Ga0207686_10110128 3300025934 Bacteria 1855
364 Ga0207686_11269832 3300025934 Bacteria 604
365 Ga0207709_10003554 3300025935 Bacteria 9216
366 Ga0207670_10048540 3300025936 Bacteria 2834
367 Ga0207669_11216068 3300025937 Bacteria 638
368 Ga0207704_10101507 3300025938 Bacteria 1919
369 Ga0207704_10217172 3300025938 Bacteria 1412
370 Ga0207704_10957345 3300025938 Bacteria 722
371 Ga0207691_10327109 3300025940 Bacteria 1314
372 Ga0207691_10454130 3300025940 Bacteria 1090
373 Ga0207691_11201930 3300025940 Bacteria 629
374 Ga0207711_10017346 3300025941 Bacteria 5981
375 Ga0207711_10733953 3300025941 Bacteria 921
376 Ga0207689_10090030 3300025942 Bacteria 2521
377 Ga0207689_10197182 3300025942 Bacteria 1662
378 Ga0207689_10221631 3300025942 Bacteria 1563
379 Ga0207661_10334937 3300025944 Bacteria 1363
380 Ga0207661_10412591 3300025944 Bacteria 1226
381 Ga0207661_11436908 3300025944 Bacteria 633
382 Ga0207667_10000061 3300025949 Bacteria 190818
383 Ga0207667_10020392 3300025949 Bacteria 7373
384 Ga0207667_10102112 3300025949 Bacteria 2958
385 Ga0207667_10209669 3300025949 Bacteria 1997
386 Ga0207667_11210835 3300025949 Bacteria 734
387 Ga0207651_10121242 3300025960 Bacteria 1983
388 Ga0207651_10207970 3300025960 Bacteria 1573
389 Ga0207651_11276443 3300025960 Bacteria 660
390 Ga0207712_10590589 3300025961 Bacteria 959
391 Ga0207712_10965382 3300025961 Unclassified 755
392 Ga0207668_11215984 3300025972 Bacteria 677
393 Ga0207658_10123750 3300025986 Bacteria 2066
394 Ga0207658_10205232 3300025986 Bacteria 1648
395 Ga0207658_10306719 3300025986 Bacteria 1370
396 Ga0207658_10495163 3300025986 Unclassified 1088
397 Ga0207677_10037356 3300026023 Bacteria 3174
398 Ga0207677_10300917 3300026023 Bacteria 1325
399 Ga0207677_10655283 3300026023 Bacteria 927
400 Ga0207677_10764671 3300026023 Bacteria 862
401 Ga0207703_10148001 3300026035 Bacteria 2045
402 Ga0207703_10661906 3300026035 Bacteria 991
403 Ga0207703_11329333 3300026035 Bacteria 691
404 Ga0207639_10077628 3300026041 Bacteria 2618
405 Ga0207639_10225952 3300026041 Bacteria 1620
406 Ga0207639_10792242 3300026041 Bacteria 883
407 Ga0207639_10854120 3300026041 Unclassified 850
408 Ga0207639_10899508 3300026041 Bacteria 827
409 Ga0207639_11475173 3300026041 Unclassified 638
410 Ga0207708_10825482 3300026075 Bacteria 799
411 Ga0207702_10322797 3300026078 Bacteria 1471
412 Ga0207702_10513293 3300026078 Bacteria 1169
413 Ga0207702_10605112 3300026078 Bacteria 1076
414 Ga0207702_10747563 3300026078 Bacteria 965
415 Ga0207702_11287772 3300026078 Bacteria 725
416 Ga0207702_12083602 3300026078 Unclassified 557
417 Ga0207641_10574161 3300026088 Bacteria 1102
418 Ga0207641_10835318 3300026088 Bacteria 912
419 Ga0207641_12268575 3300026088 Bacteria 543
420 Ga0207648_10044599 3300026089 Bacteria 3890
421 Ga0207648_10305595 3300026089 Bacteria 1427
422 Ga0207648_10910601 3300026089 Bacteria 822
423 Ga0207674_10019842 3300026116 Bacteria 7274
424 Ga0207674_10101739 3300026116 Bacteria 2854
425 Ga0207674_10189883 3300026116 Bacteria 2004
426 Ga0207674_10489372 3300026116 Bacteria 1189
427 Ga0207674_11440775 3300026116 Unclassified 658
428 Ga0207675_100773438 3300026118 Bacteria 972
429 Ga0207675_101417446 3300026118 Bacteria 715
430 Ga0207683_10008807 3300026121 Bacteria 8613
431 Ga0207683_10019373 3300026121 Bacteria 5809
432 Ga0207683_10142869 3300026121 Bacteria 2157
433 Ga0207683_10336105 3300026121 Bacteria 1385
434 Ga0207683_10848938 3300026121 Bacteria 848
435 Ga0207698_10104179 3300026142 Bacteria 2360
436 Ga0207698_10181392 3300026142 Bacteria 1865
437 Ga0207698_10206210 3300026142 Bacteria 1765
438 Ga0207698_11545910 3300026142 Bacteria 679
439 Ga0207698_11580649 3300026142 Bacteria 671
440 Ga0268266_10000695 3300028379 Bacteria 45341
441 Ga0268266_10022016 3300028379 Bacteria 5433
442 Ga0268266_10131661 3300028379 Bacteria 2237
443 Ga0268266_10139343 3300028379 Bacteria 2176
444 Ga0268266_10169932 3300028379 Bacteria 1978
445 Ga0268266_10230934 3300028379 Bacteria 1704
446 Ga0268266_10238747 3300028379 Bacteria 1676
447 Ga0268266_10389306 3300028379 Bacteria 1316
448 Ga0268266_10594696 3300028379 Bacteria 1062
449 Ga0268266_10942418 3300028379 Unclassified 835
450 Ga0268265_10842929 3300028380 Bacteria 896
451 Ga0268264_10873627 3300028381 Bacteria 901
452 Ga0265334_10347447 3300028573 Bacteria 507
453 Ga0265318_10003384 3300028577 Bacteria 8036
454 Ga0265318_10366214 3300028577 Bacteria 526
455 Ga0265338_10022918 3300028800 Bacteria 6442
456 Ga0265330_10004583 3300031235 Bacteria 6991
457 Ga0265330_10025693 3300031235 Bacteria 2669
458 Ga0265330_10129090 3300031235 Bacteria 1076
459 Ga0265330_10198576 3300031235 Bacteria 848
460 Ga0265332_10098715 3300031238 Bacteria 1233
461 Ga0265332_10120360 3300031238 Bacteria 1103
462 Ga0265332_10411277 3300031238 Unclassified 559
463 Ga0265328_10072595 3300031239 Bacteria 1265
464 Ga0265328_10343895 3300031239 Bacteria 580
465 Ga0265320_10289178 3300031240 Bacteria 725
466 Ga0265325_10014465 3300031241 Bacteria 4457
467 Ga0265325_10033117 3300031241 Bacteria 2755
468 Ga0265325_10142454 3300031241 Bacteria 1139
469 Ga0265325_10234422 3300031241 Bacteria 836
470 Ga0265340_10000045 3300031247 Bacteria 56451
471 Ga0265340_10245018 3300031247 Bacteria 799
472 Ga0265340_10407665 3300031247 Bacteria 599
473 Ga0265339_10011572 3300031249 Bacteria 5422
474 Ga0265339_10094711 3300031249 Bacteria 1561
475 Ga0265339_10184775 3300031249 Bacteria 1036
476 Ga0265339_10357942 3300031249 Bacteria 687
477 Ga0265339_10607311 3300031249 Bacteria 501
478 Ga0265331_10000113 3300031250 Bacteria 105472
479 Ga0265331_10032183 3300031250 Bacteria 2601
480 Ga0265331_10073193 3300031250 Bacteria 1600
481 Ga0265331_10126046 3300031250 Bacteria 1170
482 Ga0265316_10021874 3300031344 Bacteria 5406
483 Ga0265316_10089537 3300031344 Bacteria 2348
484 Ga0265316_10135749 3300031344 Bacteria 1851
485 Ga0265316_10265375 3300031344 Bacteria 1258
486 Ga0265316_10390079 3300031344 Bacteria 1004
487 Ga0307513_10519726 3300031456 Unclassified 906
488 Ga0265313_10002892 3300031595 Bacteria 14371
489 Ga0265313_10016173 3300031595 Bacteria 4301
490 Ga0265313_10017499 3300031595 Bacteria 4071
491 Ga0265313_10198786 3300031595 Bacteria 835
492 Ga0265314_10006495 3300031711 Bacteria 10339
493 Ga0265314_10029553 3300031711 Bacteria 4071
494 Ga0265314_10033294 3300031711 Bacteria 3782
495 Ga0265314_10045594 3300031711 Bacteria 3098
496 Ga0265314_10097346 3300031711 Bacteria 1901
497 Ga0265314_10247942 3300031711 Bacteria 1024
498 Ga0265314_10601940 3300031711 Bacteria 566
499 Ga0265342_10018674 3300031712 Bacteria 4482
500 Ga0265342_10045634 3300031712 Bacteria 2637
501 Ga0265342_10069717 3300031712 Bacteria 2052
502 Ga0265342_10145502 3300031712 Bacteria 1320
503 Ga0265342_10163821 3300031712 Unclassified 1227
504 Ga0307516_10059575 3300031730 Bacteria 3713
505 Ga0307516_10192641 3300031730 Bacteria 1763
506 Ga0307516_10231713 3300031730 Bacteria 1550
507 Ga0307413_11513331 3300031824 Bacteria 594
508 Ga0373932_0243788 3300035112 Bacteria 654
509 Ga0373935_0659309 3300035692 Bacteria 768
510 Ga0373937_0744256 3300036401 Bacteria 928
511 Ga0395899_0069184 3300037312 Bacteria 2586
512 Ga0395900_0010488 3300037418 Bacteria 9478
513 Ga0395900_0218624 3300037418 Bacteria 1921
514 Ga0395898_0008354 3300037466 Bacteria 10947
515 Ga0395898_0045250 3300037466 Bacteria 4327
516 Ga0395901_0167509 3300038443 Bacteria 2306
517 Ga0436365_0322570 3300039437 Bacteria 8765
518 Ga0436365_1687461 3300039437 Bacteria 886
519 Ga0436361_0180372 3300039447 Bacteria 807
520 Ga0436362_0053635 3300039453 Bacteria 974
521 Ga0451787_799516 3300041441 Bacteria 525
522 Ga0466963_1218914 3300044694 Bacteria 529
523 Ga0466957_0457269 3300044842 Bacteria 880
