F476929

General Info

Members Datasets Scaffolds Average Seq Length
714 314 703 541

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100001198|Ga0070665_1000011988
Length 565
Sequence MSSTQQPPLSPQPVAEQQLPKEHYLNATYGIRSWLLTTDHKRIAILYLISVTFFFFVGGIFASLIRIHLLTPGGYLVTPETYNKLFTMHGVAMIFFFLIPSIPAVLGNFLIPIMVGAKDLAFPKINLLSWYIYLVGGAFVLYSFATGGLDTGWTFYTPLSSIYSNSAVTPAVIGIFINGFSSILTGLNFIITVHTMRAPGMTWFRLPLFVWAHYATSIIFILGTPVIAITLLLAGLERMFHMGFFNPAYGGDPILFQHLFWFYSHPAVYIMILPAMGVISEIIPTFARKPIFGYDFIAASSIGIAVIGFIVWAHHMFLTGQSTYSALAFSFLTFLVAVPSAVKVFNWTATLYKGSISFDTPMLYGLGFIGLFTIGGLTGLFLACLGLDIHLHDTYFVVAHFHYIMVGGAIMGYLGGIHFWWPKITGRLYPEYLARIAAITLFVGFNLTFFPQFILGYLGMPRRYHNYPPEYQVLNVMSTAGASILALGYLLPMIYLTWSMRYGKVAGKNPWPSTGLEWTTDSPPLTENFRETPVVDWEPYDFMHRPELGLLGATSKKPVPAHGDD

Samples

Sample ID Description Type Environment
1 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
2 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
3 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
4 2902330777 Methylobacterium sp. 2A Isolate Unclassified
5 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
6 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
7 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
8 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
9 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
10 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
73 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
74 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
82 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
83 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
90 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
114 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
115 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
170 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
173 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
176 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
177 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
178 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
179 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
180 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
181 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
182 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
183 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
184 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
185 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
186 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
187 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
188 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
189 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
190 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
191 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
192 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
193 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
194 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
195 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
196 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
197 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
198 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
199 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
200 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
201 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
202 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
203 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
204 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
205 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
206 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
207 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
208 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
209 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
210 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
211 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
212 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
213 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
214 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
215 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
216 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
217 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
218 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
219 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
220 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
221 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
222 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
223 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
224 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
225 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
226 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
227 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
228 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
229 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
230 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
231 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
232 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
233 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
234 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
235 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
236 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
237 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
238 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
239 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
240 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
241 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
242 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
243 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
244 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
245 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
246 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
247 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
248 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
249 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
250 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
251 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
252 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
253 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
254 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
255 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
256 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
257 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
258 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
259 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
260 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
261 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
262 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
263 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
264 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
265 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
266 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
267 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
268 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
269 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
270 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
271 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
272 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
273 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
274 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
275 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
276 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
277 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
286 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
287 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
288 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
289 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
290 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
291 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
292 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
293 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
294 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
295 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
296 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
297 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
298 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
299 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
300 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
301 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
302 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
303 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
304 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
305 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
306 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
307 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
308 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
309 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
310 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
311 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
312 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
313 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
314 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.18
Metatranscriptomes 0.28
Isolates 1.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.84
Nodule 0
Rhizoplane 4.06
Rhizosphere 93.56
Stem 0
Stem Tuber 0
Unclassified 1.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10011117 3300005289 Bacteria 2915
2 Ga0065712_10006770 3300005290 Bacteria 4410
3 Ga0065712_10068711 3300005290 Bacteria 9257
4 Ga0065712_10068753 3300005290 Bacteria 9147
5 Ga0065715_10013849 3300005293 Bacteria 3551
6 Ga0065715_10116775 3300005293 Bacteria 2365
7 Ga0065707_10102087 3300005295 Bacteria 2824
8 Ga0070658_10000010 3300005327 Bacteria 297212
9 Ga0070658_10001372 3300005327 Bacteria 20819
10 Ga0070658_10027582 3300005327 Bacteria 4555
11 Ga0070658_10043442 3300005327 Bacteria 3630
12 Ga0070683_100003814 3300005329 Bacteria 12319
13 Ga0070683_100004771 3300005329 Bacteria 11224
14 Ga0070683_100005644 3300005329 Bacteria 10456
15 Ga0070683_100125910 3300005329 Bacteria 2422
16 Ga0070690_100011506 3300005330 Bacteria 5176
17 Ga0070690_100035999 3300005330 Bacteria 3109
18 Ga0070670_100010077 3300005331 Bacteria 8065
19 Ga0068869_100012085 3300005334 Bacteria 5692
20 Ga0070666_10006111 3300005335 Bacteria 7400
21 Ga0070680_100026993 3300005336 Bacteria 4597
22 Ga0070680_100056287 3300005336 Bacteria 3214
23 Ga0070680_100057450 3300005336 Bacteria 3181
24 Ga0070680_100071646 3300005336 Bacteria 2848
25 Ga0070680_100116134 3300005336 Bacteria 2230
26 Ga0070682_100026421 3300005337 Bacteria 3474
27 Ga0070682_100086289 3300005337 Bacteria 2044
28 Ga0068868_100001688 3300005338 Bacteria 15102
29 Ga0070660_100000773 3300005339 Bacteria 21239
30 Ga0070660_100005907 3300005339 Bacteria 8468
31 Ga0070660_100007349 3300005339 Bacteria 7674
