F476929
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 714 | 314 | 703 | 541 |
Family's Representative Sequence
| Representative Sequence | 3300005548|Ga0070665_100001198|Ga0070665_1000011988 |
| Length | 565 |
| Sequence | MSSTQQPPLSPQPVAEQQLPKEHYLNATYGIRSWLLTTDHKRIAILYLISVTFFFFVGGIFASLIRIHLLTPGGYLVTPETYNKLFTMHGVAMIFFFLIPSIPAVLGNFLIPIMVGAKDLAFPKINLLSWYIYLVGGAFVLYSFATGGLDTGWTFYTPLSSIYSNSAVTPAVIGIFINGFSSILTGLNFIITVHTMRAPGMTWFRLPLFVWAHYATSIIFILGTPVIAITLLLAGLERMFHMGFFNPAYGGDPILFQHLFWFYSHPAVYIMILPAMGVISEIIPTFARKPIFGYDFIAASSIGIAVIGFIVWAHHMFLTGQSTYSALAFSFLTFLVAVPSAVKVFNWTATLYKGSISFDTPMLYGLGFIGLFTIGGLTGLFLACLGLDIHLHDTYFVVAHFHYIMVGGAIMGYLGGIHFWWPKITGRLYPEYLARIAAITLFVGFNLTFFPQFILGYLGMPRRYHNYPPEYQVLNVMSTAGASILALGYLLPMIYLTWSMRYGKVAGKNPWPSTGLEWTTDSPPLTENFRETPVVDWEPYDFMHRPELGLLGATSKKPVPAHGDD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2595698237 | Methylobacterium sp. UNCCL125 | Isolate | Unclassified |
| 2 | 2738543032 | Methylobacterium sp. GV104 | Isolate | Unclassified |
| 3 | 2889306138 | Methylobacterium sp. PvR107 | Isolate | Rhizosphere |
| 4 | 2902330777 | Methylobacterium sp. 2A | Isolate | Unclassified |
| 5 | 2902405164 | Methylobacterium sp. P1-11 | Isolate | Unclassified |
| 6 | 2928125067 | Methylobacterium sp. 1973 | Isolate | Unclassified |
| 7 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 8 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 9 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 10 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 11 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 13 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 67 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 68 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 69 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 72 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 73 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 75 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 78 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 80 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 81 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 82 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 83 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 84 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 85 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 86 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 87 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 88 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 90 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 91 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 111 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 114 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 115 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 170 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 173 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 174 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 175 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 176 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 177 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 178 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 179 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 180 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 181 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 182 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 183 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 184 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 185 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 186 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 187 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 188 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 189 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 190 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 191 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 192 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 193 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 194 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 195 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 196 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 197 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 198 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 199 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 200 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 201 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 202 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 203 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 204 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 205 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 206 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 207 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 208 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 209 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 210 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 262 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 263 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 264 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 265 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 266 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 267 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 268 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 269 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 270 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 271 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 272 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 273 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 274 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 275 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 276 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 277 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 297 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 308 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 309 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 310 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 311 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 314 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.18 |
| Metatranscriptomes | 0.28 |
| Isolates | 1.54 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.84 |
| Nodule | 0 |
| Rhizoplane | 4.06 |
| Rhizosphere | 93.56 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.54 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065704_10011117 | 3300005289 | Bacteria | 2915 |
| 2 | Ga0065712_10006770 | 3300005290 | Bacteria | 4410 |
| 3 | Ga0065712_10068711 | 3300005290 | Bacteria | 9257 |
| 4 | Ga0065712_10068753 | 3300005290 | Bacteria | 9147 |
| 5 | Ga0065715_10013849 | 3300005293 | Bacteria | 3551 |
| 6 | Ga0065715_10116775 | 3300005293 | Bacteria | 2365 |
| 7 | Ga0065707_10102087 | 3300005295 | Bacteria | 2824 |
| 8 | Ga0070658_10000010 | 3300005327 | Bacteria | 297212 |
| 9 | Ga0070658_10001372 | 3300005327 | Bacteria | 20819 |
| 10 | Ga0070658_10027582 | 3300005327 | Bacteria | 4555 |
| 11 | Ga0070658_10043442 | 3300005327 | Bacteria | 3630 |
| 12 | Ga0070683_100003814 | 3300005329 | Bacteria | 12319 |
| 13 | Ga0070683_100004771 | 3300005329 | Bacteria | 11224 |
| 14 | Ga0070683_100005644 | 3300005329 | Bacteria | 10456 |
| 15 | Ga0070683_100125910 | 3300005329 | Bacteria | 2422 |
| 16 | Ga0070690_100011506 | 3300005330 | Bacteria | 5176 |
| 17 | Ga0070690_100035999 | 3300005330 | Bacteria | 3109 |
| 18 | Ga0070670_100010077 | 3300005331 | Bacteria | 8065 |
| 19 | Ga0068869_100012085 | 3300005334 | Bacteria | 5692 |
| 20 | Ga0070666_10006111 | 3300005335 | Bacteria | 7400 |
| 21 | Ga0070680_100026993 | 3300005336 | Bacteria | 4597 |
| 22 | Ga0070680_100056287 | 3300005336 | Bacteria | 3214 |
| 23 | Ga0070680_100057450 | 3300005336 | Bacteria | 3181 |
| 24 | Ga0070680_100071646 | 3300005336 | Bacteria | 2848 |
| 25 | Ga0070680_100116134 | 3300005336 | Bacteria | 2230 |
| 26 | Ga0070682_100026421 | 3300005337 | Bacteria | 3474 |
| 27 | Ga0070682_100086289 | 3300005337 | Bacteria | 2044 |
| 28 | Ga0068868_100001688 | 3300005338 | Bacteria | 15102 |
| 29 | Ga0070660_100000773 | 3300005339 | Bacteria | 21239 |
| 30 | Ga0070660_100005907 | 3300005339 | Bacteria | 8468 |