524 Ga0466967_0748036 3300045976 Unclassified 969
525 Ga0495592_0715296 3300046454 Bacteria 601
526 Ga0495650_0334024 3300046471 Bacteria 503
527 Ga0495585_0412578 3300046492 Bacteria 649
528 Ga0495594_0371709 3300046499 Bacteria 814
529 Ga0495606_0320179 3300046507 Bacteria 833
530 Ga0495618_0555183 3300046514 Bacteria 687
531 Ga0495620_0198172 3300046515 Bacteria 773
532 Ga0495620_0382723 3300046515 Bacteria 533
533 Ga0495644_0073952 3300046523 Bacteria 1282
534 Ga0495648_0103502 3300046524 Bacteria 1566
535 Ga0495652_0090157 3300046529 Bacteria 2509
536 Ga0495652_0227147 3300046529 Bacteria 1399
537 Ga0495654_0070804 3300046530 Bacteria 1653
538 Ga0495587_0318924 3300046536 Bacteria 868
539 Ga0495587_0582405 3300046536 Bacteria 617
540 Ga0495609_0022902 3300046538 Bacteria 2876
541 Ga0495621_0063918 3300046539 Bacteria 1342
542 Ga0495622_0012617 3300046557 Bacteria 3915
543 Ga0495667_0423198 3300046559 Bacteria 838
544 Ga0495634_0816620 3300046642 Bacteria 531
545 Ga0495611_0324553 3300046648 Bacteria 708
546 Ga0495657_0425743 3300046675 Unclassified 779
547 Ga0495657_0511511 3300046675 Bacteria 700
548 Ga0495623_0169952 3300046679 Bacteria 1274
549 Ga0495613_0234497 3300046689 Bacteria 1285
550 Ga0495624_0690953 3300046690 Unclassified 606
551 Ga0495649_0182687 3300046694 Bacteria 1094
552 Ga0495604_0806832 3300047317 Bacteria 591
553 Ga0495672_0147535 3300047320 Bacteria 1223
554 Ga0495672_0313084 3300047320 Bacteria 740
555 Ga0495676_0696077 3300047321 Bacteria 658
556 Ga0495602_0023569 3300048088 Bacteria 5994
557 Ga0495602_0719205 3300048088 Bacteria 676
558 Ga0496100_1094406 3300048903 Unclassified 628
559 Ga0496101_0877094 3300048904 Unclassified 707
560 Ga0496107_1105017 3300048910 Bacteria 573
561 Ga0496121_0000527 3300048924 Bacteria 72759
562 Ga0496121_0522411 3300048924 Unclassified 749
563 Ga0496126_0128976 3300048929 Bacteria 2187
564 Ga0495682_0001570 3300049460 Bacteria 11922
565 Ga0501031_0010452 3300049568 Bacteria 6045
566 Ga0501031_0248295 3300049568 Bacteria 1157
567 Ga0501031_0290003 3300049568 Bacteria 1061
568 Ga0501031_0504673 3300049568 Bacteria 780
569 Ga0501031_0894323 3300049568 Bacteria 568
570 Ga0501032_0005257 3300049569 Bacteria 9631
571 Ga0501032_0208279 3300049569 Bacteria 1275
572 Ga0501032_0241709 3300049569 Bacteria 1173
573 Ga0501032_0420884 3300049569 Bacteria 857
574 Ga0501032_0513743 3300049569 Bacteria 765
575 Ga0501033_0018503 3300049570 Bacteria 5264
576 Ga0501033_0030587 3300049570 Bacteria 4045
577 Ga0501033_0033037 3300049570 Bacteria 3885
578 Ga0501033_0035122 3300049570 Bacteria 3758
579 Ga0501033_0042807 3300049570 Bacteria 3376
580 Ga0501033_0048041 3300049570 Bacteria 3171
581 Ga0501033_0191720 3300049570 Bacteria 1462
582 Ga0501033_0210770 3300049570 Bacteria 1385
583 Ga0501033_0250301 3300049570 Bacteria 1256
584 Ga0501033_0425434 3300049570 Bacteria 924
585 Ga0501033_0436740 3300049570 Bacteria 910
586 Ga0501033_0473224 3300049570 Bacteria 868
587 Ga0501034_0014485 3300049571 Bacteria 8121
588 Ga0501034_0020591 3300049571 Bacteria 6737
589 Ga0501034_0026236 3300049571 Bacteria 5934
590 Ga0501034_0069108 3300049571 Bacteria 3543
591 Ga0501034_0075264 3300049571 Bacteria 3384
592 Ga0501034_0115624 3300049571 Bacteria 2671
593 Ga0501034_0171340 3300049571 Bacteria 2138
594 Ga0501034_0265856 3300049571 Bacteria 1657
595 Ga0501034_0649476 3300049571 Bacteria 957
596 Ga0501034_0803192 3300049571 Bacteria 833
597 Ga0501034_0971349 3300049571 Bacteria 734
598 Ga0501034_1175288 3300049571 Bacteria 646
599 Ga0501036_0004837 3300049572 Bacteria 10879
600 Ga0501036_0086475 3300049572 Bacteria 2650
601 Ga0501036_0139317 3300049572 Bacteria 2048
602 Ga0501036_0182086 3300049572 Bacteria 1769
603 Ga0501036_0252789 3300049572 Bacteria 1477
604 Ga0501036_1004522 3300049572 Bacteria 683
605 Ga0501037_0034928 3300049573 Bacteria 3708
606 Ga0501037_0075325 3300049573 Bacteria 2451
607 Ga0501037_0137764 3300049573 Bacteria 1748
608 Ga0501037_0310692 3300049573 Bacteria 1093
609 Ga0501037_0990662 3300049573 Bacteria 548
610 Ga0501038_0021951 3300049574 Bacteria 5725
611 Ga0501038_0049270 3300049574 Bacteria 3643
612 Ga0501038_0088552 3300049574 Bacteria 2598
613 Ga0501038_0111908 3300049574 Bacteria 2261
614 Ga0501039_0041675 3300049575 Bacteria 3547
615 Ga0501039_0126740 3300049575 Bacteria 2003
616 Ga0501039_1156317 3300049575 Bacteria 599
617 Ga0501040_0114960 3300049576 Bacteria 1884
618 Ga0501042_0067410 3300049578 Bacteria 2558
619 Ga0501043_0019544 3300049579 Bacteria 5316
620 Ga0501043_0312139 3300049579 Bacteria 1200
621 Ga0501043_0363296 3300049579 Bacteria 1098
622 Ga0501043_0619888 3300049579 Bacteria 797
623 Ga0501046_0006506 3300049580 Bacteria 10332
624 Ga0501046_0007976 3300049580 Bacteria 9260
625 Ga0501046_0133396 3300049580 Bacteria 1882
626 Ga0501046_1068265 3300049580 Bacteria 558
627 Ga0501047_0005573 3300049581 Bacteria 11854
628 Ga0501047_0012160 3300049581 Bacteria 8147
629 Ga0501047_0024719 3300049581 Bacteria 5767
630 Ga0501047_0051529 3300049581 Bacteria 3978
631 Ga0501047_0055987 3300049581 Bacteria 3812
632 Ga0501047_0058311 3300049581 Bacteria 3730
633 Ga0501047_0062071 3300049581 Bacteria 3605
634 Ga0501047_0079600 3300049581 Bacteria 3150
635 Ga0501047_0281357 3300049581 Bacteria 1508
636 Ga0501047_0422663 3300049581 Bacteria 1164
637 Ga0501047_0532185 3300049581 Bacteria 1000
638 Ga0501047_0639114 3300049581 Bacteria 884
639 Ga0501048_0009781 3300049582 Bacteria 7189
640 Ga0501048_0011718 3300049582 Bacteria 6540
641 Ga0501067_0002975 3300049583 Bacteria 9351
642 Ga0501067_0014512 3300049583 Bacteria 4362
643 Ga0501068_0099997 3300049584 Bacteria 1797
644 Ga0501068_0846855 3300049584 Bacteria 601
645 Ga0501069_0010175 3300049585 Bacteria 4975
646 Ga0501069_0168117 3300049585 Bacteria 1264
647 Ga0501070_0001596 3300049586 Bacteria 20105
648 Ga0501070_0010156 3300049586 Bacteria 7968
649 Ga0501070_0504077 3300049586 Unclassified 972
650 Ga0501070_1181614 3300049586 Bacteria 588
651 Ga0501072_0029247 3300049588 Bacteria 4302
652 Ga0501072_0124768 3300049588 Bacteria 2051
653 Ga0501073_0008387 3300049589 Bacteria 7666
654 Ga0501073_0128979 3300049589 Bacteria 1753
655 Ga0501073_0230136 3300049589 Bacteria 1280
656 Ga0501073_0491811 3300049589 Bacteria 848
657 Ga0501074_0022031 3300049590 Bacteria 4628
658 Ga0501074_0154709 3300049590 Bacteria 1638
659 Ga0501076_0874976 3300049592 Bacteria 741
660 Ga0501079_0009686 3300049741 Bacteria 7304
661 Ga0501079_0068919 3300049741 Bacteria 2730
662 Ga0501080_0044620 3300049742 Bacteria 4127
663 Ga0501080_0081720 3300049742 Bacteria 3001
664 Ga0501080_0161758 3300049742 Bacteria 2067
665 Ga0501080_0325419 3300049742 Bacteria 1391
666 Ga0501080_0345073 3300049742 Bacteria 1345
667 Ga0501080_0444054 3300049742 Bacteria 1164
668 Ga0501083_0002469 3300049744 Bacteria 12669
669 Ga0501083_0054975 3300049744 Bacteria 2670
670 Ga0501083_0134421 3300049744 Bacteria 1621
671 Ga0501035_0081616 3300049822 Bacteria 2854
672 Ga0501035_0084164 3300049822 Bacteria 2805
673 Ga0501035_0103141 3300049822 Bacteria 2502
674 Ga0501035_0104314 3300049822 Bacteria 2486
675 Ga0501035_0105357 3300049822 Bacteria 2472
676 Ga0501035_0108946 3300049822 Bacteria 2428
677 Ga0501035_0135193 3300049822 Bacteria 2147
678 Ga0501035_0179992 3300049822 Bacteria 1821
679 Ga0501035_0248191 3300049822 Bacteria 1512
680 Ga0501035_0276308 3300049822 Bacteria 1421
681 Ga0501044_0008181 3300049823 Bacteria 11477
682 Ga0501044_0024973 3300049823 Bacteria 6335
683 Ga0501044_0051027 3300049823 Bacteria 4266
684 Ga0501044_0071373 3300049823 Bacteria 3531
685 Ga0501044_0090489 3300049823 Bacteria 3087
686 Ga0501044_0105596 3300049823 Bacteria 2829
687 Ga0501044_0151801 3300049823 Bacteria 2298