32 Ga0070660_100015514 3300005339 Bacteria 5504
33 Ga0070660_100020550 3300005339 Bacteria 4854
34 Ga0070660_100036539 3300005339 Bacteria 3721
35 Ga0070691_10056091 3300005341 Bacteria 1888
36 Ga0070661_100002233 3300005344 Bacteria 13282
37 Ga0070661_100003160 3300005344 Bacteria 11338
38 Ga0070661_100007607 3300005344 Bacteria 7474
39 Ga0070661_100012735 3300005344 Bacteria 5887
40 Ga0070661_100034547 3300005344 Bacteria 3667
41 Ga0070661_100037933 3300005344 Bacteria 3507
42 Ga0070669_100011901 3300005353 Bacteria 6174
43 Ga0070675_100068417 3300005354 Bacteria 2940
44 Ga0070675_100082354 3300005354 Bacteria 2685
45 Ga0070671_100009092 3300005355 Bacteria 7974
46 Ga0070671_100030645 3300005355 Bacteria 4439
47 Ga0070671_100049345 3300005355 Bacteria 3502
48 Ga0070671_100051197 3300005355 Bacteria 3434
49 Ga0070671_100056861 3300005355 Bacteria 3255
50 Ga0070673_100001367 3300005364 Bacteria 14268
51 Ga0070673_100051111 3300005364 Bacteria 3235
52 Ga0070673_100073115 3300005364 Bacteria 2759
53 Ga0070673_100129845 3300005364 Bacteria 2113
54 Ga0070659_100001713 3300005366 Bacteria 15774
55 Ga0070659_100024406 3300005366 Bacteria 4635
56 Ga0070703_10006223 3300005406 Bacteria 3341
57 Ga0070709_10023151 3300005434 Bacteria 3644
58 Ga0070709_10050905 3300005434 Bacteria 2597
59 Ga0070714_100009936 3300005435 Bacteria 7505
60 Ga0070714_100012212 3300005435 Bacteria 6849
61 Ga0070714_100015355 3300005435 Bacteria 6162
62 Ga0070714_100082797 3300005435 Bacteria 2796
63 Ga0070714_100117168 3300005435 Bacteria 2365
64 Ga0070713_100000907 3300005436 Bacteria 18932
65 Ga0070713_100004207 3300005436 Bacteria 9609
66 Ga0070713_100010519 3300005436 Bacteria 6686
67 Ga0070710_10009681 3300005437 Bacteria 4721
68 Ga0070711_100003054 3300005439 Bacteria 9671
69 Ga0070711_100004233 3300005439 Bacteria 8435
70 Ga0070711_100014844 3300005439 Bacteria 4919
71 Ga0070694_100002730 3300005444 Bacteria 10471
72 Ga0070708_100011685 3300005445 Bacteria 7146
73 Ga0070708_100088845 3300005445 Bacteria 2811
74 Ga0070678_100019606 3300005456 Bacteria 4416
75 Ga0070662_100011219 3300005457 Bacteria 5905
76 Ga0070662_100012468 3300005457 Bacteria 5638
77 Ga0070662_100063297 3300005457 Bacteria 2705
78 Ga0070681_10000247 3300005458 Bacteria 42975
79 Ga0070681_10000261 3300005458 Bacteria 42065
80 Ga0070681_10001144 3300005458 Bacteria 22852
81 Ga0070681_10002214 3300005458 Bacteria 17729
82 Ga0070681_10003473 3300005458 Bacteria 14764
83 Ga0070681_10010707 3300005458 Bacteria 9062
84 Ga0070681_10013899 3300005458 Bacteria 8011
85 Ga0070681_10074665 3300005458 Bacteria 3351
86 Ga0070681_10079886 3300005458 Bacteria 3227
87 Ga0068867_100003528 3300005459 Bacteria 11000
88 Ga0070706_100038332 3300005467 Bacteria 4423
89 Ga0070706_100110895 3300005467 Bacteria 2553
90 Ga0070698_100000236 3300005471 Bacteria 54837
91 Ga0070698_100142906 3300005471 Bacteria 2344
92 Ga0070699_100029983 3300005518 Bacteria 4693
93 Ga0070699_100069043 3300005518 Bacteria 3070
94 Ga0070679_100000327 3300005530 Bacteria 40290
95 Ga0070679_100003583 3300005530 Bacteria 14209
96 Ga0070679_100008438 3300005530 Bacteria 9699
97 Ga0070679_100010134 3300005530 Bacteria 8936
98 Ga0070679_100013022 3300005530 Bacteria 7964
99 Ga0070679_100034853 3300005530 Bacteria 4991
100 Ga0070679_100040488 3300005530 Bacteria 4635
101 Ga0070679_100052872 3300005530 Bacteria 4044
102 Ga0070679_100069664 3300005530 Bacteria 3508
103 Ga0070679_100081316 3300005530 Bacteria 3229
104 Ga0070684_100015869 3300005535 Bacteria 6147
105 Ga0070684_100016031 3300005535 Bacteria 6120
106 Ga0070684_100036790 3300005535 Unclassified 4195
107 Ga0070684_100043366 3300005535 Bacteria 3884
108 Ga0070684_100117771 3300005535 Bacteria 2387
109 Ga0070697_100001253 3300005536 Bacteria 19201
110 Ga0070697_100033366 3300005536 Bacteria 4146
111 Ga0070697_100036116 3300005536 Bacteria 3991
112 Ga0070697_100103873 3300005536 Bacteria 2362
113 Ga0068853_100022380 3300005539 Bacteria 5278
114 Ga0068853_100027796 3300005539 Unclassified 4755
115 Ga0070672_100019537 3300005543 Bacteria 4919
116 Ga0070672_100150838 3300005543 Bacteria 1923
117 Ga0070686_100002740 3300005544 Bacteria 9697
118 Ga0070695_100001059 3300005545 Bacteria 15017
119 Ga0070695_100011378 3300005545 Bacteria 5323
120 Ga0070695_100034537 3300005545 Bacteria 3171
121 Ga0070696_100013455 3300005546 Bacteria 5490
122 Ga0070696_100054662 3300005546 Bacteria 2783
123 Ga0070693_100000102 3300005547 Bacteria 37722
124 Ga0070693_100027720 3300005547 Bacteria 3073
125 Ga0070665_100001198 3300005548 Bacteria 31613
126 Ga0070665_100002180 3300005548 Bacteria 21833
127 Ga0070704_100001455 3300005549 Bacteria 12695
128 Ga0070704_100036561 3300005549 Bacteria 3348
129 Ga0068855_100000561 3300005563 Bacteria 45527
130 Ga0068855_100002571 3300005563 Bacteria 22364
131 Ga0068855_100012592 3300005563 Bacteria 10207
132 Ga0068855_100032252 3300005563 Bacteria 6255
133 Ga0068855_100035466 3300005563 Bacteria 5941
134 Ga0068855_100035591 3300005563 Bacteria 5930
135 Ga0068855_100039129 3300005563 Bacteria 5629
136 Ga0068855_100065797 3300005563 Bacteria 4226
137 Ga0070664_100000830 3300005564 Bacteria 23813
138 Ga0070664_100003501 3300005564 Bacteria 12681
139 Ga0070664_100003647 3300005564 Bacteria 12398
140 Ga0068857_100000419 3300005577 Bacteria 30014
141 Ga0068857_100005498 3300005577 Bacteria 10804
142 Ga0068857_100008356 3300005577 Bacteria 8942
143 Ga0068857_100032487 3300005577 Bacteria 4615
144 Ga0068857_100040676 3300005577 Bacteria 4123
145 Ga0068857_100048315 3300005577 Bacteria 3778
146 Ga0068854_100038957 3300005578 Bacteria 3345
147 Ga0068856_100000394 3300005614 Bacteria 47803
148 Ga0068856_100001696 3300005614 Bacteria 23049
149 Ga0068856_100002047 3300005614 Bacteria 20923
150 Ga0068856_100002997 3300005614 Bacteria 17285
151 Ga0068856_100005834 3300005614 Bacteria 12137
152 Ga0068856_100009823 3300005614 Bacteria 9293
153 Ga0068856_100023859 3300005614 Bacteria 5950
154 Ga0068852_100004628 3300005616 Bacteria 9751
155 Ga0068852_100004778 3300005616 Bacteria 9623
156 Ga0068852_100004781 3300005616 Bacteria 9620
157 Ga0068852_100006343 3300005616 Bacteria 8535
158 Ga0068859_100000290 3300005617 Bacteria 49956
159 Ga0068859_100171430 3300005617 Bacteria 2251
160 Ga0068864_100001429 3300005618 Bacteria 19704
161 Ga0068866_10001078 3300005718 Bacteria 12038
162 Ga0068851_10004716 3300005834 Bacteria 6169
163 Ga0068863_100007676 3300005841 Bacteria 10552
164 Ga0068858_100002722 3300005842 Bacteria 17810
165 Ga0068858_100042641 3300005842 Unclassified 4207
166 Ga0068858_100068455 3300005842 Bacteria 3290
167 Ga0068860_100003559 3300005843 Bacteria 16019
168 Ga0068860_100045562 3300005843 Bacteria 4183
169 Ga0081455_10000777 3300005937 Bacteria 41065
170 Ga0081455_10013832 3300005937 Bacteria 7940
171 Ga0081538_10003485 3300005981 Bacteria 14849
172 Ga0081538_10014573 3300005981 Bacteria 6147
173 Ga0070717_10051695 3300006028 Bacteria 3383
174 Ga0070717_10141495 3300006028 Bacteria 2075
175 Ga0075432_10005885 3300006058 Bacteria 4172
176 Ga0070716_100000297 3300006173 Bacteria 20076
177 Ga0070716_100005379 3300006173 Bacteria 6196
178 Ga0070716_100057929 3300006173 Bacteria 2228
179 Ga0070712_100016363 3300006175 Bacteria 4789
180 Ga0070712_100036163 3300006175 Bacteria 3358
181 Ga0075367_10008309 3300006178 Bacteria 5376
182 Ga0097621_100001063 3300006237 Bacteria 19228
183 Ga0097621_100004160 3300006237 Bacteria 10035
184 Ga0068871_100001936 3300006358 Bacteria 14019
185 Ga0068871_100023496 3300006358 Bacteria 4771
186 Ga0068871_100029931 3300006358 Bacteria 4282
187 Ga0075428_100004241 3300006844 Bacteria 15786
188 Ga0075428_100028228 3300006844 Bacteria 6206
189 Ga0075428_100045517 3300006844 Bacteria 4821
190 Ga0075430_100003080 3300006846 Bacteria 13926
191 Ga0075430_100029707 3300006846 Bacteria 4639
192 Ga0075430_100035481 3300006846 Bacteria 4231
193 Ga0075430_100038743 3300006846 Bacteria 4036
194 Ga0075431_100023037 3300006847 Bacteria 6366
195 Ga0075431_100029475 3300006847 Bacteria 5650
196 Ga0075431_100070167 3300006847 Bacteria 3615
197 Ga0075431_100091553 3300006847 Bacteria 3139
198 Ga0075431_100148741 3300006847 Bacteria 2412
199 Ga0075433_10003978 3300006852 Bacteria 11436
200 Ga0075433_10004780 3300006852 Bacteria 10569
201 Ga0075433_10072540 3300006852 Bacteria 3027
202 Ga0075433_10082392 3300006852 Bacteria 2837
203 Ga0075434_100001703 3300006871 Bacteria 18823
204 Ga0075434_100007024 3300006871 Bacteria 10385
205 Ga0075434_100007292 3300006871 Bacteria 10231
206 Ga0075429_100031657 3300006880 Bacteria 4597
207 Ga0075429_100052768 3300006880 Bacteria 3538
208 Ga0068865_100082825 3300006881 Bacteria 2307
209 Ga0075436_100036828 3300006914 Bacteria 3378
210 Ga0097620_100000290 3300006931 Bacteria 49956
211 Ga0097620_100171420 3300006931 Bacteria 2251
212 Ga0075435_100002073 3300007076 Bacteria 13146
213 Ga0075435_100037178 3300007076 Bacteria 3875
214 Ga0075435_100097171 3300007076 Bacteria 2437
215 Ga0099794_10011502 3300007265 Bacteria 3790
216 Ga0099794_10013424 3300007265 Bacteria 3565
217 Ga0099794_10028772 3300007265 Bacteria 2586
218 Ga0105240_10002877 3300009093 Bacteria 27222
219 Ga0105240_10018106 3300009093 Bacteria 9472
220 Ga0105240_10024508 3300009093 Bacteria 7950
221 Ga0105240_10033595 3300009093 Bacteria 6623
222 Ga0105240_10051192 3300009093 Bacteria 5199
223 Ga0105240_10133163 3300009093 Bacteria 2979
224 Ga0105240_10205380 3300009093 Bacteria 2306
225 Ga0105240_10209187 3300009093 Bacteria 2281
226 Ga0111539_10020976 3300009094 Bacteria 8045
227 Ga0111539_10031183 3300009094 Bacteria 6479
228 Ga0111539_10032522 3300009094 Bacteria 6333
229 Ga0111539_10289772 3300009094 Bacteria 1905
230 Ga0105245_10100566 3300009098 Bacteria 2674
231 Ga0105245_10147040 3300009098 Bacteria 2224
232 Ga0105247_10044304 3300009101 Bacteria 2728
233 Ga0114129_10007873 3300009147 Bacteria 15162
234 Ga0114129_10009458 3300009147 Bacteria 13893
235 Ga0114129_10012984 3300009147 Bacteria 11859
236 Ga0114129_10023521 3300009147 Bacteria 8733
237 Ga0114129_10234347 3300009147 Bacteria 2471
238 Ga0105237_10007734 3300009545 Bacteria 11736
239 Ga0105237_10026300 3300009545 Bacteria 5947
240 Ga0105237_10037757 3300009545 Bacteria 4881
241 Ga0105237_10078138 3300009545 Unclassified 3299
242 Ga0105237_10160182 3300009545 Bacteria 2249
243 Ga0105238_10001041 3300009551 Bacteria 28144
244 Ga0105238_10001061 3300009551 Bacteria 27757
245 Ga0105238_10005774 3300009551 Bacteria 12248
246 Ga0105238_10007685 3300009551 Bacteria 10779
247 Ga0105238_10014246 3300009551 Bacteria 8040
248 Ga0105249_10039605 3300009553 Bacteria 4279
249 Ga0105239_10072758 3300010375 Bacteria 3779
250 Ga0157373_10024462 3300013100 Bacteria 4373
251 Ga0157373_10092562 3300013100 Bacteria 2129
252 Ga0157371_10000892 3300013102 Bacteria 33627
253 Ga0157371_10020196 3300013102 Bacteria 4902
254 Ga0157371_10036902 3300013102 Unclassified 3500
255 Ga0157371_10054559 3300013102 Bacteria 2838
256 Ga0157371_10126702 3300013102 Bacteria 1816
257 Ga0157370_10002254 3300013104 Bacteria 23424
258 Ga0157370_10002480 3300013104 Bacteria 22253
259 Ga0157370_10029113 3300013104 Bacteria 5426