| 31 | Ga0070660_100007349 | 3300005339 | Bacteria | 7674 |
| 32 | Ga0070660_100015514 | 3300005339 | Bacteria | 5504 |
| 33 | Ga0070660_100020550 | 3300005339 | Bacteria | 4854 |
| 34 | Ga0070660_100036539 | 3300005339 | Bacteria | 3721 |
| 35 | Ga0070691_10056091 | 3300005341 | Bacteria | 1888 |
| 36 | Ga0070661_100002233 | 3300005344 | Bacteria | 13282 |
| 37 | Ga0070661_100003160 | 3300005344 | Bacteria | 11338 |
| 38 | Ga0070661_100007607 | 3300005344 | Bacteria | 7474 |
| 39 | Ga0070661_100012735 | 3300005344 | Bacteria | 5887 |
| 40 | Ga0070661_100034547 | 3300005344 | Bacteria | 3667 |
| 41 | Ga0070661_100037933 | 3300005344 | Bacteria | 3507 |
| 42 | Ga0070669_100011901 | 3300005353 | Bacteria | 6174 |
| 43 | Ga0070675_100068417 | 3300005354 | Bacteria | 2940 |
| 44 | Ga0070675_100082354 | 3300005354 | Bacteria | 2685 |
| 45 | Ga0070671_100009092 | 3300005355 | Bacteria | 7974 |
| 46 | Ga0070671_100030645 | 3300005355 | Bacteria | 4439 |
| 47 | Ga0070671_100049345 | 3300005355 | Bacteria | 3502 |
| 48 | Ga0070671_100051197 | 3300005355 | Bacteria | 3434 |
| 49 | Ga0070671_100056861 | 3300005355 | Bacteria | 3255 |
| 50 | Ga0070673_100001367 | 3300005364 | Bacteria | 14268 |
| 51 | Ga0070673_100051111 | 3300005364 | Bacteria | 3235 |
| 52 | Ga0070673_100073115 | 3300005364 | Bacteria | 2759 |
| 53 | Ga0070673_100129845 | 3300005364 | Bacteria | 2113 |
| 54 | Ga0070659_100001713 | 3300005366 | Bacteria | 15774 |
| 55 | Ga0070659_100024406 | 3300005366 | Bacteria | 4635 |
| 56 | Ga0070703_10006223 | 3300005406 | Bacteria | 3341 |
| 57 | Ga0070709_10023151 | 3300005434 | Bacteria | 3644 |
| 58 | Ga0070709_10050905 | 3300005434 | Bacteria | 2597 |
| 59 | Ga0070714_100009936 | 3300005435 | Bacteria | 7505 |
| 60 | Ga0070714_100012212 | 3300005435 | Bacteria | 6849 |
| 61 | Ga0070714_100015355 | 3300005435 | Bacteria | 6162 |
| 62 | Ga0070714_100082797 | 3300005435 | Bacteria | 2796 |
| 63 | Ga0070714_100117168 | 3300005435 | Bacteria | 2365 |
| 64 | Ga0070713_100000907 | 3300005436 | Bacteria | 18932 |
| 65 | Ga0070713_100004207 | 3300005436 | Bacteria | 9609 |
| 66 | Ga0070713_100010519 | 3300005436 | Bacteria | 6686 |
| 67 | Ga0070710_10009681 | 3300005437 | Bacteria | 4721 |
| 68 | Ga0070711_100003054 | 3300005439 | Bacteria | 9671 |
| 69 | Ga0070711_100004233 | 3300005439 | Bacteria | 8435 |
| 70 | Ga0070711_100014844 | 3300005439 | Bacteria | 4919 |
| 71 | Ga0070694_100002730 | 3300005444 | Bacteria | 10471 |
| 72 | Ga0070708_100011685 | 3300005445 | Bacteria | 7146 |
| 73 | Ga0070708_100088845 | 3300005445 | Bacteria | 2811 |
| 74 | Ga0070678_100019606 | 3300005456 | Bacteria | 4416 |
| 75 | Ga0070662_100011219 | 3300005457 | Bacteria | 5905 |
| 76 | Ga0070662_100012468 | 3300005457 | Bacteria | 5638 |
| 77 | Ga0070662_100063297 | 3300005457 | Bacteria | 2705 |
| 78 | Ga0070681_10000247 | 3300005458 | Bacteria | 42975 |
| 79 | Ga0070681_10000261 | 3300005458 | Bacteria | 42065 |
| 80 | Ga0070681_10001144 | 3300005458 | Bacteria | 22852 |
| 81 | Ga0070681_10002214 | 3300005458 | Bacteria | 17729 |
| 82 | Ga0070681_10003473 | 3300005458 | Bacteria | 14764 |
| 83 | Ga0070681_10010707 | 3300005458 | Bacteria | 9062 |
| 84 | Ga0070681_10013899 | 3300005458 | Bacteria | 8011 |
| 85 | Ga0070681_10074665 | 3300005458 | Bacteria | 3351 |
| 86 | Ga0070681_10079886 | 3300005458 | Bacteria | 3227 |
| 87 | Ga0068867_100003528 | 3300005459 | Bacteria | 11000 |
| 88 | Ga0070706_100038332 | 3300005467 | Bacteria | 4423 |
| 89 | Ga0070706_100110895 | 3300005467 | Bacteria | 2553 |
| 90 | Ga0070698_100000236 | 3300005471 | Bacteria | 54837 |
| 91 | Ga0070698_100142906 | 3300005471 | Bacteria | 2344 |
| 92 | Ga0070699_100029983 | 3300005518 | Bacteria | 4693 |
| 93 | Ga0070699_100069043 | 3300005518 | Bacteria | 3070 |
| 94 | Ga0070679_100000327 | 3300005530 | Bacteria | 40290 |
| 95 | Ga0070679_100003583 | 3300005530 | Bacteria | 14209 |
| 96 | Ga0070679_100008438 | 3300005530 | Bacteria | 9699 |
| 97 | Ga0070679_100010134 | 3300005530 | Bacteria | 8936 |
| 98 | Ga0070679_100013022 | 3300005530 | Bacteria | 7964 |
| 99 | Ga0070679_100034853 | 3300005530 | Bacteria | 4991 |
| 100 | Ga0070679_100040488 | 3300005530 | Bacteria | 4635 |
| 101 | Ga0070679_100052872 | 3300005530 | Bacteria | 4044 |
| 102 | Ga0070679_100069664 | 3300005530 | Bacteria | 3508 |
| 103 | Ga0070679_100081316 | 3300005530 | Bacteria | 3229 |
| 104 | Ga0070684_100015869 | 3300005535 | Bacteria | 6147 |
| 105 | Ga0070684_100016031 | 3300005535 | Bacteria | 6120 |
| 106 | Ga0070684_100036790 | 3300005535 | Unclassified | 4195 |
| 107 | Ga0070684_100043366 | 3300005535 | Bacteria | 3884 |
| 108 | Ga0070684_100117771 | 3300005535 | Bacteria | 2387 |
| 109 | Ga0070697_100001253 | 3300005536 | Bacteria | 19201 |
| 110 | Ga0070697_100033366 | 3300005536 | Bacteria | 4146 |
| 111 | Ga0070697_100036116 | 3300005536 | Bacteria | 3991 |
| 112 | Ga0070697_100103873 | 3300005536 | Bacteria | 2362 |
| 113 | Ga0068853_100022380 | 3300005539 | Bacteria | 5278 |
| 114 | Ga0068853_100027796 | 3300005539 | Unclassified | 4755 |
| 115 | Ga0070672_100019537 | 3300005543 | Bacteria | 4919 |
| 116 | Ga0070672_100150838 | 3300005543 | Bacteria | 1923 |
| 117 | Ga0070686_100002740 | 3300005544 | Bacteria | 9697 |
| 118 | Ga0070695_100001059 | 3300005545 | Bacteria | 15017 |
| 119 | Ga0070695_100011378 | 3300005545 | Bacteria | 5323 |
| 120 | Ga0070695_100034537 | 3300005545 | Bacteria | 3171 |
| 121 | Ga0070696_100013455 | 3300005546 | Bacteria | 5490 |
| 122 | Ga0070696_100054662 | 3300005546 | Bacteria | 2783 |
| 123 | Ga0070693_100000102 | 3300005547 | Bacteria | 37722 |
| 124 | Ga0070693_100027720 | 3300005547 | Bacteria | 3073 |
| 125 | Ga0070665_100001198 | 3300005548 | Bacteria | 31613 |
| 126 | Ga0070665_100002180 | 3300005548 | Bacteria | 21833 |
| 127 | Ga0070704_100001455 | 3300005549 | Bacteria | 12695 |
| 128 | Ga0070704_100036561 | 3300005549 | Bacteria | 3348 |
| 129 | Ga0068855_100000561 | 3300005563 | Bacteria | 45527 |
| 130 | Ga0068855_100002571 | 3300005563 | Bacteria | 22364 |
| 131 | Ga0068855_100012592 | 3300005563 | Bacteria | 10207 |
| 132 | Ga0068855_100032252 | 3300005563 | Bacteria | 6255 |
| 133 | Ga0068855_100035466 | 3300005563 | Bacteria | 5941 |
| 134 | Ga0068855_100035591 | 3300005563 | Bacteria | 5930 |
| 135 | Ga0068855_100039129 | 3300005563 | Bacteria | 5629 |
| 136 | Ga0068855_100065797 | 3300005563 | Bacteria | 4226 |
| 137 | Ga0070664_100000830 | 3300005564 | Bacteria | 23813 |
| 138 | Ga0070664_100003501 | 3300005564 | Bacteria | 12681 |
| 139 | Ga0070664_100003647 | 3300005564 | Bacteria | 12398 |
| 140 | Ga0068857_100000419 | 3300005577 | Bacteria | 30014 |
| 141 | Ga0068857_100005498 | 3300005577 | Bacteria | 10804 |
| 142 | Ga0068857_100008356 | 3300005577 | Bacteria | 8942 |
| 143 | Ga0068857_100032487 | 3300005577 | Bacteria | 4615 |
| 144 | Ga0068857_100040676 | 3300005577 | Bacteria | 4123 |
| 145 | Ga0068857_100048315 | 3300005577 | Bacteria | 3778 |
| 146 | Ga0068854_100038957 | 3300005578 | Bacteria | 3345 |
| 147 | Ga0068856_100000394 | 3300005614 | Bacteria | 47803 |
| 148 | Ga0068856_100001696 | 3300005614 | Bacteria | 23049 |
| 149 | Ga0068856_100002047 | 3300005614 | Bacteria | 20923 |
| 150 | Ga0068856_100002997 | 3300005614 | Bacteria | 17285 |
| 151 | Ga0068856_100005834 | 3300005614 | Bacteria | 12137 |
| 152 | Ga0068856_100009823 | 3300005614 | Bacteria | 9293 |
| 153 | Ga0068856_100023859 | 3300005614 | Bacteria | 5950 |
| 154 | Ga0068852_100004628 | 3300005616 | Bacteria | 9751 |
| 155 | Ga0068852_100004778 | 3300005616 | Bacteria | 9623 |
| 156 | Ga0068852_100004781 | 3300005616 | Bacteria | 9620 |
| 157 | Ga0068852_100006343 | 3300005616 | Bacteria | 8535 |
| 158 | Ga0068859_100000290 | 3300005617 | Bacteria | 49956 |
| 159 | Ga0068859_100171430 | 3300005617 | Bacteria | 2251 |
| 160 | Ga0068864_100001429 | 3300005618 | Bacteria | 19704 |
| 161 | Ga0068866_10001078 | 3300005718 | Bacteria | 12038 |
| 162 | Ga0068851_10004716 | 3300005834 | Bacteria | 6169 |
| 163 | Ga0068863_100007676 | 3300005841 | Bacteria | 10552 |
| 164 | Ga0068858_100002722 | 3300005842 | Bacteria | 17810 |
| 165 | Ga0068858_100042641 | 3300005842 | Unclassified | 4207 |
| 166 | Ga0068858_100068455 | 3300005842 | Bacteria | 3290 |
| 167 | Ga0068860_100003559 | 3300005843 | Bacteria | 16019 |
| 168 | Ga0068860_100045562 | 3300005843 | Bacteria | 4183 |