688 Ga0501044_0196576 3300049823 Bacteria 1976
689 Ga0501044_0321554 3300049823 Bacteria 1471
690 Ga0501044_0681360 3300049823 Bacteria 915
691 Ga0501044_0924242 3300049823 Bacteria 746
692 Ga0501044_0940804 3300049823 Bacteria 738
693 Ga0501044_1047589 3300049823 Bacteria 686
694 Ga0501044_1069443 3300049823 Bacteria 677
695 Ga0501045_0440132 3300049824 Bacteria 969
696 Ga0500643_000003 3300053087 Bacteria 876659
697 Ga0500646_0138052 3300053090 Bacteria 798
698 Ga0500555_125407 3300053103 Bacteria 639
699 Ga0500595_001154 3300053119 Bacteria 14653
700 Ga0500595_021631 3300053119 Bacteria 2292
701 Ga0500595_026422 3300053119 Bacteria 2001
702 Ga0500595_044650 3300053119 Bacteria 1403
703 Ga0500642_0203143 3300053130 Bacteria 922
704 Ga0500655_027659 3300053133 Bacteria 1083
705 Ga0500559_0024113 3300053136 Bacteria 2586
706 Ga0500559_0024947 3300053136 Bacteria 2545
707 Ga0500568_0130986 3300053139 Bacteria 932
708 Ga0500573_0000025 3300053140 Bacteria 144473
709 Ga0500639_223115 3300053163 Bacteria 784
710 Ga0500645_019051 3300053730 Bacteria 2138
711 Ga0501084_0163445 3300054114 Bacteria 1878
712 Ga0501082_0035263 3300060353 Bacteria 4312
713 Ga0501082_0066011 3300060353 Bacteria 3116
714 Ga0501082_0278461 3300060353 Bacteria 1456

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300021384 Ga0213876_10020783 Ga0213876_100207833 101
2 3300039437 Ga0436365_0322570 Ga0436365_0322570_5309_5686 101
3 3300039453 Ga0436362_0053635 Ga0436362_0053635_254_631 101
4 3300049585 Ga0501069_0168117 Ga0501069_0168117_923_1237 103
5 3300009551 Ga0105238_12652998 Ga0105238_126529981 106
6 3300031241 Ga0265325_10234422 Ga0265325_102344222 106
7 3300031595 Ga0265313_10002892 Ga0265313_1000289213 106
8 3300049575 Ga0501039_0126740 Ga0501039_0126740_1178_1534 109
9 3300053163 Ga0500639_223115 Ga0500639_223115_315_644 109
10 3300005563 Ga0068855_100021219 Ga0068855_1000212194 110
11 3300013104 Ga0157370_10008648 Ga0157370_100086487 110
12 3300013105 Ga0157369_11381272 Ga0157369_113812722 110
13 3300025949 Ga0207667_10020392 Ga0207667_100203924 110
14 3300031249 Ga0265339_10357942 Ga0265339_103579422 110
15 3300026118 Ga0207675_100773438 Ga0207675_1007734382 112
16 3300003214 JGI25165J46597_1000003 JGI25165J46597_1000003651 113
17 3300003215 JGI25153J46596_10025344 JGI25153J46596_100253442 113
18 3300003323 rootH1_10164083 rootH1_101640832 113
19 3300005327 Ga0070658_10029983 Ga0070658_100299834 113
20 3300005327 Ga0070658_10035662 Ga0070658_100356621 113
21 3300005327 Ga0070658_10043261 Ga0070658_100432612 113
22 3300005327 Ga0070658_10135283 Ga0070658_101352831 113
23 3300005327 Ga0070658_10148879 Ga0070658_101488792 113
24 3300005327 Ga0070658_10481462 Ga0070658_104814622 113
25 3300005327 Ga0070658_10639878 Ga0070658_106398781 113
26 3300005327 Ga0070658_10961002 Ga0070658_109610022 113
27 3300005327 Ga0070658_11147791 Ga0070658_111477912 113
28 3300005327 Ga0070658_11448389 Ga0070658_114483892 113
29 3300005327 Ga0070658_11669325 Ga0070658_116693251 113
30 3300005328 Ga0070676_10042600 Ga0070676_100426002 113
31 3300005328 Ga0070676_10607215 Ga0070676_106072152 113
32 3300005328 Ga0070676_11235293 Ga0070676_112352932 113
33 3300005329 Ga0070683_100279601 Ga0070683_1002796013 113
34 3300005331 Ga0070670_100388921 Ga0070670_1003889212 113
35 3300005333 Ga0070677_10174966 Ga0070677_101749662 113
36 3300005333 Ga0070677_10406561 Ga0070677_104065612 113
37 3300005334 Ga0068869_100200670 Ga0068869_1002006702 113
38 3300005334 Ga0068869_100209167 Ga0068869_1002091672 113
39 3300005334 Ga0068869_100422006 Ga0068869_1004220062 113
40 3300005334 Ga0068869_100468796 Ga0068869_1004687962 113
41 3300005335 Ga0070666_10041648 Ga0070666_100416482 113
42 3300005335 Ga0070666_10589663 Ga0070666_105896632 113
43 3300005336 Ga0070680_100230057 Ga0070680_1002300572 113
44 3300005336 Ga0070680_100363452 Ga0070680_1003634522 113
45 3300005338 Ga0068868_100014115 Ga0068868_1000141151 113
46 3300005338 Ga0068868_100054692 Ga0068868_1000546923 113
47 3300005338 Ga0068868_100060392 Ga0068868_1000603924 113
48 3300005339 Ga0070660_100071191 Ga0070660_1000711913 113
49 3300005339 Ga0070660_100081619 Ga0070660_1000816192 113
50 3300005339 Ga0070660_100216857 Ga0070660_1002168572 113
51 3300005341 Ga0070691_10858314 Ga0070691_108583142 113
52 3300005344 Ga0070661_100002706 Ga0070661_1000027066 113
53 3300005344 Ga0070661_100466262 Ga0070661_1004662622 113
54 3300005344 Ga0070661_101623830 Ga0070661_1016238302 113
55 3300005347 Ga0070668_101919655 Ga0070668_1019196551 113
56 3300005354 Ga0070675_100043761 Ga0070675_1000437612 113
57 3300005354 Ga0070675_100370264 Ga0070675_1003702641 113
58 3300005354 Ga0070675_100752543 Ga0070675_1007525432 113
59 3300005355 Ga0070671_100310698 Ga0070671_1003106982 113
60 3300005356 Ga0070674_100579917 Ga0070674_1005799172 113
61 3300005364 Ga0070673_100086851 Ga0070673_1000868512 113
62 3300005364 Ga0070673_101587734 Ga0070673_1015877342 113
63 3300005366 Ga0070659_100415021 Ga0070659_1004150212 113
64 3300005366 Ga0070659_100494505 Ga0070659_1004945052 113
65 3300005366 Ga0070659_101604327 Ga0070659_1016043271 113
66 3300005367 Ga0070667_100159468 Ga0070667_1001594681 113
67 3300005367 Ga0070667_100485173 Ga0070667_1004851732 113
68 3300005367 Ga0070667_101655773 Ga0070667_1016557731 113
69 3300005367 Ga0070667_102086695 Ga0070667_1020866952 113
70 3300005435 Ga0070714_100014744 Ga0070714_1000147445 113
71 3300005438 Ga0070701_10381955 Ga0070701_103819551 113
72 3300005438 Ga0070701_10691596 Ga0070701_106915962 113
73 3300005439 Ga0070711_101004583 Ga0070711_1010045831 113
74 3300005441 Ga0070700_100973038 Ga0070700_1009730382 113
75 3300005456 Ga0070678_100014122 Ga0070678_1000141228 113
76 3300005456 Ga0070678_100017757 Ga0070678_1000177575 113
77 3300005456 Ga0070678_100112436 Ga0070678_1001124363 113
78 3300005456 Ga0070678_100115106 Ga0070678_1001151062 113
79 3300005457 Ga0070662_100967540 Ga0070662_1009675401 113
80 3300005458 Ga0070681_10103979 Ga0070681_101039792 113
81 3300005458 Ga0070681_10181799 Ga0070681_101817992 113
82 3300005458 Ga0070681_10270181 Ga0070681_102701812 113
83 3300005459 Ga0068867_100012470 Ga0068867_1000124704 113
84 3300005459 Ga0068867_100538324 Ga0068867_1005383242 113
85 3300005530 Ga0070679_100011831 Ga0070679_1000118314 113
86 3300005530 Ga0070679_100060211 Ga0070679_1000602113 113
87 3300005530 Ga0070679_100062116 Ga0070679_1000621164 113
88 3300005530 Ga0070679_100687497 Ga0070679_1006874972 113
89 3300005530 Ga0070679_102083855 Ga0070679_1020838551 113
90 3300005535 Ga0070684_100507155 Ga0070684_1005071552 113
91 3300005535 Ga0070684_101456157 Ga0070684_1014561572 113
92 3300005539 Ga0068853_100448166 Ga0068853_1004481662 113
93 3300005539 Ga0068853_100502379 Ga0068853_1005023792 113
94 3300005539 Ga0068853_100747067 Ga0068853_1007470671 113
95 3300005539 Ga0068853_100893384 Ga0068853_1008933842 113
96 3300005543 Ga0070672_100199525 Ga0070672_1001995252 113
97 3300005546 Ga0070696_101229123 Ga0070696_1012291231 113
98 3300005547 Ga0070693_100348657 Ga0070693_1003486572 113
99 3300005547 Ga0070693_100945245 Ga0070693_1009452451 113
100 3300005548 Ga0070665_100007050 Ga0070665_10000705012 113
101 3300005548 Ga0070665_100027566 Ga0070665_1000275663 113
102 3300005548 Ga0070665_100061341 Ga0070665_1000613413 113
103 3300005548 Ga0070665_100061584 Ga0070665_1000615842 113
104 3300005548 Ga0070665_100218252 Ga0070665_1002182522 113
105 3300005548 Ga0070665_100534927 Ga0070665_1005349272 113
106 3300005548 Ga0070665_100862085 Ga0070665_1008620852 113
107 3300005548 Ga0070665_101106517 Ga0070665_1011065171 113
108 3300005563 Ga0068855_100000022 Ga0068855_100000022161 113
109 3300005563 Ga0068855_100022754 Ga0068855_1000227543 113