260 Ga0157369_10000134 3300013105 Bacteria 105562
261 Ga0157369_10000258 3300013105 Bacteria 72711
262 Ga0157369_10011416 3300013105 Bacteria 10088
263 Ga0157369_10118493 3300013105 Bacteria 2810
264 Ga0157374_10000517 3300013296 Bacteria 34675
265 Ga0157374_10000661 3300013296 Bacteria 30295
266 Ga0157374_10006871 3300013296 Bacteria 9681
267 Ga0157374_10022386 3300013296 Bacteria 5638
268 Ga0157374_10101183 3300013296 Bacteria 2763
269 Ga0157374_10120964 3300013296 Bacteria 2527
270 Ga0157378_10000517 3300013297 Bacteria 36671
271 Ga0157378_10000915 3300013297 Bacteria 27185
272 Ga0157378_10001601 3300013297 Bacteria 20469
273 Ga0157378_10007804 3300013297 Bacteria 9340
274 Ga0157378_10059811 3300013297 Bacteria 3400
275 Ga0163162_10067996 3300013306 Bacteria 3613
276 Ga0163162_10149096 3300013306 Bacteria 2456
277 Ga0157372_10000125 3300013307 Bacteria 82978
278 Ga0157372_10000335 3300013307 Bacteria 51775
279 Ga0157372_10000629 3300013307 Bacteria 38566
280 Ga0157372_10010222 3300013307 Bacteria 9963
281 Ga0157372_10010413 3300013307 Bacteria 9886
282 Ga0157372_10011442 3300013307 Bacteria 9435
283 Ga0157372_10028289 3300013307 Bacteria 6118
284 Ga0157372_10029357 3300013307 Bacteria 6004
285 Ga0157372_10076839 3300013307 Bacteria 3771
286 Ga0157375_10151509 3300013308 Bacteria 2455
287 Ga0157375_10180531 3300013308 Bacteria 2262
288 Ga0163163_10159075 3300014325 Bacteria 2304
289 Ga0182008_10000712 3300014497 Bacteria 23839
290 Ga0182008_10002552 3300014497 Bacteria 11339
291 Ga0157379_10000346 3300014968 Bacteria 37348
292 Ga0157376_10000005 3300014969 Bacteria 443695
293 Ga0157376_10002022 3300014969 Bacteria 13602
294 Ga0157376_10034568 3300014969 Unclassified 4082
295 Ga0157376_10040249 3300014969 Bacteria 3819
296 Ga0182007_10003649 3300015262 Bacteria 7214
297 Ga0228598_1000409 3300024227 Bacteria 8673
298 Ga0207697_10023558 3300025315 Bacteria 2521
299 Ga0207653_10007131 3300025885 Bacteria 3491
300 Ga0207682_10024110 3300025893 Bacteria 2407
301 Ga0207692_10005300 3300025898 Bacteria 5156
302 Ga0207642_10000509 3300025899 Bacteria 11899
303 Ga0207688_10010552 3300025901 Bacteria 5025
304 Ga0207647_10004022 3300025904 Bacteria 10970
305 Ga0207647_10007033 3300025904 Bacteria 8160
306 Ga0207647_10011034 3300025904 Bacteria 6354
307 Ga0207699_10022367 3300025906 Bacteria 3424
308 Ga0207699_10023187 3300025906 Bacteria 3375
309 Ga0207699_10025017 3300025906 Bacteria 3273
310 Ga0207645_10001511 3300025907 Bacteria 19014
311 Ga0207705_10000016 3300025909 Bacteria 377359
312 Ga0207705_10000419 3300025909 Bacteria 37164
313 Ga0207705_10002757 3300025909 Bacteria 13460
314 Ga0207705_10007786 3300025909 Bacteria 7868
315 Ga0207705_10027889 3300025909 Bacteria 4026
316 Ga0207705_10065583 3300025909 Bacteria 2625
317 Ga0207705_10094081 3300025909 Bacteria 2197
318 Ga0207684_10010867 3300025910 Bacteria 7988
319 Ga0207684_10037810 3300025910 Bacteria 4095
320 Ga0207707_10000003 3300025912 Bacteria 642592
321 Ga0207707_10001477 3300025912 Bacteria 21753
322 Ga0207707_10008348 3300025912 Bacteria 8985
323 Ga0207707_10024604 3300025912 Bacteria 5270
324 Ga0207707_10031062 3300025912 Bacteria 4673
325 Ga0207707_10043614 3300025912 Bacteria 3911
326 Ga0207707_10091905 3300025912 Bacteria 2652
327 Ga0207707_10096586 3300025912 Bacteria 2582
328 Ga0207707_10100155 3300025912 Bacteria 2532
329 Ga0207707_10149435 3300025912 Bacteria 2043
330 Ga0207707_10160146 3300025912 Bacteria 1968
331 Ga0207707_10175375 3300025912 Bacteria 1873
332 Ga0207695_10001093 3300025913 Bacteria 47293
333 Ga0207695_10012444 3300025913 Bacteria 10216
334 Ga0207695_10044125 3300025913 Bacteria 4745
335 Ga0207695_10087992 3300025913 Bacteria 3128
336 Ga0207671_10038188 3300025914 Bacteria 3559
337 Ga0207671_10074747 3300025914 Bacteria 2533
338 Ga0207693_10005882 3300025915 Bacteria 10178
339 Ga0207693_10026475 3300025915 Bacteria 4590
340 Ga0207663_10035866 3300025916 Bacteria 2979
341 Ga0207663_10058173 3300025916 Bacteria 2438
342 Ga0207660_10001220 3300025917 Bacteria 17201
343 Ga0207660_10001524 3300025917 Bacteria 15540
344 Ga0207660_10014935 3300025917 Bacteria 5119
345 Ga0207660_10041799 3300025917 Bacteria 3214
346 Ga0207660_10048028 3300025917 Bacteria 3020
347 Ga0207660_10054259 3300025917 Bacteria 2860
348 Ga0207657_10000159 3300025919 Bacteria 69260
349 Ga0207657_10001503 3300025919 Bacteria 24928
350 Ga0207657_10002194 3300025919 Bacteria 21168
351 Ga0207657_10003049 3300025919 Bacteria 17918
352 Ga0207657_10007180 3300025919 Bacteria 11435
353 Ga0207657_10008065 3300025919 Bacteria 10739
354 Ga0207649_10009058 3300025920 Bacteria 5439
355 Ga0207649_10080913 3300025920 Bacteria 2102
356 Ga0207652_10000024 3300025921 Bacteria 157748
357 Ga0207652_10001698 3300025921 Bacteria 19278
358 Ga0207652_10003474 3300025921 Bacteria 12992
359 Ga0207652_10006183 3300025921 Bacteria 9677
360 Ga0207652_10026753 3300025921 Bacteria 4807
361 Ga0207652_10052778 3300025921 Bacteria 3491
362 Ga0207652_10058987 3300025921 Bacteria 3307
363 Ga0207652_10089999 3300025921 Bacteria 2696
364 Ga0207652_10151853 3300025921 Bacteria 2074
365 Ga0207646_10011190 3300025922 Bacteria 8712
366 Ga0207681_10000044 3300025923 Bacteria 128566
367 Ga0207681_10014504 3300025923 Bacteria 4899
368 Ga0207694_10000284 3300025924 Bacteria 47825
369 Ga0207694_10001081 3300025924 Bacteria 23667
370 Ga0207694_10001478 3300025924 Bacteria 20095
371 Ga0207694_10019640 3300025924 Bacteria 5111
372 Ga0207694_10071576 3300025924 Bacteria 2710
373 Ga0207650_10001148 3300025925 Bacteria 19458
374 Ga0207650_10007616 3300025925 Bacteria 7378
375 Ga0207659_10007100 3300025926 Bacteria 6877
376 Ga0207700_10003312 3300025928 Bacteria 9339
377 Ga0207700_10015608 3300025928 Bacteria 5017
378 Ga0207664_10006945 3300025929 Bacteria 7831
379 Ga0207664_10035053 3300025929 Bacteria 3870
380 Ga0207644_10008669 3300025931 Bacteria 6652
381 Ga0207644_10023383 3300025931 Bacteria 4233
382 Ga0207644_10025878 3300025931 Bacteria 4038
383 Ga0207690_10006311 3300025932 Bacteria 7024
384 Ga0207690_10009340 3300025932 Bacteria 5826
385 Ga0207690_10016806 3300025932 Bacteria 4458
386 Ga0207706_10002112 3300025933 Bacteria 19449
387 Ga0207706_10006139 3300025933 Bacteria 11156
388 Ga0207706_10024322 3300025933 Bacteria 5430
389 Ga0207706_10078919 3300025933 Bacteria 2895
390 Ga0207704_10004923 3300025938 Bacteria 6137
391 Ga0207665_10000020 3300025939 Bacteria 117316
392 Ga0207665_10004248 3300025939 Bacteria 9526
393 Ga0207665_10020602 3300025939 Bacteria 4333
394 Ga0207665_10024622 3300025939 Bacteria 3970
395 Ga0207665_10030902 3300025939 Bacteria 3541
396 Ga0207691_10001855 3300025940 Bacteria 20651
397 Ga0207691_10022008 3300025940 Bacteria 6016
398 Ga0207711_10020787 3300025941 Bacteria 5477
399 Ga0207711_10083347 3300025941 Bacteria 2796
400 Ga0207689_10016908 3300025942 Bacteria 6172
401 Ga0207661_10001184 3300025944 Bacteria 17452
402 Ga0207661_10002226 3300025944 Bacteria 13382
403 Ga0207661_10004525 3300025944 Bacteria 9746
404 Ga0207661_10028936 3300025944 Bacteria 4249
405 Ga0207661_10045545 3300025944 Bacteria 3473
406 Ga0207661_10048712 3300025944 Bacteria 3369
407 Ga0207661_10077319 3300025944 Bacteria 2737
408 Ga0207679_10000457 3300025945 Bacteria 28830
409 Ga0207679_10006991 3300025945 Bacteria 7153
410 Ga0207679_10009363 3300025945 Bacteria 6273
411 Ga0207679_10106471 3300025945 Bacteria 2204
412 Ga0207667_10000123 3300025949 Bacteria 120422
413 Ga0207667_10000245 3300025949 Bacteria 76423
414 Ga0207667_10000314 3300025949 Bacteria 67212
415 Ga0207667_10000487 3300025949 Bacteria 52501
416 Ga0207667_10002750 3300025949 Bacteria 21739
417 Ga0207667_10006431 3300025949 Bacteria 14231
418 Ga0207667_10008821 3300025949 Bacteria 11939
419 Ga0207667_10011306 3300025949 Bacteria 10379
420 Ga0207667_10028027 3300025949 Bacteria 6121
421 Ga0207667_10028616 3300025949 Bacteria 6050
422 Ga0207667_10087272 3300025949 Bacteria 3228
423 Ga0207667_10092112 3300025949 Bacteria 3131
424 Ga0207651_10001825 3300025960 Bacteria 9920
425 Ga0207640_10012164 3300025981 Bacteria 4894
426 Ga0207677_10002130 3300026023 Bacteria 10395
427 Ga0207703_10000881 3300026035 Bacteria 29513
428 Ga0207703_10008498 3300026035 Bacteria 8112
429 Ga0207703_10013106 3300026035 Bacteria 6462
430 Ga0207639_10006611 3300026041 Bacteria 7885
431 Ga0207639_10014149 3300026041 Bacteria 5603
432 Ga0207639_10017610 3300026041 Bacteria 5067
433 Ga0207678_10000102 3300026067 Bacteria 69930
434 Ga0207678_10006379 3300026067 Bacteria 10471
435 Ga0207678_10031852 3300026067 Bacteria 4597
436 Ga0207702_10000091 3300026078 Bacteria 104021
437 Ga0207702_10000454 3300026078 Bacteria 46222
438 Ga0207702_10000482 3300026078 Bacteria 44849
439 Ga0207702_10001896 3300026078 Bacteria 20434
440 Ga0207702_10009071 3300026078 Bacteria 8372
441 Ga0207641_10008320 3300026088 Bacteria 8573
442 Ga0207641_10033229 3300026088 Bacteria 4286
443 Ga0207648_10015008 3300026089 Bacteria 7135
444 Ga0207676_10001522 3300026095 Bacteria 17124
445 Ga0207674_10000229 3300026116 Bacteria 69982
446 Ga0207674_10001151 3300026116 Bacteria 34261
447 Ga0207674_10006007 3300026116 Bacteria 14362
448 Ga0207674_10010596 3300026116 Bacteria 10430
449 Ga0207674_10020001 3300026116 Bacteria 7244
450 Ga0207674_10021224 3300026116 Bacteria 7000
451 Ga0207674_10029219 3300026116 Bacteria 5806
452 Ga0207674_10035662 3300026116 Bacteria 5191
453 Ga0207683_10004353 3300026121 Bacteria 12232
454 Ga0207698_10000912 3300026142 Bacteria 17183
455 Ga0207698_10004145 3300026142 Bacteria 8805
456 Ga0207698_10012327 3300026142 Bacteria 5591
457 Ga0207698_10014443 3300026142 Bacteria 5250
458 Ga0207698_10017821 3300026142 Bacteria 4827
459 Ga0207698_10138172 3300026142 Bacteria 2094
460 Ga0209588_1002342 3300027671 Bacteria 5134
461 Ga0209588_1002355 3300027671 Bacteria 5123
462 Ga0209588_1013405 3300027671 Bacteria 2499
463 Ga0209588_1015655 3300027671 Bacteria 2333
464 Ga0209971_1009224 3300027682 Bacteria 2338
465 Ga0209974_10001602 3300027876 Bacteria 8191
466 Ga0209974_10002919 3300027876 Bacteria 6201
467 Ga0265354_1000380 3300028016 Bacteria 7778
468 Ga0268266_10000661 3300028379 Bacteria 46641
469 Ga0268266_10032306 3300028379 Bacteria 4447
470 Ga0268266_10033892 3300028379 Bacteria 4340
471 Ga0268264_10035546 3300028381 Bacteria 4103
472 Ga0268264_10112011 3300028381 Bacteria 2392
473 Ga0265338_10034265 3300028800 Bacteria 4911
474 Ga0265338_10114654 3300028800 Bacteria 2162
475 Ga0265765_1000017 3300030879 Bacteria 7740
476 Ga0265760_10000038 3300031090 Bacteria 42230
477 Ga0265325_10003991 3300031241 Bacteria 9442
478 Ga0265339_10031676 3300031249 Bacteria 2986
479 Ga0265316_10027712 3300031344 Bacteria 4684
480 Ga0307508_10014924 3300031616 Bacteria 7084
481 Ga0265314_10001027 3300031711 Bacteria 32557
482 Ga0373954_0001152 3300035118 Bacteria 10627
483 Ga0373956_0003549 3300035119 Bacteria 6282
484 Ga0373957_0002185 3300035120 Bacteria 5528
485 Ga0373946_0004832 3300035171 Bacteria 4848
486 Ga0373961_0000297 3300035241 Bacteria 22207
487 Ga0373931_0029980 3300035691 Bacteria 2798
488 Ga0373935_0000591 3300035692 Bacteria 18897
489 Ga0373927_0001772 3300035695 Bacteria 16103
490 Ga0373947_0004469 3300035725 Bacteria 8209