| 169 | Ga0081455_10000777 | 3300005937 | Bacteria | 41065 |
| 170 | Ga0081455_10013832 | 3300005937 | Bacteria | 7940 |
| 171 | Ga0081538_10003485 | 3300005981 | Bacteria | 14849 |
| 172 | Ga0081538_10014573 | 3300005981 | Bacteria | 6147 |
| 173 | Ga0070717_10051695 | 3300006028 | Bacteria | 3383 |
| 174 | Ga0070717_10141495 | 3300006028 | Bacteria | 2075 |
| 175 | Ga0075432_10005885 | 3300006058 | Bacteria | 4172 |
| 176 | Ga0070716_100000297 | 3300006173 | Bacteria | 20076 |
| 177 | Ga0070716_100005379 | 3300006173 | Bacteria | 6196 |
| 178 | Ga0070716_100057929 | 3300006173 | Bacteria | 2228 |
| 179 | Ga0070712_100016363 | 3300006175 | Bacteria | 4789 |
| 180 | Ga0070712_100036163 | 3300006175 | Bacteria | 3358 |
| 181 | Ga0075367_10008309 | 3300006178 | Bacteria | 5376 |
| 182 | Ga0097621_100001063 | 3300006237 | Bacteria | 19228 |
| 183 | Ga0097621_100004160 | 3300006237 | Bacteria | 10035 |
| 184 | Ga0068871_100001936 | 3300006358 | Bacteria | 14019 |
| 185 | Ga0068871_100023496 | 3300006358 | Bacteria | 4771 |
| 186 | Ga0068871_100029931 | 3300006358 | Bacteria | 4282 |
| 187 | Ga0075428_100004241 | 3300006844 | Bacteria | 15786 |
| 188 | Ga0075428_100028228 | 3300006844 | Bacteria | 6206 |
| 189 | Ga0075428_100045517 | 3300006844 | Bacteria | 4821 |
| 190 | Ga0075430_100003080 | 3300006846 | Bacteria | 13926 |
| 191 | Ga0075430_100029707 | 3300006846 | Bacteria | 4639 |
| 192 | Ga0075430_100035481 | 3300006846 | Bacteria | 4231 |
| 193 | Ga0075430_100038743 | 3300006846 | Bacteria | 4036 |
| 194 | Ga0075431_100023037 | 3300006847 | Bacteria | 6366 |
| 195 | Ga0075431_100029475 | 3300006847 | Bacteria | 5650 |
| 196 | Ga0075431_100070167 | 3300006847 | Bacteria | 3615 |
| 197 | Ga0075431_100091553 | 3300006847 | Bacteria | 3139 |
| 198 | Ga0075431_100148741 | 3300006847 | Bacteria | 2412 |
| 199 | Ga0075433_10003978 | 3300006852 | Bacteria | 11436 |
| 200 | Ga0075433_10004780 | 3300006852 | Bacteria | 10569 |
| 201 | Ga0075433_10072540 | 3300006852 | Bacteria | 3027 |
| 202 | Ga0075433_10082392 | 3300006852 | Bacteria | 2837 |
| 203 | Ga0075434_100001703 | 3300006871 | Bacteria | 18823 |
| 204 | Ga0075434_100007024 | 3300006871 | Bacteria | 10385 |
| 205 | Ga0075434_100007292 | 3300006871 | Bacteria | 10231 |
| 206 | Ga0075429_100031657 | 3300006880 | Bacteria | 4597 |
| 207 | Ga0075429_100052768 | 3300006880 | Bacteria | 3538 |
| 208 | Ga0068865_100082825 | 3300006881 | Bacteria | 2307 |
| 209 | Ga0075436_100036828 | 3300006914 | Bacteria | 3378 |
| 210 | Ga0097620_100000290 | 3300006931 | Bacteria | 49956 |
| 211 | Ga0097620_100171420 | 3300006931 | Bacteria | 2251 |
| 212 | Ga0075435_100002073 | 3300007076 | Bacteria | 13146 |
| 213 | Ga0075435_100037178 | 3300007076 | Bacteria | 3875 |
| 214 | Ga0075435_100097171 | 3300007076 | Bacteria | 2437 |
| 215 | Ga0099794_10011502 | 3300007265 | Bacteria | 3790 |
| 216 | Ga0099794_10013424 | 3300007265 | Bacteria | 3565 |
| 217 | Ga0099794_10028772 | 3300007265 | Bacteria | 2586 |
| 218 | Ga0105240_10002877 | 3300009093 | Bacteria | 27222 |
| 219 | Ga0105240_10018106 | 3300009093 | Bacteria | 9472 |
| 220 | Ga0105240_10024508 | 3300009093 | Bacteria | 7950 |
| 221 | Ga0105240_10033595 | 3300009093 | Bacteria | 6623 |
| 222 | Ga0105240_10051192 | 3300009093 | Bacteria | 5199 |
| 223 | Ga0105240_10133163 | 3300009093 | Bacteria | 2979 |
| 224 | Ga0105240_10205380 | 3300009093 | Bacteria | 2306 |
| 225 | Ga0105240_10209187 | 3300009093 | Bacteria | 2281 |
| 226 | Ga0111539_10020976 | 3300009094 | Bacteria | 8045 |
| 227 | Ga0111539_10031183 | 3300009094 | Bacteria | 6479 |
| 228 | Ga0111539_10032522 | 3300009094 | Bacteria | 6333 |
| 229 | Ga0111539_10289772 | 3300009094 | Bacteria | 1905 |
| 230 | Ga0105245_10100566 | 3300009098 | Bacteria | 2674 |
| 231 | Ga0105245_10147040 | 3300009098 | Bacteria | 2224 |
| 232 | Ga0105247_10044304 | 3300009101 | Bacteria | 2728 |
| 233 | Ga0114129_10007873 | 3300009147 | Bacteria | 15162 |
| 234 | Ga0114129_10009458 | 3300009147 | Bacteria | 13893 |
| 235 | Ga0114129_10012984 | 3300009147 | Bacteria | 11859 |
| 236 | Ga0114129_10023521 | 3300009147 | Bacteria | 8733 |
| 237 | Ga0114129_10234347 | 3300009147 | Bacteria | 2471 |
| 238 | Ga0105237_10007734 | 3300009545 | Bacteria | 11736 |
| 239 | Ga0105237_10026300 | 3300009545 | Bacteria | 5947 |
| 240 | Ga0105237_10037757 | 3300009545 | Bacteria | 4881 |
| 241 | Ga0105237_10078138 | 3300009545 | Unclassified | 3299 |
| 242 | Ga0105237_10160182 | 3300009545 | Bacteria | 2249 |
| 243 | Ga0105238_10001041 | 3300009551 | Bacteria | 28144 |
| 244 | Ga0105238_10001061 | 3300009551 | Bacteria | 27757 |
| 245 | Ga0105238_10005774 | 3300009551 | Bacteria | 12248 |
| 246 | Ga0105238_10007685 | 3300009551 | Bacteria | 10779 |
| 247 | Ga0105238_10014246 | 3300009551 | Bacteria | 8040 |
| 248 | Ga0105249_10039605 | 3300009553 | Bacteria | 4279 |
| 249 | Ga0105239_10072758 | 3300010375 | Bacteria | 3779 |
| 250 | Ga0157373_10024462 | 3300013100 | Bacteria | 4373 |
| 251 | Ga0157373_10092562 | 3300013100 | Bacteria | 2129 |
| 252 | Ga0157371_10000892 | 3300013102 | Bacteria | 33627 |
| 253 | Ga0157371_10020196 | 3300013102 | Bacteria | 4902 |
| 254 | Ga0157371_10036902 | 3300013102 | Unclassified | 3500 |
| 255 | Ga0157371_10054559 | 3300013102 | Bacteria | 2838 |
| 256 | Ga0157371_10126702 | 3300013102 | Bacteria | 1816 |
| 257 | Ga0157370_10002254 | 3300013104 | Bacteria | 23424 |
| 258 | Ga0157370_10002480 | 3300013104 | Bacteria | 22253 |
| 259 | Ga0157370_10029113 | 3300013104 | Bacteria | 5426 |
| 260 | Ga0157369_10000134 | 3300013105 | Bacteria | 105562 |
| 261 | Ga0157369_10000258 | 3300013105 | Bacteria | 72711 |
| 262 | Ga0157369_10011416 | 3300013105 | Bacteria | 10088 |
| 263 | Ga0157369_10118493 | 3300013105 | Bacteria | 2810 |
| 264 | Ga0157374_10000517 | 3300013296 | Bacteria | 34675 |
| 265 | Ga0157374_10000661 | 3300013296 | Bacteria | 30295 |
| 266 | Ga0157374_10006871 | 3300013296 | Bacteria | 9681 |
| 267 | Ga0157374_10022386 | 3300013296 | Bacteria | 5638 |
| 268 | Ga0157374_10101183 | 3300013296 | Bacteria | 2763 |
| 269 | Ga0157374_10120964 | 3300013296 | Bacteria | 2527 |
| 270 | Ga0157378_10000517 | 3300013297 | Bacteria | 36671 |
| 271 | Ga0157378_10000915 | 3300013297 | Bacteria | 27185 |
| 272 | Ga0157378_10001601 | 3300013297 | Bacteria | 20469 |
| 273 | Ga0157378_10007804 | 3300013297 | Bacteria | 9340 |
| 274 | Ga0157378_10059811 | 3300013297 | Bacteria | 3400 |
| 275 | Ga0163162_10067996 | 3300013306 | Bacteria | 3613 |
| 276 | Ga0163162_10149096 | 3300013306 | Bacteria | 2456 |
| 277 | Ga0157372_10000125 | 3300013307 | Bacteria | 82978 |
| 278 | Ga0157372_10000335 | 3300013307 | Bacteria | 51775 |
| 279 | Ga0157372_10000629 | 3300013307 | Bacteria | 38566 |
| 280 | Ga0157372_10010222 | 3300013307 | Bacteria | 9963 |
| 281 | Ga0157372_10010413 | 3300013307 | Bacteria | 9886 |
| 282 | Ga0157372_10011442 | 3300013307 | Bacteria | 9435 |
| 283 | Ga0157372_10028289 | 3300013307 | Bacteria | 6118 |
| 284 | Ga0157372_10029357 | 3300013307 | Bacteria | 6004 |
| 285 | Ga0157372_10076839 | 3300013307 | Bacteria | 3771 |
| 286 | Ga0157375_10151509 | 3300013308 | Bacteria | 2455 |
| 287 | Ga0157375_10180531 | 3300013308 | Bacteria | 2262 |
| 288 | Ga0163163_10159075 | 3300014325 | Bacteria | 2304 |
| 289 | Ga0182008_10000712 | 3300014497 | Bacteria | 23839 |
| 290 | Ga0182008_10002552 | 3300014497 | Bacteria | 11339 |
| 291 | Ga0157379_10000346 | 3300014968 | Bacteria | 37348 |
| 292 | Ga0157376_10000005 | 3300014969 | Bacteria | 443695 |
| 293 | Ga0157376_10002022 | 3300014969 | Bacteria | 13602 |
| 294 | Ga0157376_10034568 | 3300014969 | Unclassified | 4082 |
| 295 | Ga0157376_10040249 | 3300014969 | Bacteria | 3819 |
| 296 | Ga0182007_10003649 | 3300015262 | Bacteria | 7214 |
| 297 | Ga0228598_1000409 | 3300024227 | Bacteria | 8673 |
| 298 | Ga0207697_10023558 | 3300025315 | Bacteria | 2521 |
| 299 | Ga0207653_10007131 | 3300025885 | Bacteria | 3491 |
| 300 | Ga0207682_10024110 | 3300025893 | Bacteria | 2407 |
| 301 | Ga0207692_10005300 | 3300025898 | Bacteria | 5156 |
| 302 | Ga0207642_10000509 | 3300025899 | Bacteria | 11899 |
| 303 | Ga0207688_10010552 | 3300025901 | Bacteria | 5025 |
| 304 | Ga0207647_10004022 | 3300025904 | Bacteria | 10970 |
| 305 | Ga0207647_10007033 | 3300025904 | Bacteria | 8160 |
| 306 | Ga0207647_10011034 | 3300025904 | Bacteria | 6354 |