110 3300005563 Ga0068855_100102622 Ga0068855_1001026224 113
111 3300005563 Ga0068855_100215457 Ga0068855_1002154572 113
112 3300005563 Ga0068855_100891055 Ga0068855_1008910552 113
113 3300005563 Ga0068855_100994498 Ga0068855_1009944982 113
114 3300005577 Ga0068857_100036127 Ga0068857_1000361272 113
115 3300005577 Ga0068857_100049344 Ga0068857_1000493444 113
116 3300005577 Ga0068857_100740445 Ga0068857_1007404452 113
117 3300005577 Ga0068857_101045493 Ga0068857_1010454932 113
118 3300005578 Ga0068854_101031648 Ga0068854_1010316482 113
119 3300005614 Ga0068856_100053489 Ga0068856_1000534891 113
120 3300005614 Ga0068856_100698264 Ga0068856_1006982642 113
121 3300005614 Ga0068856_100908069 Ga0068856_1009080692 113
122 3300005614 Ga0068856_101500491 Ga0068856_1015004912 113
123 3300005614 Ga0068856_101738171 Ga0068856_1017381711 113
124 3300005615 Ga0070702_101130285 Ga0070702_1011302851 113
125 3300005616 Ga0068852_100112097 Ga0068852_1001120972 113
126 3300005616 Ga0068852_100285476 Ga0068852_1002854761 113
127 3300005616 Ga0068852_100769561 Ga0068852_1007695611 113
128 3300005616 Ga0068852_102142351 Ga0068852_1021423511 113
129 3300005617 Ga0068859_100257553 Ga0068859_1002575532 113
130 3300005618 Ga0068864_100575673 Ga0068864_1005756732 113
131 3300005718 Ga0068866_10032314 Ga0068866_100323143 113
132 3300005841 Ga0068863_100241410 Ga0068863_1002414102 113
133 3300005841 Ga0068863_101526983 Ga0068863_1015269831 113
134 3300005842 Ga0068858_100027187 Ga0068858_1000271874 113
135 3300005842 Ga0068858_100511348 Ga0068858_1005113481 113
136 3300005842 Ga0068858_101674705 Ga0068858_1016747052 113
137 3300005843 Ga0068860_100172001 Ga0068860_1001720013 113
138 3300005843 Ga0068860_100342271 Ga0068860_1003422712 113
139 3300005844 Ga0068862_101238802 Ga0068862_1012388022 113
140 3300005844 Ga0068862_102225765 Ga0068862_1022257652 113
141 3300006028 Ga0070717_10766284 Ga0070717_107662843 113
142 3300006175 Ga0070712_100140201 Ga0070712_1001402011 113
143 3300006237 Ga0097621_100000101 Ga0097621_10000010119 113
144 3300006237 Ga0097621_100011653 Ga0097621_10001165311 113
145 3300006237 Ga0097621_100034035 Ga0097621_1000340354 113
146 3300006237 Ga0097621_100058087 Ga0097621_1000580873 113
147 3300006237 Ga0097621_100227440 Ga0097621_1002274402 113
148 3300006237 Ga0097621_100468125 Ga0097621_1004681252 113
149 3300006237 Ga0097621_100765146 Ga0097621_1007651462 113
150 3300006237 Ga0097621_100894469 Ga0097621_1008944692 113
151 3300006237 Ga0097621_101761505 Ga0097621_1017615051 113
152 3300006358 Ga0068871_100000360 Ga0068871_10000036027 113
153 3300006358 Ga0068871_100019146 Ga0068871_1000191462 113
154 3300006358 Ga0068871_100029042 Ga0068871_1000290427 113
155 3300006358 Ga0068871_100081673 Ga0068871_1000816733 113
156 3300006358 Ga0068871_100467383 Ga0068871_1004673832 113
157 3300006358 Ga0068871_100790603 Ga0068871_1007906032 113
158 3300006358 Ga0068871_101715783 Ga0068871_1017157831 113
159 3300006881 Ga0068865_100170333 Ga0068865_1001703332 113
160 3300006881 Ga0068865_100442877 Ga0068865_1004428772 113
161 3300006881 Ga0068865_100447088 Ga0068865_1004470882 113
162 3300006931 Ga0097620_100257539 Ga0097620_1002575392 113
163 3300009093 Ga0105240_10024685 Ga0105240_100246853 113
164 3300009093 Ga0105240_10123496 Ga0105240_101234964 113
165 3300009093 Ga0105240_10124554 Ga0105240_101245543 113
166 3300009093 Ga0105240_10131546 Ga0105240_101315462 113
167 3300009093 Ga0105240_10207074 Ga0105240_102070742 113
168 3300009093 Ga0105240_10290960 Ga0105240_102909601 113
169 3300009093 Ga0105240_10341823 Ga0105240_103418232 113
170 3300009093 Ga0105240_10402244 Ga0105240_104022442 113
171 3300009093 Ga0105240_10403867 Ga0105240_104038672 113
172 3300009093 Ga0105240_10641919 Ga0105240_106419192 113
173 3300009093 Ga0105240_11507777 Ga0105240_115077772 113
174 3300009093 Ga0105240_11697760 Ga0105240_116977602 113
175 3300009093 Ga0105240_11963312 Ga0105240_119633121 113
176 3300009098 Ga0105245_10006665 Ga0105245_1000666510 113
177 3300009098 Ga0105245_10154755 Ga0105245_101547551 113
178 3300009098 Ga0105245_10175333 Ga0105245_101753332 113
179 3300009098 Ga0105245_10341064 Ga0105245_103410642 113
180 3300009098 Ga0105245_10420102 Ga0105245_104201022 113
181 3300009098 Ga0105245_10426352 Ga0105245_104263521 113
182 3300009098 Ga0105245_12043017 Ga0105245_120430172 113
183 3300009101 Ga0105247_10283648 Ga0105247_102836482 113
184 3300009101 Ga0105247_10487831 Ga0105247_104878312 113
185 3300009148 Ga0105243_10008539 Ga0105243_100085394 113
186 3300009148 Ga0105243_10159370 Ga0105243_101593701 113
187 3300009148 Ga0105243_10796742 Ga0105243_107967422 113
188 3300009174 Ga0105241_10007579 Ga0105241_100075797 113
189 3300009174 Ga0105241_10128100 Ga0105241_101281002 113
190 3300009174 Ga0105241_10294921 Ga0105241_102949212 113
191 3300009174 Ga0105241_10310645 Ga0105241_103106452 113
192 3300009174 Ga0105241_10663084 Ga0105241_106630842 113
193 3300009174 Ga0105241_11110554 Ga0105241_111105542 113
194 3300009174 Ga0105241_11793913 Ga0105241_117939132 113
195 3300009176 Ga0105242_10044925 Ga0105242_100449254 113
196 3300009176 Ga0105242_10089847 Ga0105242_100898472 113
197 3300009176 Ga0105242_10284489 Ga0105242_102844892 113
198 3300009176 Ga0105242_10683239 Ga0105242_106832392 113
199 3300009176 Ga0105242_10795438 Ga0105242_107954382 113
200 3300009176 Ga0105242_11074991 Ga0105242_110749912 113
201 3300009176 Ga0105242_11109514 Ga0105242_111095142 113
202 3300009177 Ga0105248_10011629 Ga0105248_100116299 113
203 3300009177 Ga0105248_10656158 Ga0105248_106561582 113
204 3300009177 Ga0105248_10984467 Ga0105248_109844672 113
205 3300009177 Ga0105248_11113255 Ga0105248_111132552 113
206 3300009177 Ga0105248_11439785 Ga0105248_114397852 113
207 3300009177 Ga0105248_11463128 Ga0105248_114631282 113
208 3300009177 Ga0105248_12312329 Ga0105248_123123291 113
209 3300009545 Ga0105237_10006194 Ga0105237_100061947 113
210 3300009545 Ga0105237_10081506 Ga0105237_100815062 113
211 3300009545 Ga0105237_10221318 Ga0105237_102213182 113
212 3300009545 Ga0105237_10306422 Ga0105237_103064222 113
213 3300009545 Ga0105237_10603930 Ga0105237_106039302 113
214 3300009551 Ga0105238_10021159 Ga0105238_100211592 113
215 3300009551 Ga0105238_10026274 Ga0105238_100262742 113
216 3300009551 Ga0105238_10027761 Ga0105238_100277613 113
217 3300009551 Ga0105238_10054332 Ga0105238_100543324 113
218 3300009551 Ga0105238_10101025 Ga0105238_101010252 113
219 3300009551 Ga0105238_10163931 Ga0105238_101639312 113
220 3300009551 Ga0105238_10333807 Ga0105238_103338072 113
221 3300009551 Ga0105238_10347896 Ga0105238_103478962 113
222 3300009551 Ga0105238_10360848 Ga0105238_103608482 113
223 3300009551 Ga0105238_11679978 Ga0105238_116799782 113
224 3300009551 Ga0105238_12977158 Ga0105238_129771581 113
225 3300009553 Ga0105249_10022197 Ga0105249_100221979 113
226 3300009553 Ga0105249_10643043 Ga0105249_106430432 113
227 3300010375 Ga0105239_10000773 Ga0105239_1000077310 113
228 3300010375 Ga0105239_10005761 Ga0105239_1000576115 113
229 3300010375 Ga0105239_10033970 Ga0105239_100339709 113
230 3300010375 Ga0105239_10094234 Ga0105239_100942342 113
231 3300010375 Ga0105239_10137495 Ga0105239_101374953 113
232 3300010375 Ga0105239_10155140 Ga0105239_101551402 113
233 3300010375 Ga0105239_10307089 Ga0105239_103070891 113
234 3300010375 Ga0105239_10386595 Ga0105239_103865952 113
235 3300010375 Ga0105239_10719255 Ga0105239_107192552 113
236 3300010375 Ga0105239_10738224 Ga0105239_107382242 113
237 3300010375 Ga0105239_11870747 Ga0105239_118707472 113
238 3300010375 Ga0105239_12110883 Ga0105239_121108831 113
239 3300011119 Ga0105246_10007879 Ga0105246_100078792 113
240 3300011119 Ga0105246_10025631 Ga0105246_100256314 113