491 Ga0373947_0006738 3300035725 Bacteria 6664
492 Ga0373937_0000340 3300036401 Bacteria 44240
493 Ga0373937_0004081 3300036401 Bacteria 12382
494 Ga0373937_0005073 3300036401 Bacteria 11210
495 Ga0373937_0013628 3300036401 Bacteria 7163
496 Ga0373925_0000615 3300037068 Bacteria 33997
497 Ga0373925_0006140 3300037068 Bacteria 8873
498 Ga0373925_0010712 3300037068 Bacteria 6650
499 Ga0373925_0024619 3300037068 Bacteria 4396
500 Ga0373925_0080403 3300037068 Bacteria 2477
501 Ga0395900_0003060 3300037418 Bacteria 18209
502 Ga0395900_0029601 3300037418 Bacteria 5618
503 Ga0395900_0058197 3300037418 Bacteria 3978
504 Ga0395900_0084380 3300037418 Bacteria 3264
505 Ga0395900_0089468 3300037418 Bacteria 3164
506 Ga0395898_0027612 3300037466 Bacteria 5693
507 Ga0395898_0033031 3300037466 Bacteria 5165
508 Ga0395905_0035459 3300037471 Bacteria 4684
509 Ga0436364_0488840 3300037853 Bacteria 8505
510 Ga0395901_0005170 3300038443 Bacteria 13166
511 Ga0395901_0008749 3300038443 Bacteria 10238
512 Ga0395901_0104883 3300038443 Bacteria 2967
513 Ga0395901_0252214 3300038443 Bacteria 1838
514 Ga0436363_0796445 3300039450 Bacteria 4257
515 Ga0436363_1131501 3300039450 Bacteria 2782
516 Ga0439466_0001002 3300041411 Bacteria 10876
517 Ga0439451_000063 3300042009 Bacteria 19874
518 Ga0439452_007992 3300042010 Bacteria 3203
519 Ga0451577_0006065 3300042876 Bacteria 12155
520 Ga0451577_0118145 3300042876 Bacteria 2375
521 Ga0466969_0005643 3300044656 Bacteria 6656
522 Ga0466969_0036131 3300044656 Bacteria 2497
523 Ga0453683_0003521 3300044673 Bacteria 11508
524 Ga0466966_0009419 3300044684 Bacteria 6468
525 Ga0466966_0017112 3300044684 Bacteria 4796
526 Ga0466961_0066625 3300044693 Bacteria 2287
527 Ga0466963_0000208 3300044694 Bacteria 24989
528 Ga0466963_0036753 3300044694 Bacteria 3194
529 Ga0466957_0001777 3300044842 Bacteria 11344
530 Ga0466957_0008613 3300044842 Bacteria 5804
531 Ga0466959_0053660 3300045049 Bacteria 2946
532 Ga0466958_0000543 3300045836 Bacteria 16041
533 Ga0466967_0000567 3300045976 Bacteria 18158
534 Ga0466967_0005247 3300045976 Bacteria 8932
535 Ga0466967_0007210 3300045976 Bacteria 7989
536 Ga0466967_0008683 3300045976 Bacteria 7476
537 Ga0466967_0028238 3300045976 Bacteria 4681
538 Ga0466967_0102638 3300045976 Bacteria 2616
539 Ga0495617_002468 3300046452 Bacteria 7345
540 Ga0495617_002920 3300046452 Bacteria 6562
541 Ga0495592_0057211 3300046454 Bacteria 2879
542 Ga0495591_000005 3300046458 Bacteria 394092
543 Ga0495638_0009240 3300046460 Bacteria 6930
544 Ga0495638_0097773 3300046460 Bacteria 1760
545 Ga0495651_0084876 3300046462 Bacteria 2385
546 Ga0495650_0000775 3300046471 Bacteria 39396
547 Ga0495650_0015684 3300046471 Bacteria 3875
548 Ga0495580_0001149 3300046472 Bacteria 23327
549 Ga0495580_0003222 3300046472 Bacteria 13965
550 Ga0495580_0003395 3300046472 Bacteria 13601
551 Ga0495580_0007152 3300046472 Bacteria 8988
552 Ga0495580_0021725 3300046472 Bacteria 4733
553 Ga0495580_0075523 3300046472 Bacteria 2351
554 Ga0495582_0009311 3300046473 Bacteria 5416
555 Ga0495594_0007810 3300046499 Bacteria 5501
556 Ga0495607_0040736 3300046501 Bacteria 2763
557 Ga0495583_0000167 3300046506 Bacteria 111792
558 Ga0495583_0002626 3300046506 Bacteria 15020
559 Ga0495606_0001672 3300046507 Bacteria 28707
560 Ga0495606_0001998 3300046507 Bacteria 25132
561 Ga0495606_0021698 3300046507 Bacteria 4698
562 Ga0495608_0012838 3300046511 Bacteria 5813
563 Ga0495610_0000174 3300046512 Bacteria 72225
564 Ga0495620_0002598 3300046515 Bacteria 10441
565 Ga0495630_0069437 3300046517 Bacteria 2650
566 Ga0495631_0006358 3300046518 Bacteria 6110
567 Ga0495632_0013955 3300046519 Bacteria 4562
568 Ga0495632_0042616 3300046519 Bacteria 2273
569 Ga0495643_0010066 3300046522 Bacteria 5831
570 Ga0495644_0001132 3300046523 Bacteria 10933
571 Ga0495648_0000487 3300046524 Bacteria 42675
572 Ga0495648_0001882 3300046524 Bacteria 20063
573 Ga0495648_0014622 3300046524 Bacteria 5735
574 Ga0495648_0015301 3300046524 Bacteria 5577
575 Ga0495642_0000004 3300046528 Bacteria 182675
576 Ga0495654_0000463 3300046530 Bacteria 33919
577 Ga0495654_0015457 3300046530 Bacteria 4051
578 Ga0495665_0014551 3300046531 Bacteria 4243
579 Ga0495586_0017915 3300046535 Bacteria 3767
580 Ga0495587_0006021 3300046536 Bacteria 7906
581 Ga0495597_0009786 3300046542 Bacteria 4718
582 Ga0495645_0001271 3300046543 Bacteria 17186
583 Ga0495633_0014064 3300046558 Bacteria 4196
584 Ga0495634_0014457 3300046642 Bacteria 5690
585 Ga0495611_0011105 3300046648 Bacteria 3815
586 Ga0495661_0000354 3300046665 Bacteria 50084
587 Ga0495623_0016226 3300046679 Bacteria 4810
588 Ga0495658_0032729 3300046683 Bacteria 2841
589 Ga0495669_0021164 3300046684 Bacteria 2820
590 Ga0495669_0028301 3300046684 Bacteria 2454
591 Ga0495613_0007406 3300046689 Bacteria 8180
592 Ga0495613_0074590 3300046689 Bacteria 2470
593 Ga0495670_0000057 3300046691 Bacteria 54709
594 Ga0495670_0033432 3300046691 Bacteria 2559
595 Ga0495671_0000241 3300046692 Bacteria 47262
596 Ga0495671_0011524 3300046692 Bacteria 4858
597 Ga0495589_0000739 3300046794 Bacteria 21063
598 Ga0495660_0000606 3300046810 Bacteria 28260
599 Ga0495604_0007016 3300047317 Bacteria 8930
600 Ga0495674_0036665 3300047319 Bacteria 4412
601 Ga0495672_0003677 3300047320 Bacteria 12958
602 Ga0495683_0000253 3300047323 Bacteria 48373
603 Ga0495679_000143 3300047446 Bacteria 64689
604 Ga0495673_0022500 3300047469 Bacteria 3087
605 Ga0495673_0028289 3300047469 Bacteria 2656
606 Ga0495673_0033279 3300047469 Bacteria 2393
607 Ga0495681_0011543 3300047470 Bacteria 5252
608 Ga0495681_0014237 3300047470 Bacteria 4573
609 Ga0495684_0029266 3300047471 Bacteria 4228
610 Ga0495684_0050536 3300047471 Bacteria 3174
611 Ga0495684_0056252 3300047471 Bacteria 2999
612 Ga0495686_0045680 3300047472 Bacteria 2770
613 Ga0495602_0026633 3300048088 Bacteria 5573
614 Ga0495626_0000265 3300048091 Bacteria 59217
615 Ga0495626_0000854 3300048091 Bacteria 27130
616 Ga0496100_0014784 3300048903 Bacteria 4540
617 Ga0496102_0000997 3300048905 Bacteria 26651
618 Ga0496102_0004200 3300048905 Bacteria 12182
619 Ga0496102_0098945 3300048905 Bacteria 2707
620 Ga0496103_0004156 3300048906 Bacteria 8793
621 Ga0496104_0010723 3300048907 Bacteria 8196
622 Ga0496104_0018597 3300048907 Bacteria 6342
623 Ga0496104_0054077 3300048907 Bacteria 3795
624 Ga0496105_0020243 3300048908 Bacteria 5376
625 Ga0496106_0075846 3300048909 Bacteria 2576
626 Ga0496107_0040411 3300048910 Bacteria 3348
627 Ga0496108_0019119 3300048911 Bacteria 5621
628 Ga0496108_0026300 3300048911 Bacteria 4799
629 Ga0496109_0001663 3300048912 Bacteria 18543
630 Ga0496109_0021099 3300048912 Bacteria 5760
631 Ga0496110_0061495 3300048913 Bacteria 3315
632 Ga0496111_0003397 3300048914 Bacteria 9845
633 Ga0496111_0019769 3300048914 Bacteria 4684
634 Ga0496112_0005913 3300048915 Bacteria 10672
635 Ga0496112_0009917 3300048915 Bacteria 8616
636 Ga0496112_0011999 3300048915 Bacteria 7945
637 Ga0496112_0019541 3300048915 Bacteria 6395
638 Ga0496112_0044931 3300048915 Bacteria 4329
639 Ga0496113_0002253 3300048916 Bacteria 11122
640 Ga0496113_0058427 3300048916 Bacteria 2902
641 Ga0496113_0112508 3300048916 Bacteria 2121
642 Ga0496114_0000031 3300048917 Bacteria 168230
643 Ga0496115_0001061 3300048918 Bacteria 19923
644 Ga0496115_0020994 3300048918 Bacteria 5040
645 Ga0496126_0047040 3300048929 Bacteria 3952
646 Ga0501036_0019842 3300049572 Bacteria 5645
647 Ga0501037_0039371 3300049573 Bacteria 3480
648 Ga0501038_0004670 3300049574 Bacteria 12756
649 Ga0501039_0000444 3300049575 Bacteria 30061
650 Ga0501040_0002905 3300049576 Bacteria 11074
651 Ga0501041_0003652 3300049577 Bacteria 8854
652 Ga0501042_0000113 3300049578 Bacteria 34099
653 Ga0501046_0003595 3300049580 Bacteria 14202
654 Ga0501068_0001152 3300049584 Bacteria 14020
655 Ga0501071_0004316 3300049587 Bacteria 9011
656 Ga0501071_0068660 3300049587 Bacteria 2579
657 Ga0501072_0001120 3300049588 Bacteria 19933
658 Ga0501073_0043084 3300049589 Bacteria 3183
659 Ga0501075_0001035 3300049591 Bacteria 17848
660 Ga0501076_0001002 3300049592 Bacteria 18504
661 Ga0501076_0083010 3300049592 Bacteria 2573
662 Ga0501077_0037475 3300049593 Bacteria 3088
663 Ga0501079_0002646 3300049741 Bacteria 13021
664 Ga0501080_0009479 3300049742 Bacteria 8881
665 Ga0501081_0000575 3300049743 Bacteria 20867
666 Ga0501045_0057341 3300049824 Bacteria 2850
667 nmdc:mga06z11_36796_c1 3300050494 Bacteria 2419
668 nmdc:mga05p37_14776_c1 3300050507 Bacteria 9376
669 nmdc:mga05p37_19988_c1 3300050507 Bacteria 8103
670 nmdc:mga05p37_2525_c1 3300050507 Bacteria 6805
671 nmdc:mga09592_24403_c1 3300050508 Bacteria 5000
672 nmdc:mga09592_48333_c1 3300050508 Bacteria 3586
673 nmdc:mga09592_82961_c1 3300050508 Bacteria 2731
674 nmdc:mga0qj67_19527_c1 3300050509 Bacteria 5178
675 nmdc:mga0qj67_2012_c1 3300050509 Bacteria 14499
676 nmdc:mga06r32_68453_c1 3300050510 Bacteria 3430
677 nmdc:mga06r32_77178_c1 3300050510 Bacteria 3236
678 nmdc:mga06r32_92361_c1 3300050510 Bacteria 2959
679 nmdc:mga06r32_97096_c1 3300050510 Bacteria 2887
680 nmdc:mga08y16_36066_c1 3300050511 Bacteria 5193
681 nmdc:mga0n895_12303_c1 3300050512 Bacteria 7670
682 nmdc:mga0n895_17278_c1 3300050512 Bacteria 6647
683 nmdc:mga0n895_36604_c1 3300050512 Bacteria 4740
684 nmdc:mga0n895_41796_c1 3300050512 Bacteria 4458
685 nmdc:mga0n895_5649_c1 3300050512 Bacteria 10482
686 nmdc:mga0n895_60541_c1 3300050512 Bacteria 3736
687 nmdc:mga0rr50_16574_c1 3300050513 Bacteria 4899
688 nmdc:mga0rr50_45870_c1 3300050513 Bacteria 3215
689 nmdc:mga0rr50_6394_c1 3300050513 Bacteria 7166
690 nmdc:mga08x19_16488_c1 3300050514 Bacteria 4507
691 nmdc:mga0a205_1777_c1 3300050515 Bacteria 18638
692 nmdc:mga0a205_31262_c1 3300050515 Bacteria 5100
693 nmdc:mga0a205_43485_c1 3300050515 Bacteria 4331
694 nmdc:mga0a205_5842_c1 3300050515 Bacteria 11084
695 nmdc:mga0a205_73990_c1 3300050515 Bacteria 3291
696 Ga0495601_0003196 3300053077 Bacteria 9381
697 Ga0500555_001047 3300053103 Bacteria 9328
698 Ga0500595_000039 3300053119 Bacteria 100396
699 Ga0500634_0000037 3300053161 Bacteria 64614
700 Ga0500645_002423 3300053730 Bacteria 8342
701 Ga0501084_0004456 3300054114 Bacteria 11433
702 Ga0501082_0080263 3300060353 Bacteria 2815
703 Ga0530510_0015151 3300061734 Bacteria 5444

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047471 Ga0495684_0056252 Ga0495684_0056252_13_1401 439
2 3300046460 Ga0495638_0097773 Ga0495638_0097773_345_1736 448
3 3300007265 Ga0099794_10028772 Ga0099794_100287723 450
4 3300013297 Ga0157378_10001601 Ga0157378_100016016 452
5 iso_pu_bacteria 3003665799 3003666486 475
6 3300046462 Ga0495651_0084876 Ga0495651_0084876_11_1522 480
7 3300042876 Ga0451577_0006065 Ga0451577_0006065_1239_2873 486
8 3300025926 Ga0207659_10007100 Ga0207659_100071004 494
9 3300046454 Ga0495592_0057211 Ga0495592_0057211_417_2003 495
10 3300025910 Ga0207684_10037810 Ga0207684_100378102 497
11 3300025912 Ga0207707_10160146 Ga0207707_101601462 499
12 3300042010 Ga0439452_007992 Ga0439452_007992_1373_2971 501
13 3300044656 Ga0466969_0005643 Ga0466969_0005643_1173_2855 501
14 3300044684 Ga0466966_0009419 Ga0466966_0009419_4423_6105 501
15 3300037418 Ga0395900_0089468 Ga0395900_0089468_841_2460 502