| 307 | Ga0207699_10022367 | 3300025906 | Bacteria | 3424 |
| 308 | Ga0207699_10023187 | 3300025906 | Bacteria | 3375 |
| 309 | Ga0207699_10025017 | 3300025906 | Bacteria | 3273 |
| 310 | Ga0207645_10001511 | 3300025907 | Bacteria | 19014 |
| 311 | Ga0207705_10000016 | 3300025909 | Bacteria | 377359 |
| 312 | Ga0207705_10000419 | 3300025909 | Bacteria | 37164 |
| 313 | Ga0207705_10002757 | 3300025909 | Bacteria | 13460 |
| 314 | Ga0207705_10007786 | 3300025909 | Bacteria | 7868 |
| 315 | Ga0207705_10027889 | 3300025909 | Bacteria | 4026 |
| 316 | Ga0207705_10065583 | 3300025909 | Bacteria | 2625 |
| 317 | Ga0207705_10094081 | 3300025909 | Bacteria | 2197 |
| 318 | Ga0207684_10010867 | 3300025910 | Bacteria | 7988 |
| 319 | Ga0207684_10037810 | 3300025910 | Bacteria | 4095 |
| 320 | Ga0207707_10000003 | 3300025912 | Bacteria | 642592 |
| 321 | Ga0207707_10001477 | 3300025912 | Bacteria | 21753 |
| 322 | Ga0207707_10008348 | 3300025912 | Bacteria | 8985 |
| 323 | Ga0207707_10024604 | 3300025912 | Bacteria | 5270 |
| 324 | Ga0207707_10031062 | 3300025912 | Bacteria | 4673 |
| 325 | Ga0207707_10043614 | 3300025912 | Bacteria | 3911 |
| 326 | Ga0207707_10091905 | 3300025912 | Bacteria | 2652 |
| 327 | Ga0207707_10096586 | 3300025912 | Bacteria | 2582 |
| 328 | Ga0207707_10100155 | 3300025912 | Bacteria | 2532 |
| 329 | Ga0207707_10149435 | 3300025912 | Bacteria | 2043 |
| 330 | Ga0207707_10160146 | 3300025912 | Bacteria | 1968 |
| 331 | Ga0207707_10175375 | 3300025912 | Bacteria | 1873 |
| 332 | Ga0207695_10001093 | 3300025913 | Bacteria | 47293 |
| 333 | Ga0207695_10012444 | 3300025913 | Bacteria | 10216 |
| 334 | Ga0207695_10044125 | 3300025913 | Bacteria | 4745 |
| 335 | Ga0207695_10087992 | 3300025913 | Bacteria | 3128 |
| 336 | Ga0207671_10038188 | 3300025914 | Bacteria | 3559 |
| 337 | Ga0207671_10074747 | 3300025914 | Bacteria | 2533 |
| 338 | Ga0207693_10005882 | 3300025915 | Bacteria | 10178 |
| 339 | Ga0207693_10026475 | 3300025915 | Bacteria | 4590 |
| 340 | Ga0207663_10035866 | 3300025916 | Bacteria | 2979 |
| 341 | Ga0207663_10058173 | 3300025916 | Bacteria | 2438 |
| 342 | Ga0207660_10001220 | 3300025917 | Bacteria | 17201 |
| 343 | Ga0207660_10001524 | 3300025917 | Bacteria | 15540 |
| 344 | Ga0207660_10014935 | 3300025917 | Bacteria | 5119 |
| 345 | Ga0207660_10041799 | 3300025917 | Bacteria | 3214 |
| 346 | Ga0207660_10048028 | 3300025917 | Bacteria | 3020 |
| 347 | Ga0207660_10054259 | 3300025917 | Bacteria | 2860 |
| 348 | Ga0207657_10000159 | 3300025919 | Bacteria | 69260 |
| 349 | Ga0207657_10001503 | 3300025919 | Bacteria | 24928 |
| 350 | Ga0207657_10002194 | 3300025919 | Bacteria | 21168 |
| 351 | Ga0207657_10003049 | 3300025919 | Bacteria | 17918 |
| 352 | Ga0207657_10007180 | 3300025919 | Bacteria | 11435 |
| 353 | Ga0207657_10008065 | 3300025919 | Bacteria | 10739 |
| 354 | Ga0207649_10009058 | 3300025920 | Bacteria | 5439 |
| 355 | Ga0207649_10080913 | 3300025920 | Bacteria | 2102 |
| 356 | Ga0207652_10000024 | 3300025921 | Bacteria | 157748 |
| 357 | Ga0207652_10001698 | 3300025921 | Bacteria | 19278 |
| 358 | Ga0207652_10003474 | 3300025921 | Bacteria | 12992 |
| 359 | Ga0207652_10006183 | 3300025921 | Bacteria | 9677 |
| 360 | Ga0207652_10026753 | 3300025921 | Bacteria | 4807 |
| 361 | Ga0207652_10052778 | 3300025921 | Bacteria | 3491 |
| 362 | Ga0207652_10058987 | 3300025921 | Bacteria | 3307 |
| 363 | Ga0207652_10089999 | 3300025921 | Bacteria | 2696 |
| 364 | Ga0207652_10151853 | 3300025921 | Bacteria | 2074 |
| 365 | Ga0207646_10011190 | 3300025922 | Bacteria | 8712 |
| 366 | Ga0207681_10000044 | 3300025923 | Bacteria | 128566 |
| 367 | Ga0207681_10014504 | 3300025923 | Bacteria | 4899 |
| 368 | Ga0207694_10000284 | 3300025924 | Bacteria | 47825 |
| 369 | Ga0207694_10001081 | 3300025924 | Bacteria | 23667 |
| 370 | Ga0207694_10001478 | 3300025924 | Bacteria | 20095 |
| 371 | Ga0207694_10019640 | 3300025924 | Bacteria | 5111 |
| 372 | Ga0207694_10071576 | 3300025924 | Bacteria | 2710 |
| 373 | Ga0207650_10001148 | 3300025925 | Bacteria | 19458 |
| 374 | Ga0207650_10007616 | 3300025925 | Bacteria | 7378 |
| 375 | Ga0207659_10007100 | 3300025926 | Bacteria | 6877 |
| 376 | Ga0207700_10003312 | 3300025928 | Bacteria | 9339 |
| 377 | Ga0207700_10015608 | 3300025928 | Bacteria | 5017 |
| 378 | Ga0207664_10006945 | 3300025929 | Bacteria | 7831 |
| 379 | Ga0207664_10035053 | 3300025929 | Bacteria | 3870 |
| 380 | Ga0207644_10008669 | 3300025931 | Bacteria | 6652 |
| 381 | Ga0207644_10023383 | 3300025931 | Bacteria | 4233 |
| 382 | Ga0207644_10025878 | 3300025931 | Bacteria | 4038 |
| 383 | Ga0207690_10006311 | 3300025932 | Bacteria | 7024 |
| 384 | Ga0207690_10009340 | 3300025932 | Bacteria | 5826 |
| 385 | Ga0207690_10016806 | 3300025932 | Bacteria | 4458 |
| 386 | Ga0207706_10002112 | 3300025933 | Bacteria | 19449 |
| 387 | Ga0207706_10006139 | 3300025933 | Bacteria | 11156 |
| 388 | Ga0207706_10024322 | 3300025933 | Bacteria | 5430 |
| 389 | Ga0207706_10078919 | 3300025933 | Bacteria | 2895 |
| 390 | Ga0207704_10004923 | 3300025938 | Bacteria | 6137 |
| 391 | Ga0207665_10000020 | 3300025939 | Bacteria | 117316 |
| 392 | Ga0207665_10004248 | 3300025939 | Bacteria | 9526 |
| 393 | Ga0207665_10020602 | 3300025939 | Bacteria | 4333 |
| 394 | Ga0207665_10024622 | 3300025939 | Bacteria | 3970 |
| 395 | Ga0207665_10030902 | 3300025939 | Bacteria | 3541 |
| 396 | Ga0207691_10001855 | 3300025940 | Bacteria | 20651 |
| 397 | Ga0207691_10022008 | 3300025940 | Bacteria | 6016 |
| 398 | Ga0207711_10020787 | 3300025941 | Bacteria | 5477 |
| 399 | Ga0207711_10083347 | 3300025941 | Bacteria | 2796 |
| 400 | Ga0207689_10016908 | 3300025942 | Bacteria | 6172 |
| 401 | Ga0207661_10001184 | 3300025944 | Bacteria | 17452 |
| 402 | Ga0207661_10002226 | 3300025944 | Bacteria | 13382 |
| 403 | Ga0207661_10004525 | 3300025944 | Bacteria | 9746 |
| 404 | Ga0207661_10028936 | 3300025944 | Bacteria | 4249 |
| 405 | Ga0207661_10045545 | 3300025944 | Bacteria | 3473 |
| 406 | Ga0207661_10048712 | 3300025944 | Bacteria | 3369 |
| 407 | Ga0207661_10077319 | 3300025944 | Bacteria | 2737 |
| 408 | Ga0207679_10000457 | 3300025945 | Bacteria | 28830 |
| 409 | Ga0207679_10006991 | 3300025945 | Bacteria | 7153 |
| 410 | Ga0207679_10009363 | 3300025945 | Bacteria | 6273 |
| 411 | Ga0207679_10106471 | 3300025945 | Bacteria | 2204 |
| 412 | Ga0207667_10000123 | 3300025949 | Bacteria | 120422 |
| 413 | Ga0207667_10000245 | 3300025949 | Bacteria | 76423 |
| 414 | Ga0207667_10000314 | 3300025949 | Bacteria | 67212 |
| 415 | Ga0207667_10000487 | 3300025949 | Bacteria | 52501 |
| 416 | Ga0207667_10002750 | 3300025949 | Bacteria | 21739 |
| 417 | Ga0207667_10006431 | 3300025949 | Bacteria | 14231 |
| 418 | Ga0207667_10008821 | 3300025949 | Bacteria | 11939 |
| 419 | Ga0207667_10011306 | 3300025949 | Bacteria | 10379 |
| 420 | Ga0207667_10028027 | 3300025949 | Bacteria | 6121 |
| 421 | Ga0207667_10028616 | 3300025949 | Bacteria | 6050 |
| 422 | Ga0207667_10087272 | 3300025949 | Bacteria | 3228 |
| 423 | Ga0207667_10092112 | 3300025949 | Bacteria | 3131 |
| 424 | Ga0207651_10001825 | 3300025960 | Bacteria | 9920 |
| 425 | Ga0207640_10012164 | 3300025981 | Bacteria | 4894 |
| 426 | Ga0207677_10002130 | 3300026023 | Bacteria | 10395 |
| 427 | Ga0207703_10000881 | 3300026035 | Bacteria | 29513 |
| 428 | Ga0207703_10008498 | 3300026035 | Bacteria | 8112 |
| 429 | Ga0207703_10013106 | 3300026035 | Bacteria | 6462 |
| 430 | Ga0207639_10006611 | 3300026041 | Bacteria | 7885 |
| 431 | Ga0207639_10014149 | 3300026041 | Bacteria | 5603 |
| 432 | Ga0207639_10017610 | 3300026041 | Bacteria | 5067 |
| 433 | Ga0207678_10000102 | 3300026067 | Bacteria | 69930 |
| 434 | Ga0207678_10006379 | 3300026067 | Bacteria | 10471 |
| 435 | Ga0207678_10031852 | 3300026067 | Bacteria | 4597 |
| 436 | Ga0207702_10000091 | 3300026078 | Bacteria | 104021 |
| 437 | Ga0207702_10000454 | 3300026078 | Bacteria | 46222 |
| 438 | Ga0207702_10000482 | 3300026078 | Bacteria | 44849 |
| 439 | Ga0207702_10001896 | 3300026078 | Bacteria | 20434 |
| 440 | Ga0207702_10009071 | 3300026078 | Bacteria | 8372 |
| 441 | Ga0207641_10008320 | 3300026088 | Bacteria | 8573 |
| 442 | Ga0207641_10033229 | 3300026088 | Bacteria | 4286 |
| 443 | Ga0207648_10015008 | 3300026089 | Bacteria | 7135 |
| 444 | Ga0207676_10001522 | 3300026095 | Bacteria | 17124 |
| 445 | Ga0207674_10000229 | 3300026116 | Bacteria | 69982 |