241 3300011119 Ga0105246_10250915 Ga0105246_102509152 113
242 3300011119 Ga0105246_12050264 Ga0105246_120502641 113
243 3300011119 Ga0105246_12081611 Ga0105246_120816111 113
244 3300013100 Ga0157373_10113430 Ga0157373_101134302 113
245 3300013100 Ga0157373_10203172 Ga0157373_102031723 113
246 3300013104 Ga0157370_10308175 Ga0157370_103081751 113
247 3300013104 Ga0157370_11085276 Ga0157370_110852762 113
248 3300013104 Ga0157370_11349593 Ga0157370_113495931 113
249 3300013105 Ga0157369_10006833 Ga0157369_100068337 113
250 3300013105 Ga0157369_10093221 Ga0157369_100932212 113
251 3300013105 Ga0157369_10308078 Ga0157369_103080782 113
252 3300013105 Ga0157369_11218944 Ga0157369_112189442 113
253 3300013296 Ga0157374_10218974 Ga0157374_102189742 113
254 3300013296 Ga0157374_10452703 Ga0157374_104527032 113
255 3300013296 Ga0157374_10602680 Ga0157374_106026801 113
256 3300013296 Ga0157374_11238152 Ga0157374_112381522 113
257 3300013296 Ga0157374_11857461 Ga0157374_118574611 113
258 3300013296 Ga0157374_12011069 Ga0157374_120110692 113
259 3300013297 Ga0157378_10071851 Ga0157378_100718512 113
260 3300013297 Ga0157378_10110509 Ga0157378_101105092 113
261 3300013297 Ga0157378_10245859 Ga0157378_102458592 113
262 3300013297 Ga0157378_10851818 Ga0157378_108518182 113
263 3300013297 Ga0157378_10894072 Ga0157378_108940722 113
264 3300013306 Ga0163162_10007963 Ga0163162_100079637 113
265 3300013306 Ga0163162_10017004 Ga0163162_1001700412 113
266 3300013306 Ga0163162_10337398 Ga0163162_103373982 113
267 3300013306 Ga0163162_10376038 Ga0163162_103760382 113
268 3300013306 Ga0163162_10978312 Ga0163162_109783122 113
269 3300013307 Ga0157372_10599295 Ga0157372_105992952 113
270 3300013307 Ga0157372_10989414 Ga0157372_109894142 113
271 3300013307 Ga0157372_11297056 Ga0157372_112970562 113
272 3300013307 Ga0157372_13408340 Ga0157372_134083401 113
273 3300013308 Ga0157375_10062618 Ga0157375_100626184 113
274 3300013308 Ga0157375_10457413 Ga0157375_104574132 113
275 3300013308 Ga0157375_11384954 Ga0157375_113849541 113
276 3300013308 Ga0157375_11454083 Ga0157375_114540832 113
277 3300014325 Ga0163163_10000002 Ga0163163_10000002531 113
278 3300014325 Ga0163163_10046548 Ga0163163_100465482 113
279 3300014325 Ga0163163_10376517 Ga0163163_103765172 113
280 3300014325 Ga0163163_10659927 Ga0163163_106599272 113
281 3300014326 Ga0157380_10394813 Ga0157380_103948132 113
282 3300014326 Ga0157380_10623189 Ga0157380_106231892 113
283 3300014968 Ga0157379_10002165 Ga0157379_100021652 113
284 3300014968 Ga0157379_10008033 Ga0157379_1000803310 113
285 3300014968 Ga0157379_10338991 Ga0157379_103389912 113
286 3300014968 Ga0157379_10409263 Ga0157379_104092631 113
287 3300014968 Ga0157379_10441522 Ga0157379_104415222 113
288 3300014969 Ga0157376_10032666 Ga0157376_100326662 113
289 3300014969 Ga0157376_10391557 Ga0157376_103915572 113
290 3300014969 Ga0157376_10676179 Ga0157376_106761792 113
291 3300014969 Ga0157376_11432646 Ga0157376_114326461 113
292 3300014969 Ga0157376_11563866 Ga0157376_115638662 113
293 3300014969 Ga0157376_11851259 Ga0157376_118512591 113
294 3300017792 Ga0163161_10012129 Ga0163161_100121298 113
295 3300017792 Ga0163161_11816775 Ga0163161_118167752 113
296 3300021361 Ga0213872_10387999 Ga0213872_103879991 113
297 3300025261 Ga0209233_1000015 Ga0209233_1000015133 113
298 3300025261 Ga0209233_1013510 Ga0209233_10135102 113
299 3300025272 Ga0209455_1037664 Ga0209455_10376642 113
300 3300025297 Ga0209758_1000013 Ga0209758_1000013653 113
301 3300025893 Ga0207682_10196467 Ga0207682_101964672 113
302 3300025893 Ga0207682_10286502 Ga0207682_102865022 113
303 3300025898 Ga0207692_10503768 Ga0207692_105037682 113
304 3300025899 Ga0207642_10775903 Ga0207642_107759032 113
305 3300025901 Ga0207688_10046283 Ga0207688_100462832 113
306 3300025903 Ga0207680_10061233 Ga0207680_100612332 113
307 3300025907 Ga0207645_10012251 Ga0207645_100122512 113
308 3300025907 Ga0207645_10202490 Ga0207645_102024902 113
309 3300025909 Ga0207705_10013726 Ga0207705_100137262 113
310 3300025909 Ga0207705_10023616 Ga0207705_100236162 113
311 3300025909 Ga0207705_10762388 Ga0207705_107623882 113
312 3300025909 Ga0207705_11000440 Ga0207705_110004402 113
313 3300025911 Ga0207654_10183605 Ga0207654_101836052 113
314 3300025911 Ga0207654_10279973 Ga0207654_102799732 113
315 3300025911 Ga0207654_10421701 Ga0207654_104217012 113
316 3300025911 Ga0207654_10442703 Ga0207654_104427032 113
317 3300025912 Ga0207707_10079800 Ga0207707_100798004 113
318 3300025912 Ga0207707_10842925 Ga0207707_108429252 113
319 3300025913 Ga0207695_10009553 Ga0207695_1000955312 113
320 3300025913 Ga0207695_10014852 Ga0207695_100148526 113
321 3300025913 Ga0207695_10086177 Ga0207695_100861771 113
322 3300025913 Ga0207695_10094972 Ga0207695_100949722 113
323 3300025913 Ga0207695_10095356 Ga0207695_100953563 113
324 3300025913 Ga0207695_10196644 Ga0207695_101966442 113
325 3300025913 Ga0207695_10223533 Ga0207695_102235332 113
326 3300025913 Ga0207695_10280228 Ga0207695_102802282 113
327 3300025913 Ga0207695_10331027 Ga0207695_103310272 113
328 3300025913 Ga0207695_10814812 Ga0207695_108148122 113
329 3300025913 Ga0207695_11273852 Ga0207695_112738521 113
330 3300025914 Ga0207671_10042949 Ga0207671_100429493 113
331 3300025914 Ga0207671_10063932 Ga0207671_100639322 113
332 3300025914 Ga0207671_10071874 Ga0207671_100718742 113
333 3300025914 Ga0207671_10177693 Ga0207671_101776932 113
334 3300025914 Ga0207671_10910518 Ga0207671_109105182 113
335 3300025915 Ga0207693_11249677 Ga0207693_112496771 113
336 3300025917 Ga0207660_10075357 Ga0207660_100753573 113
337 3300025917 Ga0207660_10599209 Ga0207660_105992092 113
338 3300025919 Ga0207657_10093351 Ga0207657_100933512 113
339 3300025919 Ga0207657_10148135 Ga0207657_101481352 113
340 3300025919 Ga0207657_10206830 Ga0207657_102068302 113
341 3300025919 Ga0207657_10879797 Ga0207657_108797972 113
342 3300025919 Ga0207657_10971392 Ga0207657_109713922 113
343 3300025920 Ga0207649_10000154 Ga0207649_1000015427 113
344 3300025920 Ga0207649_10064343 Ga0207649_100643432 113
345 3300025920 Ga0207649_10143320 Ga0207649_101433202 113
346 3300025920 Ga0207649_10479626 Ga0207649_104796261 113
347 3300025921 Ga0207652_10039728 Ga0207652_100397283 113
348 3300025921 Ga0207652_10086124 Ga0207652_100861242 113
349 3300025921 Ga0207652_10237262 Ga0207652_102372622 113
350 3300025921 Ga0207652_10664389 Ga0207652_106643891 113
351 3300025924 Ga0207694_10000005 Ga0207694_10000005112 113
352 3300025924 Ga0207694_10062919 Ga0207694_100629192 113
353 3300025924 Ga0207694_10245087 Ga0207694_102450872 113
354 3300025924 Ga0207694_10326452 Ga0207694_103264521 113
355 3300025924 Ga0207694_10497800 Ga0207694_104978002 113
356 3300025924 Ga0207694_10802022 Ga0207694_108020222 113
357 3300025925 Ga0207650_10212763 Ga0207650_102127632 113
358 3300025925 Ga0207650_10330052 Ga0207650_103300522 113
359 3300025926 Ga0207659_10188169 Ga0207659_101881692 113
360 3300025926 Ga0207659_10344040 Ga0207659_103440402 113
361 3300025926 Ga0207659_11714851 Ga0207659_117148511 113
362 3300025927 Ga0207687_10009197 Ga0207687_100091976 113
363 3300025927 Ga0207687_10019917 Ga0207687_100199174 113
364 3300025927 Ga0207687_10098518 Ga0207687_100985182 113
365 3300025927 Ga0207687_10226890 Ga0207687_102268902 113
366 3300025929 Ga0207664_10135221 Ga0207664_101352212 113
367 3300025931 Ga0207644_10674731 Ga0207644_106747312 113
368 3300025932 Ga0207690_10204139 Ga0207690_102041392 113
369 3300025932 Ga0207690_10478627 Ga0207690_104786272 113
370 3300025932 Ga0207690_10509621 Ga0207690_105096212 113
371 3300025934 Ga0207686_10064734 Ga0207686_100647343 113
372 3300025934 Ga0207686_10078192 Ga0207686_100781923 113
373 3300025934 Ga0207686_10110128 Ga0207686_101101282 113