16 3300037466 Ga0395898_0027612 Ga0395898_0027612_3242_4861 502
17 3300037418 Ga0395900_0084380 Ga0395900_0084380_1116_2753 503
18 3300005329 Ga0070683_100125910 Ga0070683_1001259101 504
19 3300005336 Ga0070680_100116134 Ga0070680_1001161342 504
20 3300025909 Ga0207705_10027889 Ga0207705_100278895 504
21 3300025917 Ga0207660_10048028 Ga0207660_100480282 504
22 3300025921 Ga0207652_10026753 Ga0207652_100267535 504
23 3300026067 Ga0207678_10031852 Ga0207678_100318522 504
24 3300037418 Ga0395900_0003060 Ga0395900_0003060_11849_13471 504
25 3300048929 Ga0496126_0047040 Ga0496126_0047040_850_2475 505
26 3300044684 Ga0466966_0017112 Ga0466966_0017112_1237_2856 507
27 3300044693 Ga0466961_0066625 Ga0466961_0066625_365_1984 507
28 3300045049 Ga0466959_0053660 Ga0466959_0053660_235_1854 507
29 3300031711 Ga0265314_10001027 Ga0265314_1000102723 508
30 3300048915 Ga0496112_0044931 Ga0496112_0044931_12_1589 508
31 iso_pu_bacteria 2945961074 2945963733 508
32 iso_pu_bacteria 2946006987 2946009965 508
33 iso_pu_bacteria 2947233263 2947237814 508
34 iso_pu_bacteria 8056155041 8056158977 508
35 3300005329 Ga0070683_100005644 Ga0070683_1000056447 510
36 3300005344 Ga0070661_100037933 Ga0070661_1000379333 510
37 3300005435 Ga0070714_100012212 Ga0070714_1000122128 510
38 3300005435 Ga0070714_100015355 Ga0070714_1000153552 510
39 3300005458 Ga0070681_10001144 Ga0070681_1000114410 510
40 3300005530 Ga0070679_100008438 Ga0070679_1000084382 510
41 3300005535 Ga0070684_100036790 Ga0070684_1000367902 510
42 3300005539 Ga0068853_100027796 Ga0068853_1000277963 510
43 3300005563 Ga0068855_100012592 Ga0068855_1000125922 510
44 3300005577 Ga0068857_100005498 Ga0068857_10000549816 510
45 3300005614 Ga0068856_100002047 Ga0068856_1000020475 510
46 3300005616 Ga0068852_100004778 Ga0068852_1000047788 510
47 3300005842 Ga0068858_100042641 Ga0068858_1000426412 510
48 3300006237 Ga0097621_100004160 Ga0097621_1000041602 510
49 3300006358 Ga0068871_100001936 Ga0068871_1000019365 510
50 3300006844 Ga0075428_100028228 Ga0075428_1000282284 510
51 3300009093 Ga0105240_10018106 Ga0105240_100181062 510
52 3300009094 Ga0111539_10031183 Ga0111539_100311838 510
53 3300009545 Ga0105237_10078138 Ga0105237_100781382 510
54 3300009551 Ga0105238_10001041 Ga0105238_1000104115 510
55 3300013105 Ga0157369_10000134 Ga0157369_1000013446 510
56 3300013296 Ga0157374_10000661 Ga0157374_1000066116 510
57 3300013307 Ga0157372_10010222 Ga0157372_100102222 510
58 3300013307 Ga0157372_10011442 Ga0157372_100114425 510
59 3300013307 Ga0157372_10029357 Ga0157372_100293572 510
60 3300014969 Ga0157376_10034568 Ga0157376_100345682 510
61 3300025913 Ga0207695_10012444 Ga0207695_100124442 510
62 3300025921 Ga0207652_10001698 Ga0207652_100016987 510
63 3300025924 Ga0207694_10001081 Ga0207694_1000108115 510
64 3300025929 Ga0207664_10035053 Ga0207664_100350531 510
65 3300025944 Ga0207661_10004525 Ga0207661_100045255 510
66 3300025949 Ga0207667_10000245 Ga0207667_1000024553 510
67 3300025949 Ga0207667_10008821 Ga0207667_100088219 510
68 3300026035 Ga0207703_10008498 Ga0207703_100084985 510
69 3300026041 Ga0207639_10006611 Ga0207639_1000661111 510
70 3300026078 Ga0207702_10000454 Ga0207702_1000045426 510
71 3300048915 Ga0496112_0005913 Ga0496112_0005913_1656_3293 510
72 3300050508 nmdc:mga09592_24403_c1 nmdc:mga09592_24403_c1_82_1665 510
73 3300050510 nmdc:mga06r32_68453_c1 nmdc:mga06r32_68453_c1_1315_2898 510
74 3300005336 Ga0070680_100071646 Ga0070680_1000716462 511
75 3300005339 Ga0070660_100015514 Ga0070660_1000155143 511
76 3300005344 Ga0070661_100002233 Ga0070661_1000022339 511
77 3300005355 Ga0070671_100049345 Ga0070671_1000493454 511
78 3300005366 Ga0070659_100001713 Ga0070659_10000171311 511
79 3300005457 Ga0070662_100012468 Ga0070662_1000124683 511
80 3300005458 Ga0070681_10079886 Ga0070681_100798864 511
81 3300005530 Ga0070679_100052872 Ga0070679_1000528722 511
82 3300005535 Ga0070684_100117771 Ga0070684_1001177712 511
83 3300005539 Ga0068853_100022380 Ga0068853_1000223802 511
84 3300005546 Ga0070696_100013455 Ga0070696_1000134554 511
85 3300005547 Ga0070693_100027720 Ga0070693_1000277204 511
86 3300005563 Ga0068855_100035591 Ga0068855_1000355916 511
87 3300005564 Ga0070664_100003501 Ga0070664_1000035015 511
88 3300005614 Ga0068856_100005834 Ga0068856_1000058345 511
89 3300005834 Ga0068851_10004716 Ga0068851_100047166 511
90 3300009093 Ga0105240_10033595 Ga0105240_100335955 511
91 3300009545 Ga0105237_10026300 Ga0105237_100263005 511
92 3300009551 Ga0105238_10005774 Ga0105238_100057749 511
93 3300010375 Ga0105239_10072758 Ga0105239_100727583 511
94 3300013296 Ga0157374_10006871 Ga0157374_100068714 511
95 3300013306 Ga0163162_10067996 Ga0163162_100679964 511
96 3300013307 Ga0157372_10076839 Ga0157372_100768394 511
97 3300014497 Ga0182008_10000712 Ga0182008_1000071215 511
98 3300014497 Ga0182008_10002552 Ga0182008_100025524 511
99 3300015262 Ga0182007_10003649 Ga0182007_100036493 511
100 3300025912 Ga0207707_10024604 Ga0207707_100246046 511
101 3300025914 Ga0207671_10074747 Ga0207671_100747472 511
102 3300025919 Ga0207657_10001503 Ga0207657_100015033 511
103 3300025920 Ga0207649_10009058 Ga0207649_100090583 511
104 3300025924 Ga0207694_10019640 Ga0207694_100196404 511
105 3300025932 Ga0207690_10016806 Ga0207690_100168062 511
106 3300025933 Ga0207706_10006139 Ga0207706_100061396 511
107 3300025945 Ga0207679_10009363 Ga0207679_100093635 511
108 3300025949 Ga0207667_10011306 Ga0207667_100113065 511
109 3300041411 Ga0439466_0001002 Ga0439466_0001002_1092_2690 511
110 3300042009 Ga0439451_000063 Ga0439451_000063_2256_3854 511
111 3300046452 Ga0495617_002468 Ga0495617_002468_586_2184 511
112 3300046452 Ga0495617_002920 Ga0495617_002920_2792_4390 511
113 3300046458 Ga0495591_000005 Ga0495591_000005_204087_205685 511
114 3300046460 Ga0495638_0009240 Ga0495638_0009240_4778_6376 511
115 3300046471 Ga0495650_0000775 Ga0495650_0000775_26415_28013 511
116 3300046471 Ga0495650_0015684 Ga0495650_0015684_1196_2794 511
117 3300046501 Ga0495607_0040736 Ga0495607_0040736_672_2270 511
118 3300046506 Ga0495583_0000167 Ga0495583_0000167_95966_97564 511
119 3300046506 Ga0495583_0002626 Ga0495583_0002626_12557_14155 511
120 3300046507 Ga0495606_0001672 Ga0495606_0001672_12824_14422 511
121 3300046507 Ga0495606_0001998 Ga0495606_0001998_12960_14558 511
122 3300046507 Ga0495606_0021698 Ga0495606_0021698_531_2129 511
123 3300046512 Ga0495610_0000174 Ga0495610_0000174_15371_16969 511
124 3300046515 Ga0495620_0002598 Ga0495620_0002598_8159_9757 511
125 3300046518 Ga0495631_0006358 Ga0495631_0006358_388_1986 511
126 3300046519 Ga0495632_0013955 Ga0495632_0013955_637_2235 511
127 3300046519 Ga0495632_0042616 Ga0495632_0042616_39_1637 511
128 3300046522 Ga0495643_0010066 Ga0495643_0010066_3602_5200 511
129 3300046523 Ga0495644_0001132 Ga0495644_0001132_7489_9087 511
130 3300046524 Ga0495648_0000487 Ga0495648_0000487_15942_17540 511
131 3300046524 Ga0495648_0001882 Ga0495648_0001882_5023_6621 511
132 3300046524 Ga0495648_0014622 Ga0495648_0014622_2570_4168 511
133 3300046524 Ga0495648_0015301 Ga0495648_0015301_1412_3010 511
134 3300046528 Ga0495642_0000004 Ga0495642_0000004_106773_108371 511
135 3300046530 Ga0495654_0000463 Ga0495654_0000463_12469_14067 511
136 3300046530 Ga0495654_0015457 Ga0495654_0015457_1292_2890 511
137 3300046542 Ga0495597_0009786 Ga0495597_0009786_2566_4164 511
138 3300046558 Ga0495633_0014064 Ga0495633_0014064_724_2322 511
139 3300046648 Ga0495611_0011105 Ga0495611_0011105_565_2163 511
140 3300046665 Ga0495661_0000354 Ga0495661_0000354_39060_40658 511
141 3300046691 Ga0495670_0000057 Ga0495670_0000057_13583_15181 511
142 3300046691 Ga0495670_0033432 Ga0495670_0033432_155_1753 511
143 3300046692 Ga0495671_0000241 Ga0495671_0000241_16720_18318 511
144 3300046692 Ga0495671_0011524 Ga0495671_0011524_2704_4302 511
145 3300046794 Ga0495589_0000739 Ga0495589_0000739_7010_8608 511
146 3300046810 Ga0495660_0000606 Ga0495660_0000606_23598_25196 511
147 3300047320 Ga0495672_0003677 Ga0495672_0003677_1678_3276 511
148 3300047323 Ga0495683_0000253 Ga0495683_0000253_32431_34029 511
149 3300047446 Ga0495679_000143 Ga0495679_000143_39079_40677 511
150 3300047469 Ga0495673_0022500 Ga0495673_0022500_1068_2666 511
151 3300047469 Ga0495673_0028289 Ga0495673_0028289_422_2020 511
152 3300047469 Ga0495673_0033279 Ga0495673_0033279_519_2117 511
153 3300047470 Ga0495681_0011543 Ga0495681_0011543_1936_3534 511
154 3300047470 Ga0495681_0014237 Ga0495681_0014237_637_2235 511
155 3300047472 Ga0495686_0045680 Ga0495686_0045680_625_2223 511
156 3300048091 Ga0495626_0000265 Ga0495626_0000265_12307_13905 511
157 3300048091 Ga0495626_0000854 Ga0495626_0000854_9902_11500 511
158 3300048903 Ga0496100_0014784 Ga0496100_0014784_2671_4305 511
159 3300048905 Ga0496102_0004200 Ga0496102_0004200_1894_3528 511
160 3300048906 Ga0496103_0004156 Ga0496103_0004156_2615_4249 511
161 3300048907 Ga0496104_0010723 Ga0496104_0010723_101_1735 511
162 3300048909 Ga0496106_0075846 Ga0496106_0075846_448_2082 511
163 3300048910 Ga0496107_0040411 Ga0496107_0040411_209_1843 511
164 3300048911 Ga0496108_0019119 Ga0496108_0019119_1317_2951 511
165 3300048912 Ga0496109_0021099 Ga0496109_0021099_2406_4040 511
166 3300048914 Ga0496111_0003397 Ga0496111_0003397_4886_6520 511
167 3300048916 Ga0496113_0002253 Ga0496113_0002253_7413_9047 511
168 3300053161 Ga0500634_0000037 Ga0500634_0000037_23913_25511 511
169 3300005436 Ga0070713_100004207 Ga0070713_1000042076 512
170 3300005458 Ga0070681_10000247 Ga0070681_1000024716 512
171 3300005577 Ga0068857_100040676 Ga0068857_1000406764 512
172 3300009093 Ga0105240_10024508 Ga0105240_100245085 512
173 3300009551 Ga0105238_10001061 Ga0105238_1000106123 512
174 3300013105 Ga0157369_10000258 Ga0157369_1000025820 512
175 3300013296 Ga0157374_10022386 Ga0157374_100223862 512
176 3300013307 Ga0157372_10000335 Ga0157372_1000033523 512
177 3300025912 Ga0207707_10001477 Ga0207707_100014779 512
178 3300025921 Ga0207652_10052778 Ga0207652_100527782 512
179 3300025924 Ga0207694_10000284 Ga0207694_1000028421 512
180 3300025928 Ga0207700_10015608 Ga0207700_100156083 512
181 3300025949 Ga0207667_10000487 Ga0207667_1000048723 512
182 3300026041 Ga0207639_10014149 Ga0207639_100141495 512
183 3300026078 Ga0207702_10000482 Ga0207702_100004825 512
184 3300026116 Ga0207674_10020001 Ga0207674_100200014 512
185 3300026142 Ga0207698_10017821 Ga0207698_100178212 512
186 3300039450 Ga0436363_1131501 Ga0436363_1131501_743_2368 512
187 3300048915 Ga0496112_0019541 Ga0496112_0019541_4274_5893 512
188 3300048916 Ga0496113_0112508 Ga0496113_0112508_362_1981 512
189 3300028800 Ga0265338_10034265 Ga0265338_100342655 513
190 3300031344 Ga0265316_10027712 Ga0265316_100277123 513
191 3300050509 nmdc:mga0qj67_19527_c1 nmdc:mga0qj67_19527_c1_1987_3573 513
192 3300005330 Ga0070690_100035999 Ga0070690_1000359992 514
193 3300005937 Ga0081455_10013832 Ga0081455_100138323 514
194 3300006846 Ga0075430_100003080 Ga0075430_10000308011 514
195 3300006847 Ga0075431_100091553 Ga0075431_1000915533 514
196 3300009147 Ga0114129_10012984 Ga0114129_100129843 514
197 3300009553 Ga0105249_10039605 Ga0105249_100396053 514
198 3300027671 Ga0209588_1002355 Ga0209588_10023554 514
199 3300050507 nmdc:mga05p37_14776_c1 nmdc:mga05p37_14776_c1_5958_7580 514