| 446 | Ga0207674_10001151 | 3300026116 | Bacteria | 34261 |
| 447 | Ga0207674_10006007 | 3300026116 | Bacteria | 14362 |
| 448 | Ga0207674_10010596 | 3300026116 | Bacteria | 10430 |
| 449 | Ga0207674_10020001 | 3300026116 | Bacteria | 7244 |
| 450 | Ga0207674_10021224 | 3300026116 | Bacteria | 7000 |
| 451 | Ga0207674_10029219 | 3300026116 | Bacteria | 5806 |
| 452 | Ga0207674_10035662 | 3300026116 | Bacteria | 5191 |
| 453 | Ga0207683_10004353 | 3300026121 | Bacteria | 12232 |
| 454 | Ga0207698_10000912 | 3300026142 | Bacteria | 17183 |
| 455 | Ga0207698_10004145 | 3300026142 | Bacteria | 8805 |
| 456 | Ga0207698_10012327 | 3300026142 | Bacteria | 5591 |
| 457 | Ga0207698_10014443 | 3300026142 | Bacteria | 5250 |
| 458 | Ga0207698_10017821 | 3300026142 | Bacteria | 4827 |
| 459 | Ga0207698_10138172 | 3300026142 | Bacteria | 2094 |
| 460 | Ga0209588_1002342 | 3300027671 | Bacteria | 5134 |
| 461 | Ga0209588_1002355 | 3300027671 | Bacteria | 5123 |
| 462 | Ga0209588_1013405 | 3300027671 | Bacteria | 2499 |
| 463 | Ga0209588_1015655 | 3300027671 | Bacteria | 2333 |
| 464 | Ga0209971_1009224 | 3300027682 | Bacteria | 2338 |
| 465 | Ga0209974_10001602 | 3300027876 | Bacteria | 8191 |
| 466 | Ga0209974_10002919 | 3300027876 | Bacteria | 6201 |
| 467 | Ga0265354_1000380 | 3300028016 | Bacteria | 7778 |
| 468 | Ga0268266_10000661 | 3300028379 | Bacteria | 46641 |
| 469 | Ga0268266_10032306 | 3300028379 | Bacteria | 4447 |
| 470 | Ga0268266_10033892 | 3300028379 | Bacteria | 4340 |
| 471 | Ga0268264_10035546 | 3300028381 | Bacteria | 4103 |
| 472 | Ga0268264_10112011 | 3300028381 | Bacteria | 2392 |
| 473 | Ga0265338_10034265 | 3300028800 | Bacteria | 4911 |
| 474 | Ga0265338_10114654 | 3300028800 | Bacteria | 2162 |
| 475 | Ga0265765_1000017 | 3300030879 | Bacteria | 7740 |
| 476 | Ga0265760_10000038 | 3300031090 | Bacteria | 42230 |
| 477 | Ga0265325_10003991 | 3300031241 | Bacteria | 9442 |
| 478 | Ga0265339_10031676 | 3300031249 | Bacteria | 2986 |
| 479 | Ga0265316_10027712 | 3300031344 | Bacteria | 4684 |
| 480 | Ga0307508_10014924 | 3300031616 | Bacteria | 7084 |
| 481 | Ga0265314_10001027 | 3300031711 | Bacteria | 32557 |
| 482 | Ga0373954_0001152 | 3300035118 | Bacteria | 10627 |
| 483 | Ga0373956_0003549 | 3300035119 | Bacteria | 6282 |
| 484 | Ga0373957_0002185 | 3300035120 | Bacteria | 5528 |
| 485 | Ga0373946_0004832 | 3300035171 | Bacteria | 4848 |
| 486 | Ga0373961_0000297 | 3300035241 | Bacteria | 22207 |
| 487 | Ga0373931_0029980 | 3300035691 | Bacteria | 2798 |
| 488 | Ga0373935_0000591 | 3300035692 | Bacteria | 18897 |
| 489 | Ga0373927_0001772 | 3300035695 | Bacteria | 16103 |
| 490 | Ga0373947_0004469 | 3300035725 | Bacteria | 8209 |
| 491 | Ga0373947_0006738 | 3300035725 | Bacteria | 6664 |
| 492 | Ga0373937_0000340 | 3300036401 | Bacteria | 44240 |
| 493 | Ga0373937_0004081 | 3300036401 | Bacteria | 12382 |
| 494 | Ga0373937_0005073 | 3300036401 | Bacteria | 11210 |
| 495 | Ga0373937_0013628 | 3300036401 | Bacteria | 7163 |
| 496 | Ga0373925_0000615 | 3300037068 | Bacteria | 33997 |
| 497 | Ga0373925_0006140 | 3300037068 | Bacteria | 8873 |
| 498 | Ga0373925_0010712 | 3300037068 | Bacteria | 6650 |
| 499 | Ga0373925_0024619 | 3300037068 | Bacteria | 4396 |
| 500 | Ga0373925_0080403 | 3300037068 | Bacteria | 2477 |
| 501 | Ga0395900_0003060 | 3300037418 | Bacteria | 18209 |
| 502 | Ga0395900_0029601 | 3300037418 | Bacteria | 5618 |
| 503 | Ga0395900_0058197 | 3300037418 | Bacteria | 3978 |
| 504 | Ga0395900_0084380 | 3300037418 | Bacteria | 3264 |
| 505 | Ga0395900_0089468 | 3300037418 | Bacteria | 3164 |
| 506 | Ga0395898_0027612 | 3300037466 | Bacteria | 5693 |
| 507 | Ga0395898_0033031 | 3300037466 | Bacteria | 5165 |
| 508 | Ga0395905_0035459 | 3300037471 | Bacteria | 4684 |
| 509 | Ga0436364_0488840 | 3300037853 | Bacteria | 8505 |
| 510 | Ga0395901_0005170 | 3300038443 | Bacteria | 13166 |
| 511 | Ga0395901_0008749 | 3300038443 | Bacteria | 10238 |
| 512 | Ga0395901_0104883 | 3300038443 | Bacteria | 2967 |
| 513 | Ga0395901_0252214 | 3300038443 | Bacteria | 1838 |
| 514 | Ga0436363_0796445 | 3300039450 | Bacteria | 4257 |
| 515 | Ga0436363_1131501 | 3300039450 | Bacteria | 2782 |
| 516 | Ga0439466_0001002 | 3300041411 | Bacteria | 10876 |
| 517 | Ga0439451_000063 | 3300042009 | Bacteria | 19874 |
| 518 | Ga0439452_007992 | 3300042010 | Bacteria | 3203 |
| 519 | Ga0451577_0006065 | 3300042876 | Bacteria | 12155 |
| 520 | Ga0451577_0118145 | 3300042876 | Bacteria | 2375 |
| 521 | Ga0466969_0005643 | 3300044656 | Bacteria | 6656 |
| 522 | Ga0466969_0036131 | 3300044656 | Bacteria | 2497 |
| 523 | Ga0453683_0003521 | 3300044673 | Bacteria | 11508 |
| 524 | Ga0466966_0009419 | 3300044684 | Bacteria | 6468 |
| 525 | Ga0466966_0017112 | 3300044684 | Bacteria | 4796 |
| 526 | Ga0466961_0066625 | 3300044693 | Bacteria | 2287 |
| 527 | Ga0466963_0000208 | 3300044694 | Bacteria | 24989 |
| 528 | Ga0466963_0036753 | 3300044694 | Bacteria | 3194 |
| 529 | Ga0466957_0001777 | 3300044842 | Bacteria | 11344 |
| 530 | Ga0466957_0008613 | 3300044842 | Bacteria | 5804 |
| 531 | Ga0466959_0053660 | 3300045049 | Bacteria | 2946 |
| 532 | Ga0466958_0000543 | 3300045836 | Bacteria | 16041 |
| 533 | Ga0466967_0000567 | 3300045976 | Bacteria | 18158 |
| 534 | Ga0466967_0005247 | 3300045976 | Bacteria | 8932 |
| 535 | Ga0466967_0007210 | 3300045976 | Bacteria | 7989 |
| 536 | Ga0466967_0008683 | 3300045976 | Bacteria | 7476 |
| 537 | Ga0466967_0028238 | 3300045976 | Bacteria | 4681 |
| 538 | Ga0466967_0102638 | 3300045976 | Bacteria | 2616 |
| 539 | Ga0495617_002468 | 3300046452 | Bacteria | 7345 |
| 540 | Ga0495617_002920 | 3300046452 | Bacteria | 6562 |
| 541 | Ga0495592_0057211 | 3300046454 | Bacteria | 2879 |
| 542 | Ga0495591_000005 | 3300046458 | Bacteria | 394092 |
| 543 | Ga0495638_0009240 | 3300046460 | Bacteria | 6930 |
| 544 | Ga0495638_0097773 | 3300046460 | Bacteria | 1760 |
| 545 | Ga0495651_0084876 | 3300046462 | Bacteria | 2385 |
| 546 | Ga0495650_0000775 | 3300046471 | Bacteria | 39396 |
| 547 | Ga0495650_0015684 | 3300046471 | Bacteria | 3875 |
| 548 | Ga0495580_0001149 | 3300046472 | Bacteria | 23327 |
| 549 | Ga0495580_0003222 | 3300046472 | Bacteria | 13965 |
| 550 | Ga0495580_0003395 | 3300046472 | Bacteria | 13601 |
| 551 | Ga0495580_0007152 | 3300046472 | Bacteria | 8988 |
| 552 | Ga0495580_0021725 | 3300046472 | Bacteria | 4733 |
| 553 | Ga0495580_0075523 | 3300046472 | Bacteria | 2351 |
| 554 | Ga0495582_0009311 | 3300046473 | Bacteria | 5416 |
| 555 | Ga0495594_0007810 | 3300046499 | Bacteria | 5501 |
| 556 | Ga0495607_0040736 | 3300046501 | Bacteria | 2763 |
| 557 | Ga0495583_0000167 | 3300046506 | Bacteria | 111792 |
| 558 | Ga0495583_0002626 | 3300046506 | Bacteria | 15020 |
| 559 | Ga0495606_0001672 | 3300046507 | Bacteria | 28707 |
| 560 | Ga0495606_0001998 | 3300046507 | Bacteria | 25132 |
| 561 | Ga0495606_0021698 | 3300046507 | Bacteria | 4698 |
| 562 | Ga0495608_0012838 | 3300046511 | Bacteria | 5813 |
| 563 | Ga0495610_0000174 | 3300046512 | Bacteria | 72225 |
| 564 | Ga0495620_0002598 | 3300046515 | Bacteria | 10441 |
| 565 | Ga0495630_0069437 | 3300046517 | Bacteria | 2650 |
| 566 | Ga0495631_0006358 | 3300046518 | Bacteria | 6110 |
| 567 | Ga0495632_0013955 | 3300046519 | Bacteria | 4562 |
| 568 | Ga0495632_0042616 | 3300046519 | Bacteria | 2273 |
| 569 | Ga0495643_0010066 | 3300046522 | Bacteria | 5831 |
| 570 | Ga0495644_0001132 | 3300046523 | Bacteria | 10933 |
| 571 | Ga0495648_0000487 | 3300046524 | Bacteria | 42675 |
| 572 | Ga0495648_0001882 | 3300046524 | Bacteria | 20063 |
| 573 | Ga0495648_0014622 | 3300046524 | Bacteria | 5735 |
| 574 | Ga0495648_0015301 | 3300046524 | Bacteria | 5577 |
| 575 | Ga0495642_0000004 | 3300046528 | Bacteria | 182675 |
| 576 | Ga0495654_0000463 | 3300046530 | Bacteria | 33919 |
| 577 | Ga0495654_0015457 | 3300046530 | Bacteria | 4051 |
| 578 | Ga0495665_0014551 | 3300046531 | Bacteria | 4243 |
| 579 | Ga0495586_0017915 | 3300046535 | Bacteria | 3767 |
| 580 | Ga0495587_0006021 | 3300046536 | Bacteria | 7906 |
| 581 | Ga0495597_0009786 | 3300046542 | Bacteria | 4718 |
| 582 | Ga0495645_0001271 | 3300046543 | Bacteria | 17186 |
| 583 | Ga0495633_0014064 | 3300046558 | Bacteria | 4196 |
| 584 | Ga0495634_0014457 | 3300046642 | Bacteria | 5690 |
| 585 | Ga0495611_0011105 | 3300046648 | Bacteria | 3815 |
| 586 | Ga0495661_0000354 | 3300046665 | Bacteria | 50084 |