374 3300025934 Ga0207686_11269832 Ga0207686_112698322 113
375 3300025935 Ga0207709_10003554 Ga0207709_100035545 113
376 3300025936 Ga0207670_10048540 Ga0207670_100485402 113
377 3300025937 Ga0207669_11216068 Ga0207669_112160681 113
378 3300025938 Ga0207704_10101507 Ga0207704_101015072 113
379 3300025938 Ga0207704_10217172 Ga0207704_102171722 113
380 3300025938 Ga0207704_10957345 Ga0207704_109573452 113
381 3300025940 Ga0207691_10327109 Ga0207691_103271092 113
382 3300025940 Ga0207691_10454130 Ga0207691_104541302 113
383 3300025940 Ga0207691_11201930 Ga0207691_112019302 113
384 3300025941 Ga0207711_10017346 Ga0207711_100173463 113
385 3300025941 Ga0207711_10733953 Ga0207711_107339532 113
386 3300025942 Ga0207689_10090030 Ga0207689_100900302 113
387 3300025942 Ga0207689_10197182 Ga0207689_101971822 113
388 3300025942 Ga0207689_10221631 Ga0207689_102216312 113
389 3300025944 Ga0207661_10334937 Ga0207661_103349373 113
390 3300025944 Ga0207661_10412591 Ga0207661_104125912 113
391 3300025944 Ga0207661_11436908 Ga0207661_114369082 113
392 3300025949 Ga0207667_10000061 Ga0207667_10000061158 113
393 3300025949 Ga0207667_10102112 Ga0207667_101021122 113
394 3300025949 Ga0207667_10209669 Ga0207667_102096693 113
395 3300025949 Ga0207667_11210835 Ga0207667_112108352 113
396 3300025960 Ga0207651_10121242 Ga0207651_101212422 113
397 3300025960 Ga0207651_10207970 Ga0207651_102079702 113
398 3300025960 Ga0207651_11276443 Ga0207651_112764432 113
399 3300025961 Ga0207712_10590589 Ga0207712_105905891 113
400 3300025961 Ga0207712_10965382 Ga0207712_109653821 113
401 3300025972 Ga0207668_11215984 Ga0207668_112159842 113
402 3300025986 Ga0207658_10123750 Ga0207658_101237502 113
403 3300025986 Ga0207658_10205232 Ga0207658_102052322 113
404 3300025986 Ga0207658_10306719 Ga0207658_103067191 113
405 3300025986 Ga0207658_10495163 Ga0207658_104951632 113
406 3300026023 Ga0207677_10037356 Ga0207677_100373563 113
407 3300026023 Ga0207677_10300917 Ga0207677_103009172 113
408 3300026023 Ga0207677_10655283 Ga0207677_106552832 113
409 3300026023 Ga0207677_10764671 Ga0207677_107646712 113
410 3300026035 Ga0207703_10148001 Ga0207703_101480012 113
411 3300026035 Ga0207703_10661906 Ga0207703_106619062 113
412 3300026035 Ga0207703_11329333 Ga0207703_113293331 113
413 3300026041 Ga0207639_10077628 Ga0207639_100776282 113
414 3300026041 Ga0207639_10225952 Ga0207639_102259521 113
415 3300026041 Ga0207639_10792242 Ga0207639_107922422 113
416 3300026041 Ga0207639_10854120 Ga0207639_108541202 113
417 3300026041 Ga0207639_10899508 Ga0207639_108995082 113
418 3300026041 Ga0207639_11475173 Ga0207639_114751732 113
419 3300026075 Ga0207708_10825482 Ga0207708_108254822 113
420 3300026078 Ga0207702_10322797 Ga0207702_103227972 113
421 3300026078 Ga0207702_10513293 Ga0207702_105132932 113
422 3300026078 Ga0207702_10605112 Ga0207702_106051122 113
423 3300026078 Ga0207702_10747563 Ga0207702_107475631 113
424 3300026078 Ga0207702_11287772 Ga0207702_112877722 113
425 3300026078 Ga0207702_12083602 Ga0207702_120836022 113
426 3300026088 Ga0207641_10574161 Ga0207641_105741612 113
427 3300026088 Ga0207641_10835318 Ga0207641_108353182 113
428 3300026088 Ga0207641_12268575 Ga0207641_122685751 113
429 3300026089 Ga0207648_10044599 Ga0207648_100445994 113
430 3300026089 Ga0207648_10305595 Ga0207648_103055952 113
431 3300026089 Ga0207648_10910601 Ga0207648_109106012 113
432 3300026116 Ga0207674_10019842 Ga0207674_100198425 113
433 3300026116 Ga0207674_10101739 Ga0207674_101017392 113
434 3300026116 Ga0207674_10189883 Ga0207674_101898833 113
435 3300026116 Ga0207674_10489372 Ga0207674_104893722 113
436 3300026116 Ga0207674_11440775 Ga0207674_114407752 113
437 3300026118 Ga0207675_101417446 Ga0207675_1014174462 113
438 3300026121 Ga0207683_10008807 Ga0207683_1000880713 113
439 3300026121 Ga0207683_10019373 Ga0207683_100193735 113
440 3300026121 Ga0207683_10142869 Ga0207683_101428692 113
441 3300026121 Ga0207683_10336105 Ga0207683_103361053 113
442 3300026121 Ga0207683_10848938 Ga0207683_108489382 113
443 3300026142 Ga0207698_10104179 Ga0207698_101041792 113
444 3300026142 Ga0207698_10181392 Ga0207698_101813922 113
445 3300026142 Ga0207698_10206210 Ga0207698_102062102 113
446 3300026142 Ga0207698_11545910 Ga0207698_115459102 113
447 3300026142 Ga0207698_11580649 Ga0207698_115806492 113
448 3300028379 Ga0268266_10000695 Ga0268266_1000069513 113
449 3300028379 Ga0268266_10022016 Ga0268266_100220164 113
450 3300028379 Ga0268266_10131661 Ga0268266_101316612 113
451 3300028379 Ga0268266_10139343 Ga0268266_101393432 113
452 3300028379 Ga0268266_10169932 Ga0268266_101699323 113
453 3300028379 Ga0268266_10230934 Ga0268266_102309342 113
454 3300028379 Ga0268266_10238747 Ga0268266_102387472 113
455 3300028379 Ga0268266_10389306 Ga0268266_103893062 113
456 3300028379 Ga0268266_10594696 Ga0268266_105946962 113
457 3300028379 Ga0268266_10942418 Ga0268266_109424182 113
458 3300028380 Ga0268265_10842929 Ga0268265_108429291 113
459 3300028381 Ga0268264_10873627 Ga0268264_108736272 113
460 3300028573 Ga0265334_10347447 Ga0265334_103474471 113
461 3300028577 Ga0265318_10003384 Ga0265318_100033844 113
462 3300028577 Ga0265318_10366214 Ga0265318_103662142 113
463 3300028800 Ga0265338_10022918 Ga0265338_100229182 113
464 3300031235 Ga0265330_10004583 Ga0265330_100045832 113
465 3300031235 Ga0265330_10025693 Ga0265330_100256932 113
466 3300031235 Ga0265330_10129090 Ga0265330_101290902 113
467 3300031235 Ga0265330_10198576 Ga0265330_101985762 113
468 3300031238 Ga0265332_10098715 Ga0265332_100987151 113
469 3300031238 Ga0265332_10120360 Ga0265332_101203601 113
470 3300031238 Ga0265332_10411277 Ga0265332_104112772 113
471 3300031239 Ga0265328_10072595 Ga0265328_100725952 113
472 3300031239 Ga0265328_10343895 Ga0265328_103438952 113
473 3300031240 Ga0265320_10289178 Ga0265320_102891782 113
474 3300031241 Ga0265325_10014465 Ga0265325_100144654 113
475 3300031241 Ga0265325_10033117 Ga0265325_100331173 113
476 3300031241 Ga0265325_10142454 Ga0265325_101424542 113
477 3300031247 Ga0265340_10000045 Ga0265340_1000004535 113
478 3300031247 Ga0265340_10245018 Ga0265340_102450182 113
479 3300031247 Ga0265340_10407665 Ga0265340_104076652 113
480 3300031249 Ga0265339_10011572 Ga0265339_100115724 113
481 3300031249 Ga0265339_10094711 Ga0265339_100947111 113
482 3300031249 Ga0265339_10184775 Ga0265339_101847751 113
483 3300031249 Ga0265339_10607311 Ga0265339_106073112 113
484 3300031250 Ga0265331_10000113 Ga0265331_1000011385 113
485 3300031250 Ga0265331_10032183 Ga0265331_100321832 113
486 3300031250 Ga0265331_10073193 Ga0265331_100731932 113
487 3300031250 Ga0265331_10126046 Ga0265331_101260462 113
488 3300031344 Ga0265316_10021874 Ga0265316_100218743 113
489 3300031344 Ga0265316_10089537 Ga0265316_100895372 113
490 3300031344 Ga0265316_10135749 Ga0265316_101357493 113
491 3300031344 Ga0265316_10265375 Ga0265316_102653752 113
492 3300031344 Ga0265316_10390079 Ga0265316_103900791 113
493 3300031456 Ga0307513_10519726 Ga0307513_105197262 113
494 3300031595 Ga0265313_10016173 Ga0265313_100161732 113
495 3300031595 Ga0265313_10017499 Ga0265313_100174992 113
496 3300031595 Ga0265313_10198786 Ga0265313_101987862 113
497 3300031711 Ga0265314_10006495 Ga0265314_100064958 113
498 3300031711 Ga0265314_10029553 Ga0265314_100295532 113
499 3300031711 Ga0265314_10033294 Ga0265314_100332942 113
500 3300031711 Ga0265314_10045594 Ga0265314_100455943 113
501 3300031711 Ga0265314_10097346 Ga0265314_100973462 113
502 3300031711 Ga0265314_10247942 Ga0265314_102479422 113
503 3300031711 Ga0265314_10601940 Ga0265314_106019401 113
504 3300031712 Ga0265342_10018674 Ga0265342_100186747 113
505 3300031712 Ga0265342_10045634 Ga0265342_100456342 113
506 3300031712 Ga0265342_10069717 Ga0265342_100697172 113