200 3300050508 nmdc:mga09592_48333_c1 nmdc:mga09592_48333_c1_1829_3427 514
201 3300050510 nmdc:mga06r32_97096_c1 nmdc:mga06r32_97096_c1_235_1833 514
202 3300006178 Ga0075367_10008309 Ga0075367_100083095 515
203 3300006846 Ga0075430_100029707 Ga0075430_1000297074 515
204 3300006847 Ga0075431_100070167 Ga0075431_1000701672 515
205 3300006880 Ga0075429_100031657 Ga0075429_1000316572 515
206 3300009147 Ga0114129_10007873 Ga0114129_100078739 515
207 3300009147 Ga0114129_10234347 Ga0114129_102343472 515
208 3300049593 Ga0501077_0037475 Ga0501077_0037475_1464_3065 515
209 3300050494 nmdc:mga06z11_36796_c1 nmdc:mga06z11_36796_c1_108_1709 515
210 3300050509 nmdc:mga0qj67_2012_c1 nmdc:mga0qj67_2012_c1_1401_3002 515
211 3300050510 nmdc:mga06r32_92361_c1 nmdc:mga06r32_92361_c1_765_2369 515
212 3300060353 Ga0501082_0080263 Ga0501082_0080263_1119_2720 515
213 3300005290 Ga0065712_10006770 Ga0065712_100067701 516
214 3300005290 Ga0065712_10068753 Ga0065712_100687534 516
215 3300005329 Ga0070683_100003814 Ga0070683_1000038143 516
216 3300005344 Ga0070661_100003160 Ga0070661_1000031603 516
217 3300005354 Ga0070675_100082354 Ga0070675_1000823541 516
218 3300005355 Ga0070671_100056861 Ga0070671_1000568612 516
219 3300005364 Ga0070673_100129845 Ga0070673_1001298452 516
220 3300005458 Ga0070681_10074665 Ga0070681_100746651 516
221 3300005530 Ga0070679_100040488 Ga0070679_1000404886 516
222 3300005535 Ga0070684_100015869 Ga0070684_1000158692 516
223 3300005543 Ga0070672_100150838 Ga0070672_1001508382 516
224 3300005614 Ga0068856_100001696 Ga0068856_1000016969 516
225 3300006844 Ga0075428_100004241 Ga0075428_1000042415 516
226 3300006847 Ga0075431_100029475 Ga0075431_1000294753 516
227 3300006852 Ga0075433_10003978 Ga0075433_100039783 516
228 3300006871 Ga0075434_100007024 Ga0075434_1000070242 516
229 3300009094 Ga0111539_10289772 Ga0111539_102897722 516
230 3300009098 Ga0105245_10147040 Ga0105245_101470402 516
231 3300009147 Ga0114129_10023521 Ga0114129_100235212 516
232 3300013296 Ga0157374_10101183 Ga0157374_101011832 516
233 3300013308 Ga0157375_10180531 Ga0157375_101805312 516
234 3300025912 Ga0207707_10149435 Ga0207707_101494352 516
235 3300025920 Ga0207649_10080913 Ga0207649_100809131 516
236 3300025921 Ga0207652_10151853 Ga0207652_101518531 516
237 3300025931 Ga0207644_10023383 Ga0207644_100233833 516
238 3300025944 Ga0207661_10001184 Ga0207661_1000118411 516
239 3300026078 Ga0207702_10000091 Ga0207702_100000918 516
240 3300026116 Ga0207674_10029219 Ga0207674_100292196 516
241 3300048907 Ga0496104_0018597 Ga0496104_0018597_3573_5177 516
242 3300048907 Ga0496104_0054077 Ga0496104_0054077_1606_3258 516
243 3300048908 Ga0496105_0020243 Ga0496105_0020243_282_1934 516
244 3300048911 Ga0496108_0026300 Ga0496108_0026300_2275_3879 516
245 3300048912 Ga0496109_0001663 Ga0496109_0001663_12435_14039 516
246 3300048914 Ga0496111_0019769 Ga0496111_0019769_2188_3792 516
247 3300048916 Ga0496113_0058427 Ga0496113_0058427_482_2086 516
248 3300048918 Ga0496115_0020994 Ga0496115_0020994_3157_4809 516
249 3300049587 Ga0501071_0068660 Ga0501071_0068660_317_1924 516
250 3300049824 Ga0501045_0057341 Ga0501045_0057341_95_1702 516
251 3300050507 nmdc:mga05p37_19988_c1 nmdc:mga05p37_19988_c1_673_2277 516
252 3300050512 nmdc:mga0n895_5649_c1 nmdc:mga0n895_5649_c1_7003_8607 516
253 3300050515 nmdc:mga0a205_31262_c1 nmdc:mga0a205_31262_c1_2813_4417 516
254 3300050515 nmdc:mga0a205_5842_c1 nmdc:mga0a205_5842_c1_1557_3161 516
255 3300005293 Ga0065715_10013849 Ga0065715_100138492 517
256 3300005327 Ga0070658_10001372 Ga0070658_100013725 517
257 3300005337 Ga0070682_100026421 Ga0070682_1000264211 517
258 3300005339 Ga0070660_100000773 Ga0070660_1000007735 517
259 3300005339 Ga0070660_100036539 Ga0070660_1000365394 517
260 3300005530 Ga0070679_100069664 Ga0070679_1000696643 517
261 3300005563 Ga0068855_100002571 Ga0068855_1000025714 517
262 3300005577 Ga0068857_100048315 Ga0068857_1000483152 517
263 3300005616 Ga0068852_100004781 Ga0068852_1000047818 517
264 3300005616 Ga0068852_100006343 Ga0068852_1000063434 517
265 3300013102 Ga0157371_10000892 Ga0157371_1000089216 517
266 3300013102 Ga0157371_10020196 Ga0157371_100201965 517
267 3300013104 Ga0157370_10002480 Ga0157370_100024802 517
268 3300025901 Ga0207688_10010552 Ga0207688_100105522 517
269 3300025904 Ga0207647_10007033 Ga0207647_100070332 517
270 3300025904 Ga0207647_10011034 Ga0207647_100110343 517
271 3300025909 Ga0207705_10000419 Ga0207705_1000041918 517
272 3300025909 Ga0207705_10007786 Ga0207705_100077864 517
273 3300025909 Ga0207705_10065583 Ga0207705_100655832 517
274 3300025909 Ga0207705_10094081 Ga0207705_100940812 517
275 3300025912 Ga0207707_10043614 Ga0207707_100436142 517
276 3300025913 Ga0207695_10044125 Ga0207695_100441255 517
277 3300025914 Ga0207671_10038188 Ga0207671_100381883 517
278 3300025917 Ga0207660_10001220 Ga0207660_1000122018 517
279 3300025917 Ga0207660_10001524 Ga0207660_100015246 517
280 3300025917 Ga0207660_10014935 Ga0207660_100149352 517
281 3300025919 Ga0207657_10000159 Ga0207657_1000015918 517
282 3300025919 Ga0207657_10003049 Ga0207657_1000304914 517
283 3300025921 Ga0207652_10058987 Ga0207652_100589873 517
284 3300025921 Ga0207652_10089999 Ga0207652_100899992 517
285 3300025933 Ga0207706_10002112 Ga0207706_1000211212 517
286 3300025944 Ga0207661_10002226 Ga0207661_1000222615 517
287 3300025944 Ga0207661_10028936 Ga0207661_100289363 517
288 3300025945 Ga0207679_10106471 Ga0207679_101064712 517
289 3300025949 Ga0207667_10000314 Ga0207667_1000031465 517
290 3300025949 Ga0207667_10006431 Ga0207667_100064315 517
291 3300025949 Ga0207667_10028616 Ga0207667_100286164 517
292 3300025949 Ga0207667_10092112 Ga0207667_100921123 517
293 3300026041 Ga0207639_10017610 Ga0207639_100176103 517
294 3300026078 Ga0207702_10009071 Ga0207702_100090718 517
295 3300026116 Ga0207674_10001151 Ga0207674_1000115119 517
296 3300026116 Ga0207674_10021224 Ga0207674_100212244 517
297 3300026142 Ga0207698_10000912 Ga0207698_1000091222 517
298 3300026142 Ga0207698_10012327 Ga0207698_100123273 517
299 3300026142 Ga0207698_10014443 Ga0207698_100144435 517
300 3300026142 Ga0207698_10138172 Ga0207698_101381722 517
301 3300037068 Ga0373925_0006140 Ga0373925_0006140_4545_6161 517
302 3300037418 Ga0395900_0058197 Ga0395900_0058197_1085_2704 517
303 3300037466 Ga0395898_0033031 Ga0395898_0033031_1943_3562 517
304 3300037471 Ga0395905_0035459 Ga0395905_0035459_1596_3215 517
305 3300038443 Ga0395901_0005170 Ga0395901_0005170_9263_10882 517
306 3300038443 Ga0395901_0008749 Ga0395901_0008749_3103_4722 517
307 3300038443 Ga0395901_0252214 Ga0395901_0252214_165_1784 517
308 3300044656 Ga0466969_0036131 Ga0466969_0036131_862_2481 517
309 3300045976 Ga0466967_0005247 Ga0466967_0005247_2509_4128 517
310 3300045976 Ga0466967_0007210 Ga0466967_0007210_389_2008 517
311 3300045976 Ga0466967_0008683 Ga0466967_0008683_2240_3859 517
312 3300045976 Ga0466967_0028238 Ga0466967_0028238_2584_4203 517
313 3300045976 Ga0466967_0102638 Ga0466967_0102638_969_2588 517
314 3300046472 Ga0495580_0075523 Ga0495580_0075523_541_2145 517
315 3300005330 Ga0070690_100011506 Ga0070690_1000115063 518
316 3300005331 Ga0070670_100010077 Ga0070670_1000100777 518
317 3300005334 Ga0068869_100012085 Ga0068869_1000120855 518
318 3300005337 Ga0070682_100086289 Ga0070682_1000862892 518
319 3300005338 Ga0068868_100001688 Ga0068868_1000016885 518
320 3300005344 Ga0070661_100007607 Ga0070661_1000076074 518
321 3300005355 Ga0070671_100051197 Ga0070671_1000511972 518
322 3300005364 Ga0070673_100001367 Ga0070673_1000013675 518
323 3300005364 Ga0070673_100073115 Ga0070673_1000731153 518
324 3300005434 Ga0070709_10023151 Ga0070709_100231512 518
325 3300005435 Ga0070714_100009936 Ga0070714_1000099362 518
326 3300005435 Ga0070714_100082797 Ga0070714_1000827972 518
327 3300005436 Ga0070713_100010519 Ga0070713_1000105194 518
328 3300005437 Ga0070710_10009681 Ga0070710_100096812 518
329 3300005439 Ga0070711_100004233 Ga0070711_1000042333 518
330 3300005459 Ga0068867_100003528 Ga0068867_1000035283 518
331 3300005530 Ga0070679_100081316 Ga0070679_1000813162 518
332 3300005543 Ga0070672_100019537 Ga0070672_1000195374 518
333 3300005563 Ga0068855_100000561 Ga0068855_1000005615 518
334 3300005564 Ga0070664_100003647 Ga0070664_1000036475 518
335 3300005577 Ga0068857_100000419 Ga0068857_1000004196 518
336 3300005614 Ga0068856_100000394 Ga0068856_10000039440 518
337 3300005614 Ga0068856_100002997 Ga0068856_10000299717 518
338 3300005617 Ga0068859_100000290 Ga0068859_10000029021 518
339 3300005618 Ga0068864_100001429 Ga0068864_1000014295 518
340 3300005718 Ga0068866_10001078 Ga0068866_100010784 518
341 3300005842 Ga0068858_100002722 Ga0068858_1000027224 518
342 3300006028 Ga0070717_10051695 Ga0070717_100516952 518
343 3300006028 Ga0070717_10141495 Ga0070717_101414952 518
344 3300006173 Ga0070716_100057929 Ga0070716_1000579292 518
345 3300006175 Ga0070712_100016363 Ga0070712_1000163632 518
346 3300006175 Ga0070712_100036163 Ga0070712_1000361633 518
347 3300006237 Ga0097621_100001063 Ga0097621_10000106317 518
348 3300006358 Ga0068871_100029931 Ga0068871_1000299314 518
349 3300006931 Ga0097620_100000290 Ga0097620_10000029021 518
350 3300007076 Ga0075435_100002073 Ga0075435_1000020736 518
351 3300009093 Ga0105240_10205380 Ga0105240_102053801 518
352 3300013100 Ga0157373_10024462 Ga0157373_100244622 518
353 3300013102 Ga0157371_10036902 Ga0157371_100369021 518
354 3300013102 Ga0157371_10126702 Ga0157371_101267022 518
355 3300013296 Ga0157374_10000517 Ga0157374_1000051712 518
356 3300013297 Ga0157378_10000517 Ga0157378_1000051723 518
357 3300013307 Ga0157372_10000629 Ga0157372_1000062916 518
358 3300014325 Ga0163163_10159075 Ga0163163_101590752 518
359 3300014969 Ga0157376_10040249 Ga0157376_100402492 518
360 3300025898 Ga0207692_10005300 Ga0207692_100053005 518
361 3300025899 Ga0207642_10000509 Ga0207642_100005099 518
362 3300025904 Ga0207647_10004022 Ga0207647_100040224 518
363 3300025906 Ga0207699_10022367 Ga0207699_100223672 518
364 3300025906 Ga0207699_10023187 Ga0207699_100231872 518
365 3300025915 Ga0207693_10005882 Ga0207693_100058825 518
366 3300025915 Ga0207693_10026475 Ga0207693_100264752 518
367 3300025916 Ga0207663_10035866 Ga0207663_100358661 518
368 3300025916 Ga0207663_10058173 Ga0207663_100581732 518
369 3300025925 Ga0207650_10007616 Ga0207650_100076164 518
370 3300025929 Ga0207664_10006945 Ga0207664_100069455 518
371 3300025931 Ga0207644_10008669 Ga0207644_100086692 518
372 3300025940 Ga0207691_10001855 Ga0207691_1000185514 518
373 3300025941 Ga0207711_10020787 Ga0207711_100207875 518
374 3300025942 Ga0207689_10016908 Ga0207689_100169083 518
375 3300025945 Ga0207679_10006991 Ga0207679_100069914 518
376 3300025949 Ga0207667_10002750 Ga0207667_100027505 518
377 3300025960 Ga0207651_10001825 Ga0207651_100018255 518
378 3300025981 Ga0207640_10012164 Ga0207640_100121645 518
379 3300026023 Ga0207677_10002130 Ga0207677_100021308 518
380 3300026035 Ga0207703_10000881 Ga0207703_100008814 518
381 3300026035 Ga0207703_10013106 Ga0207703_100131064 518
382 3300026078 Ga0207702_10001896 Ga0207702_1000189616 518
383 3300026088 Ga0207641_10033229 Ga0207641_100332292 518