| 587 | Ga0495623_0016226 | 3300046679 | Bacteria | 4810 |
| 588 | Ga0495658_0032729 | 3300046683 | Bacteria | 2841 |
| 589 | Ga0495669_0021164 | 3300046684 | Bacteria | 2820 |
| 590 | Ga0495669_0028301 | 3300046684 | Bacteria | 2454 |
| 591 | Ga0495613_0007406 | 3300046689 | Bacteria | 8180 |
| 592 | Ga0495613_0074590 | 3300046689 | Bacteria | 2470 |
| 593 | Ga0495670_0000057 | 3300046691 | Bacteria | 54709 |
| 594 | Ga0495670_0033432 | 3300046691 | Bacteria | 2559 |
| 595 | Ga0495671_0000241 | 3300046692 | Bacteria | 47262 |
| 596 | Ga0495671_0011524 | 3300046692 | Bacteria | 4858 |
| 597 | Ga0495589_0000739 | 3300046794 | Bacteria | 21063 |
| 598 | Ga0495660_0000606 | 3300046810 | Bacteria | 28260 |
| 599 | Ga0495604_0007016 | 3300047317 | Bacteria | 8930 |
| 600 | Ga0495674_0036665 | 3300047319 | Bacteria | 4412 |
| 601 | Ga0495672_0003677 | 3300047320 | Bacteria | 12958 |
| 602 | Ga0495683_0000253 | 3300047323 | Bacteria | 48373 |
| 603 | Ga0495679_000143 | 3300047446 | Bacteria | 64689 |
| 604 | Ga0495673_0022500 | 3300047469 | Bacteria | 3087 |
| 605 | Ga0495673_0028289 | 3300047469 | Bacteria | 2656 |
| 606 | Ga0495673_0033279 | 3300047469 | Bacteria | 2393 |
| 607 | Ga0495681_0011543 | 3300047470 | Bacteria | 5252 |
| 608 | Ga0495681_0014237 | 3300047470 | Bacteria | 4573 |
| 609 | Ga0495684_0029266 | 3300047471 | Bacteria | 4228 |
| 610 | Ga0495684_0050536 | 3300047471 | Bacteria | 3174 |
| 611 | Ga0495684_0056252 | 3300047471 | Bacteria | 2999 |
| 612 | Ga0495686_0045680 | 3300047472 | Bacteria | 2770 |
| 613 | Ga0495602_0026633 | 3300048088 | Bacteria | 5573 |
| 614 | Ga0495626_0000265 | 3300048091 | Bacteria | 59217 |
| 615 | Ga0495626_0000854 | 3300048091 | Bacteria | 27130 |
| 616 | Ga0496100_0014784 | 3300048903 | Bacteria | 4540 |
| 617 | Ga0496102_0000997 | 3300048905 | Bacteria | 26651 |
| 618 | Ga0496102_0004200 | 3300048905 | Bacteria | 12182 |
| 619 | Ga0496102_0098945 | 3300048905 | Bacteria | 2707 |
| 620 | Ga0496103_0004156 | 3300048906 | Bacteria | 8793 |
| 621 | Ga0496104_0010723 | 3300048907 | Bacteria | 8196 |
| 622 | Ga0496104_0018597 | 3300048907 | Bacteria | 6342 |
| 623 | Ga0496104_0054077 | 3300048907 | Bacteria | 3795 |
| 624 | Ga0496105_0020243 | 3300048908 | Bacteria | 5376 |
| 625 | Ga0496106_0075846 | 3300048909 | Bacteria | 2576 |
| 626 | Ga0496107_0040411 | 3300048910 | Bacteria | 3348 |
| 627 | Ga0496108_0019119 | 3300048911 | Bacteria | 5621 |
| 628 | Ga0496108_0026300 | 3300048911 | Bacteria | 4799 |
| 629 | Ga0496109_0001663 | 3300048912 | Bacteria | 18543 |
| 630 | Ga0496109_0021099 | 3300048912 | Bacteria | 5760 |
| 631 | Ga0496110_0061495 | 3300048913 | Bacteria | 3315 |
| 632 | Ga0496111_0003397 | 3300048914 | Bacteria | 9845 |
| 633 | Ga0496111_0019769 | 3300048914 | Bacteria | 4684 |
| 634 | Ga0496112_0005913 | 3300048915 | Bacteria | 10672 |
| 635 | Ga0496112_0009917 | 3300048915 | Bacteria | 8616 |
| 636 | Ga0496112_0011999 | 3300048915 | Bacteria | 7945 |
| 637 | Ga0496112_0019541 | 3300048915 | Bacteria | 6395 |
| 638 | Ga0496112_0044931 | 3300048915 | Bacteria | 4329 |
| 639 | Ga0496113_0002253 | 3300048916 | Bacteria | 11122 |
| 640 | Ga0496113_0058427 | 3300048916 | Bacteria | 2902 |
| 641 | Ga0496113_0112508 | 3300048916 | Bacteria | 2121 |
| 642 | Ga0496114_0000031 | 3300048917 | Bacteria | 168230 |
| 643 | Ga0496115_0001061 | 3300048918 | Bacteria | 19923 |
| 644 | Ga0496115_0020994 | 3300048918 | Bacteria | 5040 |
| 645 | Ga0496126_0047040 | 3300048929 | Bacteria | 3952 |
| 646 | Ga0501036_0019842 | 3300049572 | Bacteria | 5645 |
| 647 | Ga0501037_0039371 | 3300049573 | Bacteria | 3480 |
| 648 | Ga0501038_0004670 | 3300049574 | Bacteria | 12756 |
| 649 | Ga0501039_0000444 | 3300049575 | Bacteria | 30061 |
| 650 | Ga0501040_0002905 | 3300049576 | Bacteria | 11074 |
| 651 | Ga0501041_0003652 | 3300049577 | Bacteria | 8854 |
| 652 | Ga0501042_0000113 | 3300049578 | Bacteria | 34099 |
| 653 | Ga0501046_0003595 | 3300049580 | Bacteria | 14202 |
| 654 | Ga0501068_0001152 | 3300049584 | Bacteria | 14020 |
| 655 | Ga0501071_0004316 | 3300049587 | Bacteria | 9011 |
| 656 | Ga0501071_0068660 | 3300049587 | Bacteria | 2579 |
| 657 | Ga0501072_0001120 | 3300049588 | Bacteria | 19933 |
| 658 | Ga0501073_0043084 | 3300049589 | Bacteria | 3183 |
| 659 | Ga0501075_0001035 | 3300049591 | Bacteria | 17848 |
| 660 | Ga0501076_0001002 | 3300049592 | Bacteria | 18504 |
| 661 | Ga0501076_0083010 | 3300049592 | Bacteria | 2573 |
| 662 | Ga0501077_0037475 | 3300049593 | Bacteria | 3088 |
| 663 | Ga0501079_0002646 | 3300049741 | Bacteria | 13021 |
| 664 | Ga0501080_0009479 | 3300049742 | Bacteria | 8881 |
| 665 | Ga0501081_0000575 | 3300049743 | Bacteria | 20867 |
| 666 | Ga0501045_0057341 | 3300049824 | Bacteria | 2850 |
| 667 | nmdc:mga06z11_36796_c1 | 3300050494 | Bacteria | 2419 |
| 668 | nmdc:mga05p37_14776_c1 | 3300050507 | Bacteria | 9376 |
| 669 | nmdc:mga05p37_19988_c1 | 3300050507 | Bacteria | 8103 |
| 670 | nmdc:mga05p37_2525_c1 | 3300050507 | Bacteria | 6805 |
| 671 | nmdc:mga09592_24403_c1 | 3300050508 | Bacteria | 5000 |
| 672 | nmdc:mga09592_48333_c1 | 3300050508 | Bacteria | 3586 |
| 673 | nmdc:mga09592_82961_c1 | 3300050508 | Bacteria | 2731 |
| 674 | nmdc:mga0qj67_19527_c1 | 3300050509 | Bacteria | 5178 |
| 675 | nmdc:mga0qj67_2012_c1 | 3300050509 | Bacteria | 14499 |
| 676 | nmdc:mga06r32_68453_c1 | 3300050510 | Bacteria | 3430 |
| 677 | nmdc:mga06r32_77178_c1 | 3300050510 | Bacteria | 3236 |
| 678 | nmdc:mga06r32_92361_c1 | 3300050510 | Bacteria | 2959 |
| 679 | nmdc:mga06r32_97096_c1 | 3300050510 | Bacteria | 2887 |
| 680 | nmdc:mga08y16_36066_c1 | 3300050511 | Bacteria | 5193 |
| 681 | nmdc:mga0n895_12303_c1 | 3300050512 | Bacteria | 7670 |
| 682 | nmdc:mga0n895_17278_c1 | 3300050512 | Bacteria | 6647 |
| 683 | nmdc:mga0n895_36604_c1 | 3300050512 | Bacteria | 4740 |
| 684 | nmdc:mga0n895_41796_c1 | 3300050512 | Bacteria | 4458 |
| 685 | nmdc:mga0n895_5649_c1 | 3300050512 | Bacteria | 10482 |
| 686 | nmdc:mga0n895_60541_c1 | 3300050512 | Bacteria | 3736 |
| 687 | nmdc:mga0rr50_16574_c1 | 3300050513 | Bacteria | 4899 |
| 688 | nmdc:mga0rr50_45870_c1 | 3300050513 | Bacteria | 3215 |
| 689 | nmdc:mga0rr50_6394_c1 | 3300050513 | Bacteria | 7166 |
| 690 | nmdc:mga08x19_16488_c1 | 3300050514 | Bacteria | 4507 |
| 691 | nmdc:mga0a205_1777_c1 | 3300050515 | Bacteria | 18638 |
| 692 | nmdc:mga0a205_31262_c1 | 3300050515 | Bacteria | 5100 |
| 693 | nmdc:mga0a205_43485_c1 | 3300050515 | Bacteria | 4331 |
| 694 | nmdc:mga0a205_5842_c1 | 3300050515 | Bacteria | 11084 |
| 695 | nmdc:mga0a205_73990_c1 | 3300050515 | Bacteria | 3291 |
| 696 | Ga0495601_0003196 | 3300053077 | Bacteria | 9381 |
| 697 | Ga0500555_001047 | 3300053103 | Bacteria | 9328 |
| 698 | Ga0500595_000039 | 3300053119 | Bacteria | 100396 |
| 699 | Ga0500634_0000037 | 3300053161 | Bacteria | 64614 |
| 700 | Ga0500645_002423 | 3300053730 | Bacteria | 8342 |
| 701 | Ga0501084_0004456 | 3300054114 | Bacteria | 11433 |
| 702 | Ga0501082_0080263 | 3300060353 | Bacteria | 2815 |
| 703 | Ga0530510_0015151 | 3300061734 | Bacteria | 5444 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300047471 | Ga0495684_0056252 | Ga0495684_0056252_13_1401 | 439 |
| 2 | 3300046460 | Ga0495638_0097773 | Ga0495638_0097773_345_1736 | 448 |
| 3 | 3300007265 | Ga0099794_10028772 | Ga0099794_100287723 | 450 |
| 4 | 3300013297 | Ga0157378_10001601 | Ga0157378_100016016 | 452 |
| 5 | iso_pu_bacteria | 3003665799 | 3003666486 | 475 |
| 6 | 3300046462 | Ga0495651_0084876 | Ga0495651_0084876_11_1522 | 480 |
| 7 | 3300042876 | Ga0451577_0006065 | Ga0451577_0006065_1239_2873 | 486 |
| 8 | 3300025926 | Ga0207659_10007100 | Ga0207659_100071004 | 494 |
| 9 | 3300046454 | Ga0495592_0057211 | Ga0495592_0057211_417_2003 | 495 |
| 10 | 3300025910 | Ga0207684_10037810 | Ga0207684_100378102 | 497 |
| 11 | 3300025912 | Ga0207707_10160146 | Ga0207707_101601462 | 499 |
| 12 | 3300042010 | Ga0439452_007992 | Ga0439452_007992_1373_2971 | 501 |
| 13 | 3300044656 | Ga0466969_0005643 | Ga0466969_0005643_1173_2855 | 501 |
| 14 | 3300044684 | Ga0466966_0009419 | Ga0466966_0009419_4423_6105 | 501 |
| 15 | 3300037418 | Ga0395900_0089468 | Ga0395900_0089468_841_2460 | 502 |
| 16 | 3300037466 | Ga0395898_0027612 | Ga0395898_0027612_3242_4861 | 502 |
| 17 | 3300037418 | Ga0395900_0084380 | Ga0395900_0084380_1116_2753 | 503 |
| 18 | 3300005329 | Ga0070683_100125910 | Ga0070683_1001259101 | 504 |