507 3300031712 Ga0265342_10145502 Ga0265342_101455022 113
508 3300031712 Ga0265342_10163821 Ga0265342_101638212 113
509 3300031730 Ga0307516_10059575 Ga0307516_100595754 113
510 3300031730 Ga0307516_10192641 Ga0307516_101926412 113
511 3300031730 Ga0307516_10231713 Ga0307516_102317132 113
512 3300031824 Ga0307413_11513331 Ga0307413_115133312 113
513 3300035112 Ga0373932_0243788 Ga0373932_0243788_248_589 113
514 3300035692 Ga0373935_0659309 Ga0373935_0659309_400_744 113
515 3300036401 Ga0373937_0744256 Ga0373937_0744256_130_471 113
516 3300037312 Ga0395899_0069184 Ga0395899_0069184_1593_1934 113
517 3300037418 Ga0395900_0010488 Ga0395900_0010488_4977_5318 113
518 3300037418 Ga0395900_0218624 Ga0395900_0218624_1294_1635 113
519 3300037466 Ga0395898_0008354 Ga0395898_0008354_766_1107 113
520 3300037466 Ga0395898_0045250 Ga0395898_0045250_1801_2142 113
521 3300038443 Ga0395901_0167509 Ga0395901_0167509_661_1002 113
522 3300039437 Ga0436365_1687461 Ga0436365_1687461_280_621 113
523 3300039447 Ga0436361_0180372 Ga0436361_0180372_188_529 113
524 3300041441 Ga0451787_799516 Ga0451787_799516_62_403 113
525 3300044694 Ga0466963_1218914 Ga0466963_1218914_172_513 113
526 3300044842 Ga0466957_0457269 Ga0466957_0457269_154_495 113
527 3300045976 Ga0466967_0748036 Ga0466967_0748036_49_390 113
528 3300046454 Ga0495592_0715296 Ga0495592_0715296_60_401 113
529 3300046471 Ga0495650_0334024 Ga0495650_0334024_35_376 113
530 3300046492 Ga0495585_0412578 Ga0495585_0412578_56_397 113
531 3300046499 Ga0495594_0371709 Ga0495594_0371709_76_417 113
532 3300046507 Ga0495606_0320179 Ga0495606_0320179_297_638 113
533 3300046514 Ga0495618_0555183 Ga0495618_0555183_247_588 113
534 3300046515 Ga0495620_0198172 Ga0495620_0198172_11_352 113
535 3300046515 Ga0495620_0382723 Ga0495620_0382723_73_414 113
536 3300046523 Ga0495644_0073952 Ga0495644_0073952_611_952 113
537 3300046524 Ga0495648_0103502 Ga0495648_0103502_262_603 113
538 3300046529 Ga0495652_0090157 Ga0495652_0090157_2037_2381 113
539 3300046529 Ga0495652_0227147 Ga0495652_0227147_903_1244 113
540 3300046530 Ga0495654_0070804 Ga0495654_0070804_24_365 113
541 3300046536 Ga0495587_0318924 Ga0495587_0318924_133_477 113
542 3300046536 Ga0495587_0582405 Ga0495587_0582405_95_436 113
543 3300046538 Ga0495609_0022902 Ga0495609_0022902_207_548 113
544 3300046539 Ga0495621_0063918 Ga0495621_0063918_192_533 113
545 3300046557 Ga0495622_0012617 Ga0495622_0012617_1397_1738 113
546 3300046559 Ga0495667_0423198 Ga0495667_0423198_454_798 113
547 3300046642 Ga0495634_0816620 Ga0495634_0816620_49_390 113
548 3300046648 Ga0495611_0324553 Ga0495611_0324553_326_667 113
549 3300046675 Ga0495657_0425743 Ga0495657_0425743_13_354 113
550 3300046675 Ga0495657_0511511 Ga0495657_0511511_13_354 113
551 3300046679 Ga0495623_0169952 Ga0495623_0169952_790_1131 113
552 3300046689 Ga0495613_0234497 Ga0495613_0234497_734_1075 113
553 3300046690 Ga0495624_0690953 Ga0495624_0690953_144_485 113
554 3300046694 Ga0495649_0182687 Ga0495649_0182687_345_686 113
555 3300047317 Ga0495604_0806832 Ga0495604_0806832_46_387 113
556 3300047320 Ga0495672_0147535 Ga0495672_0147535_400_741 113
557 3300047320 Ga0495672_0313084 Ga0495672_0313084_140_481 113
558 3300047321 Ga0495676_0696077 Ga0495676_0696077_79_420 113
559 3300048088 Ga0495602_0023569 Ga0495602_0023569_1863_2204 113
560 3300048088 Ga0495602_0719205 Ga0495602_0719205_93_434 113
561 3300048903 Ga0496100_1094406 Ga0496100_1094406_237_596 113
562 3300048904 Ga0496101_0877094 Ga0496101_0877094_76_417 113
563 3300048910 Ga0496107_1105017 Ga0496107_1105017_118_459 113
564 3300048924 Ga0496121_0000527 Ga0496121_0000527_31014_31355 113
565 3300048924 Ga0496121_0522411 Ga0496121_0522411_259_600 113
566 3300048929 Ga0496126_0128976 Ga0496126_0128976_334_675 113
567 3300049460 Ga0495682_0001570 Ga0495682_0001570_9309_9653 113
568 3300049568 Ga0501031_0010452 Ga0501031_0010452_278_619 113
569 3300049568 Ga0501031_0248295 Ga0501031_0248295_30_371 113
570 3300049568 Ga0501031_0290003 Ga0501031_0290003_547_891 113
571 3300049568 Ga0501031_0504673 Ga0501031_0504673_378_719 113
572 3300049568 Ga0501031_0894323 Ga0501031_0894323_64_405 113
573 3300049569 Ga0501032_0005257 Ga0501032_0005257_6240_6581 113
574 3300049569 Ga0501032_0208279 Ga0501032_0208279_618_962 113
575 3300049569 Ga0501032_0241709 Ga0501032_0241709_696_1037 113
576 3300049569 Ga0501032_0420884 Ga0501032_0420884_281_622 113
577 3300049569 Ga0501032_0513743 Ga0501032_0513743_334_675 113
578 3300049570 Ga0501033_0018503 Ga0501033_0018503_770_1111 113
579 3300049570 Ga0501033_0030587 Ga0501033_0030587_2298_2639 113
580 3300049570 Ga0501033_0033037 Ga0501033_0033037_2652_2993 113
581 3300049570 Ga0501033_0035122 Ga0501033_0035122_3134_3475 113
582 3300049570 Ga0501033_0042807 Ga0501033_0042807_1093_1434 113
583 3300049570 Ga0501033_0048041 Ga0501033_0048041_38_379 113
584 3300049570 Ga0501033_0191720 Ga0501033_0191720_561_902 113
585 3300049570 Ga0501033_0210770 Ga0501033_0210770_594_935 113
586 3300049570 Ga0501033_0250301 Ga0501033_0250301_541_882 113
587 3300049570 Ga0501033_0425434 Ga0501033_0425434_375_716 113
588 3300049570 Ga0501033_0436740 Ga0501033_0436740_528_869 113
589 3300049570 Ga0501033_0473224 Ga0501033_0473224_95_436 113
590 3300049571 Ga0501034_0014485 Ga0501034_0014485_1669_2010 113
591 3300049571 Ga0501034_0020591 Ga0501034_0020591_4381_4722 113
592 3300049571 Ga0501034_0026236 Ga0501034_0026236_3687_4028 113
593 3300049571 Ga0501034_0069108 Ga0501034_0069108_2364_2708 113
594 3300049571 Ga0501034_0075264 Ga0501034_0075264_1951_2295 113
595 3300049571 Ga0501034_0115624 Ga0501034_0115624_884_1225 113
596 3300049571 Ga0501034_0171340 Ga0501034_0171340_1703_2044 113
597 3300049571 Ga0501034_0265856 Ga0501034_0265856_335_676 113
598 3300049571 Ga0501034_0649476 Ga0501034_0649476_264_605 113
599 3300049571 Ga0501034_0803192 Ga0501034_0803192_36_377 113
600 3300049571 Ga0501034_0971349 Ga0501034_0971349_303_644 113
601 3300049571 Ga0501034_1175288 Ga0501034_1175288_234_575 113
602 3300049572 Ga0501036_0004837 Ga0501036_0004837_6494_6835 113
603 3300049572 Ga0501036_0086475 Ga0501036_0086475_1647_1988 113
604 3300049572 Ga0501036_0139317 Ga0501036_0139317_1366_1710 113
605 3300049572 Ga0501036_0182086 Ga0501036_0182086_120_461 113
606 3300049572 Ga0501036_0252789 Ga0501036_0252789_253_594 113
607 3300049572 Ga0501036_1004522 Ga0501036_1004522_30_371 113
608 3300049573 Ga0501037_0034928 Ga0501037_0034928_36_377 113
609 3300049573 Ga0501037_0075325 Ga0501037_0075325_92_433 113
610 3300049573 Ga0501037_0137764 Ga0501037_0137764_757_1098 113
611 3300049573 Ga0501037_0310692 Ga0501037_0310692_392_733 113
612 3300049573 Ga0501037_0990662 Ga0501037_0990662_129_473 113
613 3300049574 Ga0501038_0021951 Ga0501038_0021951_4310_4651 113
614 3300049574 Ga0501038_0049270 Ga0501038_0049270_2339_2680 113
615 3300049574 Ga0501038_0088552 Ga0501038_0088552_1887_2228 113
616 3300049574 Ga0501038_0111908 Ga0501038_0111908_480_821 113
617 3300049575 Ga0501039_0041675 Ga0501039_0041675_1691_2032 113
618 3300049575 Ga0501039_1156317 Ga0501039_1156317_147_488 113
619 3300049576 Ga0501040_0114960 Ga0501040_0114960_272_613 113
620 3300049578 Ga0501042_0067410 Ga0501042_0067410_1796_2137 113
621 3300049579 Ga0501043_0019544 Ga0501043_0019544_4645_4986 113
622 3300049579 Ga0501043_0312139 Ga0501043_0312139_442_783 113
623 3300049579 Ga0501043_0363296 Ga0501043_0363296_725_1066 113
624 3300049579 Ga0501043_0619888 Ga0501043_0619888_366_707 113
625 3300049580 Ga0501046_0006506 Ga0501046_0006506_2836_3177 113
626 3300049580 Ga0501046_0007976 Ga0501046_0007976_5223_5564 113
627 3300049580 Ga0501046_0133396 Ga0501046_0133396_885_1226 113
628 3300049580 Ga0501046_1068265 Ga0501046_1068265_124_465 113