384 3300026089 Ga0207648_10015008 Ga0207648_100150084 518
385 3300026095 Ga0207676_10001522 Ga0207676_1000152216 518
386 3300026116 Ga0207674_10000229 Ga0207674_1000022940 518
387 3300026116 Ga0207674_10010596 Ga0207674_100105967 518
388 3300035691 Ga0373931_0029980 Ga0373931_0029980_207_1847 518
389 3300037853 Ga0436364_0488840 Ga0436364_0488840_97_1737 518
390 3300039450 Ga0436363_0796445 Ga0436363_0796445_1948_3588 518
391 3300044673 Ga0453683_0003521 Ga0453683_0003521_8364_10007 518
392 3300044694 Ga0466963_0000208 Ga0466963_0000208_3272_4894 518
393 3300044694 Ga0466963_0036753 Ga0466963_0036753_344_1966 518
394 3300044842 Ga0466957_0001777 Ga0466957_0001777_3601_5223 518
395 3300044842 Ga0466957_0008613 Ga0466957_0008613_923_2545 518
396 3300045836 Ga0466958_0000543 Ga0466958_0000543_13859_15481 518
397 3300045976 Ga0466967_0000567 Ga0466967_0000567_3272_4894 518
398 3300046472 Ga0495580_0007152 Ga0495580_0007152_2372_4018 518
399 3300046531 Ga0495665_0014551 Ga0495665_0014551_2461_4095 518
400 3300046684 Ga0495669_0028301 Ga0495669_0028301_314_1948 518
401 3300046689 Ga0495613_0007406 Ga0495613_0007406_5371_6999 518
402 3300048915 Ga0496112_0009917 Ga0496112_0009917_3120_4760 518
403 3300050512 nmdc:mga0n895_12303_c1 nmdc:mga0n895_12303_c1_5597_7219 518
404 3300050513 nmdc:mga0rr50_6394_c1 nmdc:mga0rr50_6394_c1_5317_6939 518
405 3300005327 Ga0070658_10027582 Ga0070658_100275823 519
406 3300005327 Ga0070658_10043442 Ga0070658_100434422 519
407 3300005329 Ga0070683_100004771 Ga0070683_1000047717 519
408 3300005336 Ga0070680_100057450 Ga0070680_1000574501 519
409 3300005339 Ga0070660_100005907 Ga0070660_1000059078 519
410 3300005339 Ga0070660_100020550 Ga0070660_1000205505 519
411 3300005344 Ga0070661_100034547 Ga0070661_1000345473 519
412 3300005458 Ga0070681_10002214 Ga0070681_100022146 519
413 3300005458 Ga0070681_10003473 Ga0070681_100034734 519
414 3300005530 Ga0070679_100000327 Ga0070679_10000032715 519
415 3300005530 Ga0070679_100010134 Ga0070679_1000101345 519
416 3300005545 Ga0070695_100001059 Ga0070695_1000010596 519
417 3300005563 Ga0068855_100032252 Ga0068855_1000322526 519
418 3300005563 Ga0068855_100039129 Ga0068855_1000391294 519
419 3300005577 Ga0068857_100008356 Ga0068857_1000083565 519
420 3300005577 Ga0068857_100032487 Ga0068857_1000324872 519
421 3300005578 Ga0068854_100038957 Ga0068854_1000389572 519
422 3300005614 Ga0068856_100009823 Ga0068856_1000098233 519
423 3300005616 Ga0068852_100004628 Ga0068852_10000462810 519
424 3300009093 Ga0105240_10002877 Ga0105240_1000287712 519
425 3300009093 Ga0105240_10051192 Ga0105240_100511922 519
426 3300009545 Ga0105237_10007734 Ga0105237_100077342 519
427 3300009551 Ga0105238_10007685 Ga0105238_100076856 519
428 3300009551 Ga0105238_10014246 Ga0105238_100142466 519
429 3300013102 Ga0157371_10054559 Ga0157371_100545591 519
430 3300013104 Ga0157370_10002254 Ga0157370_1000225414 519
431 3300013105 Ga0157369_10011416 Ga0157369_100114166 519
432 3300013307 Ga0157372_10000125 Ga0157372_1000012556 519
433 3300025909 Ga0207705_10002757 Ga0207705_100027574 519
434 3300025912 Ga0207707_10008348 Ga0207707_100083485 519
435 3300025912 Ga0207707_10091905 Ga0207707_100919052 519
436 3300025913 Ga0207695_10001093 Ga0207695_1000109312 519
437 3300025919 Ga0207657_10002194 Ga0207657_100021949 519
438 3300025919 Ga0207657_10008065 Ga0207657_100080657 519
439 3300025921 Ga0207652_10006183 Ga0207652_100061834 519
440 3300025924 Ga0207694_10001478 Ga0207694_100014786 519
441 3300025932 Ga0207690_10006311 Ga0207690_100063115 519
442 3300025944 Ga0207661_10077319 Ga0207661_100773192 519
443 3300025949 Ga0207667_10000123 Ga0207667_1000012328 519
444 3300025949 Ga0207667_10028027 Ga0207667_100280275 519
445 3300026067 Ga0207678_10006379 Ga0207678_100063792 519
446 3300026116 Ga0207674_10006007 Ga0207674_100060074 519
447 3300026116 Ga0207674_10035662 Ga0207674_100356625 519
448 3300026142 Ga0207698_10004145 Ga0207698_100041455 519
449 3300036401 Ga0373937_0005073 Ga0373937_0005073_6457_8112 519
450 3300038443 Ga0395901_0104883 Ga0395901_0104883_253_1881 519
451 3300046684 Ga0495669_0021164 Ga0495669_0021164_924_2561 519
452 3300049589 Ga0501073_0043084 Ga0501073_0043084_467_2104 519
453 3300053103 Ga0500555_001047 Ga0500555_001047_2444_4066 519
454 3300053730 Ga0500645_002423 Ga0500645_002423_2448_4070 519
455 3300005327 Ga0070658_10000010 Ga0070658_10000010110 520
456 3300005435 Ga0070714_100117168 Ga0070714_1001171682 520
457 3300005535 Ga0070684_100043366 Ga0070684_1000433662 520
458 3300005563 Ga0068855_100065797 Ga0068855_1000657972 520
459 3300006881 Ga0068865_100082825 Ga0068865_1000828252 520
460 3300007265 Ga0099794_10011502 Ga0099794_100115022 520
461 3300009093 Ga0105240_10209187 Ga0105240_102091872 520
462 3300013104 Ga0157370_10029113 Ga0157370_100291134 520
463 3300013105 Ga0157369_10118493 Ga0157369_101184933 520
464 3300013307 Ga0157372_10010413 Ga0157372_100104133 520
465 3300025909 Ga0207705_10000016 Ga0207705_10000016176 520
466 3300025938 Ga0207704_10004923 Ga0207704_100049236 520
467 3300026067 Ga0207678_10000102 Ga0207678_1000010257 520
468 3300027671 Ga0209588_1002342 Ga0209588_10023423 520
469 3300027671 Ga0209588_1015655 Ga0209588_10156552 520
470 3300028800 Ga0265338_10114654 Ga0265338_101146542 520
471 3300005458 Ga0070681_10010707 Ga0070681_100107074 521
472 3300005544 Ga0070686_100002740 Ga0070686_1000027402 521
473 3300005548 Ga0070665_100002180 Ga0070665_1000021806 521
474 3300024227 Ga0228598_1000409 Ga0228598_10004098 521
475 3300025893 Ga0207682_10024110 Ga0207682_100241101 521
476 3300025912 Ga0207707_10100155 Ga0207707_101001552 521
477 3300025924 Ga0207694_10071576 Ga0207694_100715762 521
478 3300025941 Ga0207711_10083347 Ga0207711_100833472 521
479 3300025944 Ga0207661_10045545 Ga0207661_100455453 521
480 3300026121 Ga0207683_10004353 Ga0207683_100043538 521
481 3300028379 Ga0268266_10032306 Ga0268266_100323064 521
482 3300028379 Ga0268266_10033892 Ga0268266_100338922 521
483 3300046543 Ga0495645_0001271 Ga0495645_0001271_8913_10535 521
484 3300047471 Ga0495684_0050536 Ga0495684_0050536_905_2542 521
485 3300048913 Ga0496110_0061495 Ga0496110_0061495_786_2408 521
486 3300005439 Ga0070711_100003054 Ga0070711_1000030544 522
487 3300005439 Ga0070711_100014844 Ga0070711_1000148444 522
488 3300009094 Ga0111539_10020976 Ga0111539_100209763 522
489 3300009545 Ga0105237_10037757 Ga0105237_100377574 522
490 3300013307 Ga0157372_10028289 Ga0157372_100282893 522
491 3300025906 Ga0207699_10025017 Ga0207699_100250172 522
492 3300025923 Ga0207681_10000044 Ga0207681_1000004434 522
493 3300027671 Ga0209588_1013405 Ga0209588_10134052 522
494 3300027876 Ga0209974_10001602 Ga0209974_100016026 522
495 3300031616 Ga0307508_10014924 Ga0307508_100149249 522
496 3300035692 Ga0373935_0000591 Ga0373935_0000591_2348_4024 522
497 3300048917 Ga0496114_0000031 Ga0496114_0000031_140910_142583 522
498 3300050511 nmdc:mga08y16_36066_c1 nmdc:mga08y16_36066_c1_1170_2795 522
499 3300005614 Ga0068856_100023859 Ga0068856_1000238596 523
500 3300014968 Ga0157379_10000346 Ga0157379_100003463 523
501 3300035725 Ga0373947_0006738 Ga0373947_0006738_4121_5758 523
502 3300036401 Ga0373937_0013628 Ga0373937_0013628_3445_5064 523
503 3300037068 Ga0373925_0010712 Ga0373925_0010712_95_1732 523
504 3300046472 Ga0495580_0003395 Ga0495580_0003395_4956_6593 523
505 3300053119 Ga0500595_000039 Ga0500595_000039_52491_54146 523
506 3300005458 Ga0070681_10000261 Ga0070681_100002617 524
507 3300005530 Ga0070679_100003583 Ga0070679_1000035834 524
508 3300005535 Ga0070684_100016031 Ga0070684_1000160314 524
509 3300005545 Ga0070695_100034537 Ga0070695_1000345375 524
510 3300005981 Ga0081538_10003485 Ga0081538_1000348510 524
511 3300009093 Ga0105240_10133163 Ga0105240_101331633 524
512 3300009098 Ga0105245_10100566 Ga0105245_101005662 524
513 3300013297 Ga0157378_10059811 Ga0157378_100598112 524
514 3300025912 Ga0207707_10000003 Ga0207707_10000003362 524
515 3300025912 Ga0207707_10175375 Ga0207707_101753752 524
516 3300025913 Ga0207695_10087992 Ga0207695_100879922 524
517 3300025921 Ga0207652_10000024 Ga0207652_1000002420 524
518 3300025944 Ga0207661_10048712 Ga0207661_100487122 524
519 3300035241 Ga0373961_0000297 Ga0373961_0000297_9868_11550 524
520 3300036401 Ga0373937_0000340 Ga0373937_0000340_24408_26045 524
521 3300048905 Ga0496102_0098945 Ga0496102_0098945_630_2267 524
522 3300048915 Ga0496112_0011999 Ga0496112_0011999_4789_6426 524
523 3300006846 Ga0075430_100035481 Ga0075430_1000354812 525
524 3300035171 Ga0373946_0004832 Ga0373946_0004832_508_2190 525
525 3300035695 Ga0373927_0001772 Ga0373927_0001772_12386_14068 525
526 3300035725 Ga0373947_0004469 Ga0373947_0004469_1681_3363 525
527 3300037068 Ga0373925_0000615 Ga0373925_0000615_2617_4299 525
528 3300037418 Ga0395900_0029601 Ga0395900_0029601_1828_3504 525
529 3300049592 Ga0501076_0083010 Ga0501076_0083010_431_2059 525
530 3300050514 nmdc:mga08x19_16488_c1 nmdc:mga08x19_16488_c1_2357_4039 525
531 iso_pu_bacteria 2595698237 2596374901 525
532 iso_pu_bacteria 2889306138 2889306534 525
533 iso_pu_bacteria 2902330777 2902332357 525
534 iso_pu_bacteria 2902405164 2902411473 525
535 iso_pu_bacteria 2928125067 2928129824 525
536 3300005336 Ga0070680_100026993 Ga0070680_1000269931 526
537 3300005406 Ga0070703_10006223 Ga0070703_100062233 526
538 3300005436 Ga0070713_100000907 Ga0070713_10000090710 526
539 3300005444 Ga0070694_100002730 Ga0070694_1000027302 526
540 3300005445 Ga0070708_100011685 Ga0070708_1000116853 526
541 3300005445 Ga0070708_100088845 Ga0070708_1000888451 526
542 3300005467 Ga0070706_100038332 Ga0070706_1000383324 526
543 3300005467 Ga0070706_100110895 Ga0070706_1001108952 526
544 3300005471 Ga0070698_100000236 Ga0070698_10000023622 526
545 3300005518 Ga0070699_100069043 Ga0070699_1000690433 526
546 3300005530 Ga0070679_100034853 Ga0070679_1000348534 526
547 3300005536 Ga0070697_100001253 Ga0070697_10000125314 526
548 3300005545 Ga0070695_100011378 Ga0070695_1000113785 526
549 3300005546 Ga0070696_100054662 Ga0070696_1000546622 526
550 3300005547 Ga0070693_100000102 Ga0070693_10000010222 526
551 3300005549 Ga0070704_100001455 Ga0070704_10000145512 526
552 3300005549 Ga0070704_100036561 Ga0070704_1000365612 526
553 3300005563 Ga0068855_100035466 Ga0068855_1000354664 526
554 3300005843 Ga0068860_100003559 Ga0068860_1000035595 526
555 3300006173 Ga0070716_100000297 Ga0070716_1000002976 526
556 3300006173 Ga0070716_100005379 Ga0070716_1000053794 526
557 3300006847 Ga0075431_100023037 Ga0075431_1000230372 526
558 3300006852 Ga0075433_10004780 Ga0075433_100047804 526
559 3300006871 Ga0075434_100001703 Ga0075434_1000017034 526
560 3300007265 Ga0099794_10013424 Ga0099794_100134244 526
561 3300013297 Ga0157378_10000915 Ga0157378_1000091512 526
562 3300014969 Ga0157376_10002022 Ga0157376_100020229 526
563 3300025885 Ga0207653_10007131 Ga0207653_100071313 526
564 3300025910 Ga0207684_10010867 Ga0207684_100108676 526
565 3300025917 Ga0207660_10054259 Ga0207660_100542591 526
566 3300025922 Ga0207646_10011190 Ga0207646_100111906 526
567 3300025928 Ga0207700_10003312 Ga0207700_100033126 526
568 3300025939 Ga0207665_10000020 Ga0207665_1000002069 526
569 3300025939 Ga0207665_10004248 Ga0207665_100042487 526