| 19 | 3300005336 | Ga0070680_100116134 | Ga0070680_1001161342 | 504 |
| 20 | 3300025909 | Ga0207705_10027889 | Ga0207705_100278895 | 504 |
| 21 | 3300025917 | Ga0207660_10048028 | Ga0207660_100480282 | 504 |
| 22 | 3300025921 | Ga0207652_10026753 | Ga0207652_100267535 | 504 |
| 23 | 3300026067 | Ga0207678_10031852 | Ga0207678_100318522 | 504 |
| 24 | 3300037418 | Ga0395900_0003060 | Ga0395900_0003060_11849_13471 | 504 |
| 25 | 3300048929 | Ga0496126_0047040 | Ga0496126_0047040_850_2475 | 505 |
| 26 | 3300044684 | Ga0466966_0017112 | Ga0466966_0017112_1237_2856 | 507 |
| 27 | 3300044693 | Ga0466961_0066625 | Ga0466961_0066625_365_1984 | 507 |
| 28 | 3300045049 | Ga0466959_0053660 | Ga0466959_0053660_235_1854 | 507 |
| 29 | 3300031711 | Ga0265314_10001027 | Ga0265314_1000102723 | 508 |
| 30 | 3300048915 | Ga0496112_0044931 | Ga0496112_0044931_12_1589 | 508 |
| 31 | iso_pu_bacteria | 2945961074 | 2945963733 | 508 |
| 32 | iso_pu_bacteria | 2946006987 | 2946009965 | 508 |
| 33 | iso_pu_bacteria | 2947233263 | 2947237814 | 508 |
| 34 | iso_pu_bacteria | 8056155041 | 8056158977 | 508 |
| 35 | 3300005329 | Ga0070683_100005644 | Ga0070683_1000056447 | 510 |
| 36 | 3300005344 | Ga0070661_100037933 | Ga0070661_1000379333 | 510 |
| 37 | 3300005435 | Ga0070714_100012212 | Ga0070714_1000122128 | 510 |
| 38 | 3300005435 | Ga0070714_100015355 | Ga0070714_1000153552 | 510 |
| 39 | 3300005458 | Ga0070681_10001144 | Ga0070681_1000114410 | 510 |
| 40 | 3300005530 | Ga0070679_100008438 | Ga0070679_1000084382 | 510 |
| 41 | 3300005535 | Ga0070684_100036790 | Ga0070684_1000367902 | 510 |
| 42 | 3300005539 | Ga0068853_100027796 | Ga0068853_1000277963 | 510 |
| 43 | 3300005563 | Ga0068855_100012592 | Ga0068855_1000125922 | 510 |
| 44 | 3300005577 | Ga0068857_100005498 | Ga0068857_10000549816 | 510 |
| 45 | 3300005614 | Ga0068856_100002047 | Ga0068856_1000020475 | 510 |
| 46 | 3300005616 | Ga0068852_100004778 | Ga0068852_1000047788 | 510 |
| 47 | 3300005842 | Ga0068858_100042641 | Ga0068858_1000426412 | 510 |
| 48 | 3300006237 | Ga0097621_100004160 | Ga0097621_1000041602 | 510 |
| 49 | 3300006358 | Ga0068871_100001936 | Ga0068871_1000019365 | 510 |
| 50 | 3300006844 | Ga0075428_100028228 | Ga0075428_1000282284 | 510 |
| 51 | 3300009093 | Ga0105240_10018106 | Ga0105240_100181062 | 510 |
| 52 | 3300009094 | Ga0111539_10031183 | Ga0111539_100311838 | 510 |
| 53 | 3300009545 | Ga0105237_10078138 | Ga0105237_100781382 | 510 |
| 54 | 3300009551 | Ga0105238_10001041 | Ga0105238_1000104115 | 510 |
| 55 | 3300013105 | Ga0157369_10000134 | Ga0157369_1000013446 | 510 |
| 56 | 3300013296 | Ga0157374_10000661 | Ga0157374_1000066116 | 510 |
| 57 | 3300013307 | Ga0157372_10010222 | Ga0157372_100102222 | 510 |
| 58 | 3300013307 | Ga0157372_10011442 | Ga0157372_100114425 | 510 |
| 59 | 3300013307 | Ga0157372_10029357 | Ga0157372_100293572 | 510 |
| 60 | 3300014969 | Ga0157376_10034568 | Ga0157376_100345682 | 510 |
| 61 | 3300025913 | Ga0207695_10012444 | Ga0207695_100124442 | 510 |
| 62 | 3300025921 | Ga0207652_10001698 | Ga0207652_100016987 | 510 |
| 63 | 3300025924 | Ga0207694_10001081 | Ga0207694_1000108115 | 510 |
| 64 | 3300025929 | Ga0207664_10035053 | Ga0207664_100350531 | 510 |
| 65 | 3300025944 | Ga0207661_10004525 | Ga0207661_100045255 | 510 |
| 66 | 3300025949 | Ga0207667_10000245 | Ga0207667_1000024553 | 510 |
| 67 | 3300025949 | Ga0207667_10008821 | Ga0207667_100088219 | 510 |
| 68 | 3300026035 | Ga0207703_10008498 | Ga0207703_100084985 | 510 |
| 69 | 3300026041 | Ga0207639_10006611 | Ga0207639_1000661111 | 510 |
| 70 | 3300026078 | Ga0207702_10000454 | Ga0207702_1000045426 | 510 |
| 71 | 3300048915 | Ga0496112_0005913 | Ga0496112_0005913_1656_3293 | 510 |
| 72 | 3300050508 | nmdc:mga09592_24403_c1 | nmdc:mga09592_24403_c1_82_1665 | 510 |
| 73 | 3300050510 | nmdc:mga06r32_68453_c1 | nmdc:mga06r32_68453_c1_1315_2898 | 510 |
| 74 | 3300005336 | Ga0070680_100071646 | Ga0070680_1000716462 | 511 |
| 75 | 3300005339 | Ga0070660_100015514 | Ga0070660_1000155143 | 511 |
| 76 | 3300005344 | Ga0070661_100002233 | Ga0070661_1000022339 | 511 |
| 77 | 3300005355 | Ga0070671_100049345 | Ga0070671_1000493454 | 511 |
| 78 | 3300005366 | Ga0070659_100001713 | Ga0070659_10000171311 | 511 |
| 79 | 3300005457 | Ga0070662_100012468 | Ga0070662_1000124683 | 511 |
| 80 | 3300005458 | Ga0070681_10079886 | Ga0070681_100798864 | 511 |
| 81 | 3300005530 | Ga0070679_100052872 | Ga0070679_1000528722 | 511 |
| 82 | 3300005535 | Ga0070684_100117771 | Ga0070684_1001177712 | 511 |
| 83 | 3300005539 | Ga0068853_100022380 | Ga0068853_1000223802 | 511 |
| 84 | 3300005546 | Ga0070696_100013455 | Ga0070696_1000134554 | 511 |
| 85 | 3300005547 | Ga0070693_100027720 | Ga0070693_1000277204 | 511 |
| 86 | 3300005563 | Ga0068855_100035591 | Ga0068855_1000355916 | 511 |
| 87 | 3300005564 | Ga0070664_100003501 | Ga0070664_1000035015 | 511 |
| 88 | 3300005614 | Ga0068856_100005834 | Ga0068856_1000058345 | 511 |
| 89 | 3300005834 | Ga0068851_10004716 | Ga0068851_100047166 | 511 |
| 90 | 3300009093 | Ga0105240_10033595 | Ga0105240_100335955 | 511 |
| 91 | 3300009545 | Ga0105237_10026300 | Ga0105237_100263005 | 511 |
| 92 | 3300009551 | Ga0105238_10005774 | Ga0105238_100057749 | 511 |
| 93 | 3300010375 | Ga0105239_10072758 | Ga0105239_100727583 | 511 |
| 94 | 3300013296 | Ga0157374_10006871 | Ga0157374_100068714 | 511 |
| 95 | 3300013306 | Ga0163162_10067996 | Ga0163162_100679964 | 511 |
| 96 | 3300013307 | Ga0157372_10076839 | Ga0157372_100768394 | 511 |
| 97 | 3300014497 | Ga0182008_10000712 | Ga0182008_1000071215 | 511 |
| 98 | 3300014497 | Ga0182008_10002552 | Ga0182008_100025524 | 511 |
| 99 | 3300015262 | Ga0182007_10003649 | Ga0182007_100036493 | 511 |
| 100 | 3300025912 | Ga0207707_10024604 | Ga0207707_100246046 | 511 |
| 101 | 3300025914 | Ga0207671_10074747 | Ga0207671_100747472 | 511 |
| 102 | 3300025919 | Ga0207657_10001503 | Ga0207657_100015033 | 511 |
| 103 | 3300025920 | Ga0207649_10009058 | Ga0207649_100090583 | 511 |
| 104 | 3300025924 | Ga0207694_10019640 | Ga0207694_100196404 | 511 |
| 105 | 3300025932 | Ga0207690_10016806 | Ga0207690_100168062 | 511 |
| 106 | 3300025933 | Ga0207706_10006139 | Ga0207706_100061396 | 511 |
| 107 | 3300025945 | Ga0207679_10009363 | Ga0207679_100093635 | 511 |
| 108 | 3300025949 | Ga0207667_10011306 | Ga0207667_100113065 | 511 |
| 109 | 3300041411 | Ga0439466_0001002 | Ga0439466_0001002_1092_2690 | 511 |
| 110 | 3300042009 | Ga0439451_000063 | Ga0439451_000063_2256_3854 | 511 |
| 111 | 3300046452 | Ga0495617_002468 | Ga0495617_002468_586_2184 | 511 |
| 112 | 3300046452 | Ga0495617_002920 | Ga0495617_002920_2792_4390 | 511 |
| 113 | 3300046458 | Ga0495591_000005 | Ga0495591_000005_204087_205685 | 511 |
| 114 | 3300046460 | Ga0495638_0009240 | Ga0495638_0009240_4778_6376 | 511 |
| 115 | 3300046471 | Ga0495650_0000775 | Ga0495650_0000775_26415_28013 | 511 |
| 116 | 3300046471 | Ga0495650_0015684 | Ga0495650_0015684_1196_2794 | 511 |
| 117 | 3300046501 | Ga0495607_0040736 | Ga0495607_0040736_672_2270 | 511 |
| 118 | 3300046506 | Ga0495583_0000167 | Ga0495583_0000167_95966_97564 | 511 |
| 119 | 3300046506 | Ga0495583_0002626 | Ga0495583_0002626_12557_14155 | 511 |
| 120 | 3300046507 | Ga0495606_0001672 | Ga0495606_0001672_12824_14422 | 511 |
| 121 | 3300046507 | Ga0495606_0001998 | Ga0495606_0001998_12960_14558 | 511 |
| 122 | 3300046507 | Ga0495606_0021698 | Ga0495606_0021698_531_2129 | 511 |
| 123 | 3300046512 | Ga0495610_0000174 | Ga0495610_0000174_15371_16969 | 511 |
| 124 | 3300046515 | Ga0495620_0002598 | Ga0495620_0002598_8159_9757 | 511 |
| 125 | 3300046518 | Ga0495631_0006358 | Ga0495631_0006358_388_1986 | 511 |
| 126 | 3300046519 | Ga0495632_0013955 | Ga0495632_0013955_637_2235 | 511 |
| 127 | 3300046519 | Ga0495632_0042616 | Ga0495632_0042616_39_1637 | 511 |
| 128 | 3300046522 | Ga0495643_0010066 | Ga0495643_0010066_3602_5200 | 511 |
| 129 | 3300046523 | Ga0495644_0001132 | Ga0495644_0001132_7489_9087 | 511 |
| 130 | 3300046524 | Ga0495648_0000487 | Ga0495648_0000487_15942_17540 | 511 |
| 131 | 3300046524 | Ga0495648_0001882 | Ga0495648_0001882_5023_6621 | 511 |
| 132 | 3300046524 | Ga0495648_0014622 | Ga0495648_0014622_2570_4168 | 511 |
| 133 | 3300046524 | Ga0495648_0015301 | Ga0495648_0015301_1412_3010 | 511 |
| 134 | 3300046528 | Ga0495642_0000004 | Ga0495642_0000004_106773_108371 | 511 |
| 135 | 3300046530 | Ga0495654_0000463 | Ga0495654_0000463_12469_14067 | 511 |