629 3300049581 Ga0501047_0005573 Ga0501047_0005573_5669_6010 113
630 3300049581 Ga0501047_0012160 Ga0501047_0012160_4557_4898 113
631 3300049581 Ga0501047_0024719 Ga0501047_0024719_595_936 113
632 3300049581 Ga0501047_0051529 Ga0501047_0051529_3016_3357 113
633 3300049581 Ga0501047_0055987 Ga0501047_0055987_1828_2169 113
634 3300049581 Ga0501047_0058311 Ga0501047_0058311_2252_2593 113
635 3300049581 Ga0501047_0062071 Ga0501047_0062071_1477_1821 113
636 3300049581 Ga0501047_0079600 Ga0501047_0079600_2539_2880 113
637 3300049581 Ga0501047_0281357 Ga0501047_0281357_242_583 113
638 3300049581 Ga0501047_0422663 Ga0501047_0422663_486_827 113
639 3300049581 Ga0501047_0532185 Ga0501047_0532185_231_572 113
640 3300049581 Ga0501047_0639114 Ga0501047_0639114_470_811 113
641 3300049582 Ga0501048_0009781 Ga0501048_0009781_411_752 113
642 3300049582 Ga0501048_0011718 Ga0501048_0011718_296_640 113
643 3300049583 Ga0501067_0002975 Ga0501067_0002975_3454_3795 113
644 3300049583 Ga0501067_0014512 Ga0501067_0014512_2809_3153 113
645 3300049584 Ga0501068_0099997 Ga0501068_0099997_317_658 113
646 3300049584 Ga0501068_0846855 Ga0501068_0846855_154_495 113
647 3300049585 Ga0501069_0010175 Ga0501069_0010175_629_970 113
648 3300049586 Ga0501070_0001596 Ga0501070_0001596_4113_4457 113
649 3300049586 Ga0501070_0010156 Ga0501070_0010156_1062_1403 113
650 3300049586 Ga0501070_0504077 Ga0501070_0504077_535_876 113
651 3300049586 Ga0501070_1181614 Ga0501070_1181614_185_526 113
652 3300049588 Ga0501072_0029247 Ga0501072_0029247_3468_3812 113
653 3300049588 Ga0501072_0124768 Ga0501072_0124768_1107_1448 113
654 3300049589 Ga0501073_0008387 Ga0501073_0008387_5301_5642 113
655 3300049589 Ga0501073_0128979 Ga0501073_0128979_579_920 113
656 3300049589 Ga0501073_0230136 Ga0501073_0230136_267_611 113
657 3300049589 Ga0501073_0491811 Ga0501073_0491811_141_482 113
658 3300049590 Ga0501074_0022031 Ga0501074_0022031_653_994 113
659 3300049590 Ga0501074_0154709 Ga0501074_0154709_695_1039 113
660 3300049592 Ga0501076_0874976 Ga0501076_0874976_377_718 113
661 3300049741 Ga0501079_0009686 Ga0501079_0009686_4191_4532 113
662 3300049741 Ga0501079_0068919 Ga0501079_0068919_1117_1461 113
663 3300049742 Ga0501080_0044620 Ga0501080_0044620_525_866 113
664 3300049742 Ga0501080_0081720 Ga0501080_0081720_1108_1449 113
665 3300049742 Ga0501080_0161758 Ga0501080_0161758_607_951 113
666 3300049742 Ga0501080_0325419 Ga0501080_0325419_324_665 113
667 3300049742 Ga0501080_0345073 Ga0501080_0345073_855_1196 113
668 3300049742 Ga0501080_0444054 Ga0501080_0444054_658_999 113
669 3300049744 Ga0501083_0002469 Ga0501083_0002469_7733_8074 113
670 3300049744 Ga0501083_0054975 Ga0501083_0054975_2271_2612 113
671 3300049744 Ga0501083_0134421 Ga0501083_0134421_968_1309 113
672 3300049822 Ga0501035_0081616 Ga0501035_0081616_2387_2728 113
673 3300049822 Ga0501035_0084164 Ga0501035_0084164_1702_2043 113
674 3300049822 Ga0501035_0103141 Ga0501035_0103141_1642_1983 113
675 3300049822 Ga0501035_0104314 Ga0501035_0104314_1898_2239 113
676 3300049822 Ga0501035_0105357 Ga0501035_0105357_1050_1391 113
677 3300049822 Ga0501035_0108946 Ga0501035_0108946_706_1047 113
678 3300049822 Ga0501035_0135193 Ga0501035_0135193_1427_1768 113
679 3300049822 Ga0501035_0179992 Ga0501035_0179992_1330_1671 113
680 3300049822 Ga0501035_0248191 Ga0501035_0248191_825_1166 113
681 3300049822 Ga0501035_0276308 Ga0501035_0276308_734_1075 113
682 3300049823 Ga0501044_0008181 Ga0501044_0008181_2334_2675 113
683 3300049823 Ga0501044_0024973 Ga0501044_0024973_4363_4707 113
684 3300049823 Ga0501044_0051027 Ga0501044_0051027_3401_3742 113
685 3300049823 Ga0501044_0071373 Ga0501044_0071373_2839_3180 113
686 3300049823 Ga0501044_0090489 Ga0501044_0090489_14_355 113
687 3300049823 Ga0501044_0105596 Ga0501044_0105596_1869_2210 113
688 3300049823 Ga0501044_0151801 Ga0501044_0151801_614_955 113
689 3300049823 Ga0501044_0196576 Ga0501044_0196576_633_974 113
690 3300049823 Ga0501044_0321554 Ga0501044_0321554_343_684 113
691 3300049823 Ga0501044_0681360 Ga0501044_0681360_95_436 113
692 3300049823 Ga0501044_0924242 Ga0501044_0924242_303_644 113
693 3300049823 Ga0501044_0940804 Ga0501044_0940804_61_402 113
694 3300049823 Ga0501044_1047589 Ga0501044_1047589_94_435 113
695 3300049823 Ga0501044_1069443 Ga0501044_1069443_35_376 113
696 3300049824 Ga0501045_0440132 Ga0501045_0440132_111_452 113
697 3300053087 Ga0500643_000003 Ga0500643_000003_326888_327229 113
698 3300053090 Ga0500646_0138052 Ga0500646_0138052_265_606 113
699 3300053103 Ga0500555_125407 Ga0500555_125407_101_442 113
700 3300053119 Ga0500595_001154 Ga0500595_001154_4912_5253 113
701 3300053119 Ga0500595_021631 Ga0500595_021631_1662_2003 113
702 3300053119 Ga0500595_026422 Ga0500595_026422_1064_1405 113
703 3300053119 Ga0500595_044650 Ga0500595_044650_853_1194 113
704 3300053130 Ga0500642_0203143 Ga0500642_0203143_203_544 113
705 3300053133 Ga0500655_027659 Ga0500655_027659_233_577 113
706 3300053136 Ga0500559_0024113 Ga0500559_0024113_2154_2495 113
707 3300053136 Ga0500559_0024947 Ga0500559_0024947_2160_2501 113
708 3300053139 Ga0500568_0130986 Ga0500568_0130986_161_502 113
709 3300053140 Ga0500573_0000025 Ga0500573_0000025_34601_34942 113
710 3300053730 Ga0500645_019051 Ga0500645_019051_511_852 113
711 3300054114 Ga0501084_0163445 Ga0501084_0163445_586_930 113
712 3300060353 Ga0501082_0035263 Ga0501082_0035263_525_866 113
713 3300060353 Ga0501082_0066011 Ga0501082_0066011_127_471 113
714 3300060353 Ga0501082_0278461 Ga0501082_0278461_565_906 113

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01502

PRA-CH

Phosphoribosyl-AMP cyclohydrolase

39

112

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bgn-assembly3.cif.gz_F crystal structure of mthisn2-amp complex, a bifunctional enzyme from the histidine biosynthetic pathway 0.9114 11 112
7bgn-assembly2.cif.gz_C crystal structure of mthisn2-amp complex, a bifunctional enzyme from the histidine biosynthetic pathway 0.909 11 112
7bgn-assembly3.cif.gz_E crystal structure of mthisn2-amp complex, a bifunctional enzyme from the histidine biosynthetic pathway 0.9069 11 112
7bgn-assembly2.cif.gz_D crystal structure of mthisn2-amp complex, a bifunctional enzyme from the histidine biosynthetic pathway 0.9009 8 112
7bgn-assembly1.cif.gz_A crystal structure of mthisn2-amp complex, a bifunctional enzyme from the histidine biosynthetic pathway 0.8973 8 112
ID Description Score Start End Superfamily
af_P9WMM7_1_97_3.10.20.810 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase 0.9619 10 100 3.10.20.810
af_C6TGF5_46_140_3.10.20.810 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase 0.9477 8 100 3.10.20.810
1zpsA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase 0.946 11 100 3.10.20.810
af_C6TGF5_46_140_3.10.20.810 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase 0.9193 8 100 3.10.20.810
af_Q2FUU3_250_343_3.10.20.810 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphoribosyl-AMP cyclohydrolase 0.9147 12 100 3.10.20.810
ID Description Score Start End GO Terms
AF-A0A4Q4CI81-F1-model_v4 phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19) 0.9863 8 96 GO:0000105
GO:0004635
AF-A0A3D0G834-F1-model_v4 phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19) 0.9706 11 102 GO:0000105
GO:0004635
AF-A0A3M2FVE2-F1-model_v4 phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19) 0.9665 5 98 GO:0000105
GO:0004635
AF-A0A7W1SMB6-F1-model_v4 phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19) 0.9608 5 96 GO:0000105
GO:0004635
AF-A0A7X8RFN4-F1-model_v4 phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19) 0.9596 12 103 GO:0000105
GO:0004635

Feature Viewer

pLDDT pTM Quality
88.91 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map