570 3300025939 Ga0207665_10030902 Ga0207665_100309023 526
571 3300028016 Ga0265354_1000380 Ga0265354_10003803 526
572 3300030879 Ga0265765_1000017 Ga0265765_10000173 526
573 3300031090 Ga0265760_10000038 Ga0265760_100000384 526
574 3300035118 Ga0373954_0001152 Ga0373954_0001152_7578_9257 526
575 3300035119 Ga0373956_0003549 Ga0373956_0003549_4086_5765 526
576 3300035120 Ga0373957_0002185 Ga0373957_0002185_3222_4901 526
577 3300036401 Ga0373937_0004081 Ga0373937_0004081_8256_9935 526
578 3300037068 Ga0373925_0080403 Ga0373925_0080403_673_2355 526
579 3300046472 Ga0495580_0021725 Ga0495580_0021725_166_1848 526
580 3300046499 Ga0495594_0007810 Ga0495594_0007810_2465_4147 526
581 3300046511 Ga0495608_0012838 Ga0495608_0012838_2512_4191 526
582 3300046517 Ga0495630_0069437 Ga0495630_0069437_251_1933 526
583 3300046535 Ga0495586_0017915 Ga0495586_0017915_2024_3706 526
584 3300046536 Ga0495587_0006021 Ga0495587_0006021_4242_5921 526
585 3300046642 Ga0495634_0014457 Ga0495634_0014457_3699_5381 526
586 3300046679 Ga0495623_0016226 Ga0495623_0016226_2754_4433 526
587 3300046683 Ga0495658_0032729 Ga0495658_0032729_729_2411 526
588 3300046689 Ga0495613_0074590 Ga0495613_0074590_716_2398 526
589 3300047317 Ga0495604_0007016 Ga0495604_0007016_4913_6592 526
590 3300047319 Ga0495674_0036665 Ga0495674_0036665_825_2507 526
591 3300047471 Ga0495684_0029266 Ga0495684_0029266_2411_4090 526
592 3300048088 Ga0495602_0026633 Ga0495602_0026633_1294_2973 526
593 3300048905 Ga0496102_0000997 Ga0496102_0000997_12108_13781 526
594 3300050512 nmdc:mga0n895_17278_c1 nmdc:mga0n895_17278_c1_2390_4024 526
595 3300050513 nmdc:mga0rr50_16574_c1 nmdc:mga0rr50_16574_c1_205_1839 526
596 3300050515 nmdc:mga0a205_1777_c1 nmdc:mga0a205_1777_c1_9224_10858 526
597 3300053077 Ga0495601_0003196 Ga0495601_0003196_366_2045 526
598 iso_pu_bacteria 2738543032 2739356750 526
599 3300005536 Ga0070697_100036116 Ga0070697_1000361161 527
600 3300025939 Ga0207665_10024622 Ga0207665_100246222 527
601 3300005434 Ga0070709_10050905 Ga0070709_100509052 528
602 3300005841 Ga0068863_100007676 Ga0068863_1000076767 528
603 3300005842 Ga0068858_100068455 Ga0068858_1000684553 528
604 3300006358 Ga0068871_100023496 Ga0068871_1000234964 528
605 3300006871 Ga0075434_100007292 Ga0075434_1000072928 528
606 3300014969 Ga0157376_10000005 Ga0157376_1000000598 528
607 3300025939 Ga0207665_10020602 Ga0207665_100206024 528
608 3300026088 Ga0207641_10008320 Ga0207641_100083204 528
609 3300028381 Ga0268264_10112011 Ga0268264_101120112 528
610 3300046472 Ga0495580_0003222 Ga0495580_0003222_9908_11542 528
611 3300048918 Ga0496115_0001061 Ga0496115_0001061_2463_4157 528
612 3300050512 nmdc:mga0n895_60541_c1 nmdc:mga0n895_60541_c1_373_2067 528
613 3300050515 nmdc:mga0a205_73990_c1 nmdc:mga0a205_73990_c1_199_1830 528
614 3300005536 Ga0070697_100033366 Ga0070697_1000333662 529
615 3300005548 Ga0070665_100001198 Ga0070665_1000011988 529
616 3300005937 Ga0081455_10000777 Ga0081455_1000077732 529
617 3300005981 Ga0081538_10014573 Ga0081538_100145734 529
618 3300007076 Ga0075435_100097171 Ga0075435_1000971712 529
619 3300009101 Ga0105247_10044304 Ga0105247_100443042 529
620 3300009147 Ga0114129_10009458 Ga0114129_100094585 529
621 3300009545 Ga0105237_10160182 Ga0105237_101601822 529
622 3300013308 Ga0157375_10151509 Ga0157375_101515092 529
623 3300028379 Ga0268266_10000661 Ga0268266_1000066117 529
624 3300028381 Ga0268264_10035546 Ga0268264_100355464 529
625 3300046472 Ga0495580_0001149 Ga0495580_0001149_15489_17186 529
626 3300046473 Ga0495582_0009311 Ga0495582_0009311_1440_3137 529
627 3300050507 nmdc:mga05p37_2525_c1 nmdc:mga05p37_2525_c1_4285_5925 529
628 3300050512 nmdc:mga0n895_41796_c1 nmdc:mga0n895_41796_c1_315_2012 529
629 3300050513 nmdc:mga0rr50_45870_c1 nmdc:mga0rr50_45870_c1_412_2109 529
630 3300005518 Ga0070699_100029983 Ga0070699_1000299832 530
631 3300005289 Ga0065704_10011117 Ga0065704_100111172 531
632 3300005290 Ga0065712_10068711 Ga0065712_100687112 531
633 3300005293 Ga0065715_10116775 Ga0065715_101167752 531
634 3300005295 Ga0065707_10102087 Ga0065707_101020872 531
635 3300005335 Ga0070666_10006111 Ga0070666_100061112 531
636 3300005336 Ga0070680_100056287 Ga0070680_1000562874 531
637 3300005339 Ga0070660_100007349 Ga0070660_1000073494 531
638 3300005341 Ga0070691_10056091 Ga0070691_100560911 531
639 3300005344 Ga0070661_100012735 Ga0070661_1000127354 531
640 3300005353 Ga0070669_100011901 Ga0070669_1000119014 531
641 3300005354 Ga0070675_100068417 Ga0070675_1000684173 531
642 3300005355 Ga0070671_100009092 Ga0070671_1000090922 531
643 3300005355 Ga0070671_100030645 Ga0070671_1000306452 531
644 3300005364 Ga0070673_100051111 Ga0070673_1000511112 531
645 3300005366 Ga0070659_100024406 Ga0070659_1000244064 531
646 3300005456 Ga0070678_100019606 Ga0070678_1000196063 531
647 3300005457 Ga0070662_100011219 Ga0070662_1000112195 531
648 3300005457 Ga0070662_100063297 Ga0070662_1000632972 531
649 3300005458 Ga0070681_10013899 Ga0070681_100138998 531
650 3300005471 Ga0070698_100142906 Ga0070698_1001429062 531
651 3300005530 Ga0070679_100013022 Ga0070679_1000130225 531
652 3300005536 Ga0070697_100103873 Ga0070697_1001038731 531
653 3300005564 Ga0070664_100000830 Ga0070664_10000083013 531
654 3300005617 Ga0068859_100171430 Ga0068859_1001714302 531
655 3300005843 Ga0068860_100045562 Ga0068860_1000455622 531
656 3300006058 Ga0075432_10005885 Ga0075432_100058852 531
657 3300006844 Ga0075428_100045517 Ga0075428_1000455176 531
658 3300006846 Ga0075430_100038743 Ga0075430_1000387433 531
659 3300006847 Ga0075431_100148741 Ga0075431_1001487412 531
660 3300006852 Ga0075433_10072540 Ga0075433_100725403 531
661 3300006852 Ga0075433_10082392 Ga0075433_100823922 531
662 3300006880 Ga0075429_100052768 Ga0075429_1000527682 531
663 3300006914 Ga0075436_100036828 Ga0075436_1000368283 531
664 3300006931 Ga0097620_100171420 Ga0097620_1001714202 531
665 3300007076 Ga0075435_100037178 Ga0075435_1000371783 531
666 3300009094 Ga0111539_10032522 Ga0111539_100325223 531
667 3300013100 Ga0157373_10092562 Ga0157373_100925622 531
668 3300013296 Ga0157374_10120964 Ga0157374_101209642 531
669 3300013297 Ga0157378_10007804 Ga0157378_100078044 531
670 3300013306 Ga0163162_10149096 Ga0163162_101490963 531
671 3300025315 Ga0207697_10023558 Ga0207697_100235582 531
672 3300025907 Ga0207645_10001511 Ga0207645_1000151116 531
673 3300025912 Ga0207707_10031062 Ga0207707_100310622 531
674 3300025912 Ga0207707_10096586 Ga0207707_100965863 531
675 3300025917 Ga0207660_10041799 Ga0207660_100417992 531
676 3300025919 Ga0207657_10007180 Ga0207657_100071803 531
677 3300025921 Ga0207652_10003474 Ga0207652_100034744 531
678 3300025923 Ga0207681_10014504 Ga0207681_100145043 531
679 3300025925 Ga0207650_10001148 Ga0207650_100011484 531
680 3300025931 Ga0207644_10025878 Ga0207644_100258782 531
681 3300025932 Ga0207690_10009340 Ga0207690_100093405 531
682 3300025933 Ga0207706_10024322 Ga0207706_100243223 531
683 3300025933 Ga0207706_10078919 Ga0207706_100789192 531
684 3300025940 Ga0207691_10022008 Ga0207691_100220083 531
685 3300025945 Ga0207679_10000457 Ga0207679_100004579 531
686 3300025949 Ga0207667_10087272 Ga0207667_100872722 531
687 3300027682 Ga0209971_1009224 Ga0209971_10092242 531
688 3300027876 Ga0209974_10002919 Ga0209974_100029195 531
689 3300031241 Ga0265325_10003991 Ga0265325_100039916 531
690 3300031249 Ga0265339_10031676 Ga0265339_100316762 531
691 3300037068 Ga0373925_0024619 Ga0373925_0024619_1054_2697 531
692 3300042876 Ga0451577_0118145 Ga0451577_0118145_455_2101 531
693 3300049572 Ga0501036_0019842 Ga0501036_0019842_1720_3363 531
694 3300049573 Ga0501037_0039371 Ga0501037_0039371_663_2306 531
695 3300049574 Ga0501038_0004670 Ga0501038_0004670_5237_6880 531
696 3300049575 Ga0501039_0000444 Ga0501039_0000444_9247_10890 531
697 3300049576 Ga0501040_0002905 Ga0501040_0002905_2834_4477 531
698 3300049577 Ga0501041_0003652 Ga0501041_0003652_1277_2920 531
699 3300049578 Ga0501042_0000113 Ga0501042_0000113_17986_19629 531
700 3300049580 Ga0501046_0003595 Ga0501046_0003595_4042_5751 531
701 3300049584 Ga0501068_0001152 Ga0501068_0001152_5488_7131 531
702 3300049587 Ga0501071_0004316 Ga0501071_0004316_4904_6547 531
703 3300049588 Ga0501072_0001120 Ga0501072_0001120_8996_10639 531
704 3300049591 Ga0501075_0001035 Ga0501075_0001035_6911_8554 531
705 3300049592 Ga0501076_0001002 Ga0501076_0001002_9295_10938 531
706 3300049741 Ga0501079_0002646 Ga0501079_0002646_1405_3048 531
707 3300049742 Ga0501080_0009479 Ga0501080_0009479_1197_2840 531
708 3300049743 Ga0501081_0000575 Ga0501081_0000575_9930_11573 531
709 3300050508 nmdc:mga09592_82961_c1 nmdc:mga09592_82961_c1_505_2148 531
710 3300050510 nmdc:mga06r32_77178_c1 nmdc:mga06r32_77178_c1_1422_3062 531
711 3300050512 nmdc:mga0n895_36604_c1 nmdc:mga0n895_36604_c1_2248_3894 531
712 3300050515 nmdc:mga0a205_43485_c1 nmdc:mga0a205_43485_c1_2182_3828 531
713 3300054114 Ga0501084_0004456 Ga0501084_0004456_2482_4125 531
714 3300061734 Ga0530510_0015151 Ga0530510_0015151_1344_2987 531

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00115

COX1

Cytochrome C and Quinol oxidase polypeptide I

42

484

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3abk-assembly1.cif.gz_A bovine heart cytochrome c oxidase at the no-bound fully reduced state (50k) 0.9093 19 509
3omi-assembly2.cif.gz_C catalytic core subunits (i and ii) of cytochrome c oxidase from rhodobacter sphaeroides with d132a mutation 0.9092 22 498
1m57-assembly2.cif.gz_G structure of cytochrome c oxidase from rhodobacter sphaeroides (eq(i-286) mutant)) 0.9081 17 507
8c8q-assembly1.cif.gz_A cytochrome c oxidase from schizosaccharomyces pombe 0.9079 19 510
6pw1-assembly2.cif.gz_C cytochrome c oxidase delta 16 0.9053 21 498
ID Description Score Start End Superfamily
af_Q7HP04_41_512_1.20.210.10 Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain 0.9007 20 464 1.20.210.10
af_Q2FZK0_30_556_1.20.210.10 Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain 0.8989 20 509 1.20.210.10
2yevD01 Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain 0.8884 20 514 1.20.210.10
af_P9WP71_20_544_1.20.210.10 Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain 0.8849 16 516 1.20.210.10
af_O21042_10_509_1.20.210.10 Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain 0.8775 21 471 1.20.210.10
ID Description Score Start End GO Terms
AF-A0A351NZH6-F1-model_v4 Cytochrome o ubiquinol oxidase subunit I 0.961 217 354 GO:0004129
GO:0005886
GO:0009060
GO:0009486
GO:0015990
GO:0020037
GO:0022904
AF-A0A3D2M157-F1-model_v4 Cytochrome c oxidase subunit I 0.9531 243 508 GO:0004129
GO:0009060
GO:0015990
GO:0016020
GO:0020037
GO:0022904
AF-F2YID4-F1-model_v4 Cytochrome c oxidase subunit 1 (EC 7.1.1.9) 0.9531 217 426 GO:0004129
GO:0005743
GO:0006123
GO:0015990
GO:0020037
GO:0046872
AF-A0A422QD25-F1-model_v4 Cytochrome oxidase subunit I 0.9514 236 425 GO:0004129
GO:0009060
GO:0015990
GO:0016020
GO:0020037
GO:0022904
AF-M4M3I1-F1-model_v4 Cytochrome c oxidase subunit 1 (EC 7.1.1.9) 0.9512 220 426 GO:0004129
GO:0005743
GO:0006123
GO:0015990
GO:0020037
GO:0046872

Feature Viewer

pLDDT pTM Quality
82.52 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map