| 136 | 3300046530 | Ga0495654_0015457 | Ga0495654_0015457_1292_2890 | 511 |
| 137 | 3300046542 | Ga0495597_0009786 | Ga0495597_0009786_2566_4164 | 511 |
| 138 | 3300046558 | Ga0495633_0014064 | Ga0495633_0014064_724_2322 | 511 |
| 139 | 3300046648 | Ga0495611_0011105 | Ga0495611_0011105_565_2163 | 511 |
| 140 | 3300046665 | Ga0495661_0000354 | Ga0495661_0000354_39060_40658 | 511 |
| 141 | 3300046691 | Ga0495670_0000057 | Ga0495670_0000057_13583_15181 | 511 |
| 142 | 3300046691 | Ga0495670_0033432 | Ga0495670_0033432_155_1753 | 511 |
| 143 | 3300046692 | Ga0495671_0000241 | Ga0495671_0000241_16720_18318 | 511 |
| 144 | 3300046692 | Ga0495671_0011524 | Ga0495671_0011524_2704_4302 | 511 |
| 145 | 3300046794 | Ga0495589_0000739 | Ga0495589_0000739_7010_8608 | 511 |
| 146 | 3300046810 | Ga0495660_0000606 | Ga0495660_0000606_23598_25196 | 511 |
| 147 | 3300047320 | Ga0495672_0003677 | Ga0495672_0003677_1678_3276 | 511 |
| 148 | 3300047323 | Ga0495683_0000253 | Ga0495683_0000253_32431_34029 | 511 |
| 149 | 3300047446 | Ga0495679_000143 | Ga0495679_000143_39079_40677 | 511 |
| 150 | 3300047469 | Ga0495673_0022500 | Ga0495673_0022500_1068_2666 | 511 |
| 151 | 3300047469 | Ga0495673_0028289 | Ga0495673_0028289_422_2020 | 511 |
| 152 | 3300047469 | Ga0495673_0033279 | Ga0495673_0033279_519_2117 | 511 |
| 153 | 3300047470 | Ga0495681_0011543 | Ga0495681_0011543_1936_3534 | 511 |
| 154 | 3300047470 | Ga0495681_0014237 | Ga0495681_0014237_637_2235 | 511 |
| 155 | 3300047472 | Ga0495686_0045680 | Ga0495686_0045680_625_2223 | 511 |
| 156 | 3300048091 | Ga0495626_0000265 | Ga0495626_0000265_12307_13905 | 511 |
| 157 | 3300048091 | Ga0495626_0000854 | Ga0495626_0000854_9902_11500 | 511 |
| 158 | 3300048903 | Ga0496100_0014784 | Ga0496100_0014784_2671_4305 | 511 |
| 159 | 3300048905 | Ga0496102_0004200 | Ga0496102_0004200_1894_3528 | 511 |
| 160 | 3300048906 | Ga0496103_0004156 | Ga0496103_0004156_2615_4249 | 511 |
| 161 | 3300048907 | Ga0496104_0010723 | Ga0496104_0010723_101_1735 | 511 |
| 162 | 3300048909 | Ga0496106_0075846 | Ga0496106_0075846_448_2082 | 511 |
| 163 | 3300048910 | Ga0496107_0040411 | Ga0496107_0040411_209_1843 | 511 |
| 164 | 3300048911 | Ga0496108_0019119 | Ga0496108_0019119_1317_2951 | 511 |
| 165 | 3300048912 | Ga0496109_0021099 | Ga0496109_0021099_2406_4040 | 511 |
| 166 | 3300048914 | Ga0496111_0003397 | Ga0496111_0003397_4886_6520 | 511 |
| 167 | 3300048916 | Ga0496113_0002253 | Ga0496113_0002253_7413_9047 | 511 |
| 168 | 3300053161 | Ga0500634_0000037 | Ga0500634_0000037_23913_25511 | 511 |
| 169 | 3300005436 | Ga0070713_100004207 | Ga0070713_1000042076 | 512 |
| 170 | 3300005458 | Ga0070681_10000247 | Ga0070681_1000024716 | 512 |
| 171 | 3300005577 | Ga0068857_100040676 | Ga0068857_1000406764 | 512 |
| 172 | 3300009093 | Ga0105240_10024508 | Ga0105240_100245085 | 512 |
| 173 | 3300009551 | Ga0105238_10001061 | Ga0105238_1000106123 | 512 |
| 174 | 3300013105 | Ga0157369_10000258 | Ga0157369_1000025820 | 512 |
| 175 | 3300013296 | Ga0157374_10022386 | Ga0157374_100223862 | 512 |
| 176 | 3300013307 | Ga0157372_10000335 | Ga0157372_1000033523 | 512 |
| 177 | 3300025912 | Ga0207707_10001477 | Ga0207707_100014779 | 512 |
| 178 | 3300025921 | Ga0207652_10052778 | Ga0207652_100527782 | 512 |
| 179 | 3300025924 | Ga0207694_10000284 | Ga0207694_1000028421 | 512 |
| 180 | 3300025928 | Ga0207700_10015608 | Ga0207700_100156083 | 512 |
| 181 | 3300025949 | Ga0207667_10000487 | Ga0207667_1000048723 | 512 |
| 182 | 3300026041 | Ga0207639_10014149 | Ga0207639_100141495 | 512 |
| 183 | 3300026078 | Ga0207702_10000482 | Ga0207702_100004825 | 512 |
| 184 | 3300026116 | Ga0207674_10020001 | Ga0207674_100200014 | 512 |
| 185 | 3300026142 | Ga0207698_10017821 | Ga0207698_100178212 | 512 |
| 186 | 3300039450 | Ga0436363_1131501 | Ga0436363_1131501_743_2368 | 512 |
| 187 | 3300048915 | Ga0496112_0019541 | Ga0496112_0019541_4274_5893 | 512 |
| 188 | 3300048916 | Ga0496113_0112508 | Ga0496113_0112508_362_1981 | 512 |
| 189 | 3300028800 | Ga0265338_10034265 | Ga0265338_100342655 | 513 |
| 190 | 3300031344 | Ga0265316_10027712 | Ga0265316_100277123 | 513 |
| 191 | 3300050509 | nmdc:mga0qj67_19527_c1 | nmdc:mga0qj67_19527_c1_1987_3573 | 513 |
| 192 | 3300005330 | Ga0070690_100035999 | Ga0070690_1000359992 | 514 |
| 193 | 3300005937 | Ga0081455_10013832 | Ga0081455_100138323 | 514 |
| 194 | 3300006846 | Ga0075430_100003080 | Ga0075430_10000308011 | 514 |
| 195 | 3300006847 | Ga0075431_100091553 | Ga0075431_1000915533 | 514 |
| 196 | 3300009147 | Ga0114129_10012984 | Ga0114129_100129843 | 514 |
| 197 | 3300009553 | Ga0105249_10039605 | Ga0105249_100396053 | 514 |
| 198 | 3300027671 | Ga0209588_1002355 | Ga0209588_10023554 | 514 |
| 199 | 3300050507 | nmdc:mga05p37_14776_c1 | nmdc:mga05p37_14776_c1_5958_7580 | 514 |
| 200 | 3300050508 | nmdc:mga09592_48333_c1 | nmdc:mga09592_48333_c1_1829_3427 | 514 |
| 201 | 3300050510 | nmdc:mga06r32_97096_c1 | nmdc:mga06r32_97096_c1_235_1833 | 514 |
| 202 | 3300006178 | Ga0075367_10008309 | Ga0075367_100083095 | 515 |
| 203 | 3300006846 | Ga0075430_100029707 | Ga0075430_1000297074 | 515 |
| 204 | 3300006847 | Ga0075431_100070167 | Ga0075431_1000701672 | 515 |
| 205 | 3300006880 | Ga0075429_100031657 | Ga0075429_1000316572 | 515 |
| 206 | 3300009147 | Ga0114129_10007873 | Ga0114129_100078739 | 515 |
| 207 | 3300009147 | Ga0114129_10234347 | Ga0114129_102343472 | 515 |
| 208 | 3300049593 | Ga0501077_0037475 | Ga0501077_0037475_1464_3065 | 515 |
| 209 | 3300050494 | nmdc:mga06z11_36796_c1 | nmdc:mga06z11_36796_c1_108_1709 | 515 |
| 210 | 3300050509 | nmdc:mga0qj67_2012_c1 | nmdc:mga0qj67_2012_c1_1401_3002 | 515 |
| 211 | 3300050510 | nmdc:mga06r32_92361_c1 | nmdc:mga06r32_92361_c1_765_2369 | 515 |
| 212 | 3300060353 | Ga0501082_0080263 | Ga0501082_0080263_1119_2720 | 515 |
| 213 | 3300005290 | Ga0065712_10006770 | Ga0065712_100067701 | 516 |
| 214 | 3300005290 | Ga0065712_10068753 | Ga0065712_100687534 | 516 |
| 215 | 3300005329 | Ga0070683_100003814 | Ga0070683_1000038143 | 516 |
| 216 | 3300005344 | Ga0070661_100003160 | Ga0070661_1000031603 | 516 |
| 217 | 3300005354 | Ga0070675_100082354 | Ga0070675_1000823541 | 516 |
| 218 | 3300005355 | Ga0070671_100056861 | Ga0070671_1000568612 | 516 |
| 219 | 3300005364 | Ga0070673_100129845 | Ga0070673_1001298452 | 516 |
| 220 | 3300005458 | Ga0070681_10074665 | Ga0070681_100746651 | 516 |
| 221 | 3300005530 | Ga0070679_100040488 | Ga0070679_1000404886 | 516 |
| 222 | 3300005535 | Ga0070684_100015869 | Ga0070684_1000158692 | 516 |
| 223 | 3300005543 | Ga0070672_100150838 | Ga0070672_1001508382 | 516 |
| 224 | 3300005614 | Ga0068856_100001696 | Ga0068856_1000016969 | 516 |
| 225 | 3300006844 | Ga0075428_100004241 | Ga0075428_1000042415 | 516 |
| 226 | 3300006847 | Ga0075431_100029475 | Ga0075431_1000294753 | 516 |
| 227 | 3300006852 | Ga0075433_10003978 | Ga0075433_100039783 | 516 |
| 228 | 3300006871 | Ga0075434_100007024 | Ga0075434_1000070242 | 516 |
| 229 | 3300009094 | Ga0111539_10289772 | Ga0111539_102897722 | 516 |
| 230 | 3300009098 | Ga0105245_10147040 | Ga0105245_101470402 | 516 |
| 231 | 3300009147 | Ga0114129_10023521 | Ga0114129_100235212 | 516 |
| 232 | 3300013296 | Ga0157374_10101183 | Ga0157374_101011832 | 516 |
| 233 | 3300013308 | Ga0157375_10180531 | Ga0157375_101805312 | 516 |
| 234 | 3300025912 | Ga0207707_10149435 | Ga0207707_101494352 | 516 |
| 235 | 3300025920 | Ga0207649_10080913 | Ga0207649_100809131 | 516 |
| 236 | 3300025921 | Ga0207652_10151853 | Ga0207652_101518531 | 516 |
| 237 | 3300025931 | Ga0207644_10023383 | Ga0207644_100233833 | 516 |
| 238 | 3300025944 | Ga0207661_10001184 | Ga0207661_1000118411 | 516 |
| 239 | 3300026078 | Ga0207702_10000091 | Ga0207702_100000918 | 516 |
| 240 | 3300026116 | Ga0207674_10029219 | Ga0207674_100292196 | 516 |
| 241 | 3300048907 | Ga0496104_0018597 | Ga0496104_0018597_3573_5177 | 516 |
| 242 | 3300048907 | Ga0496104_0054077 | Ga0496104_0054077_1606_3258 | 516 |
| 243 | 3300048908 | Ga0496105_0020243 | Ga0496105_0020243_282_1934 | 516 |
| 244 | 3300048911 | Ga0496108_0026300 | Ga0496108_0026300_2275_3879 | 516 |
| 245 | 3300048912 | Ga0496109_0001663 | Ga0496109_0001663_12435_14039 | 516 |
| 246 | 3300048914 | Ga0496111_0019769 | Ga0496111_0019769_2188_3792 | 516 |
| 247 | 3300048916 | Ga0496113_0058427 | Ga0496113_0058427_482_2086 | 516 |
| 248 | 3300048918 | Ga0496115_0020994 | Ga0496115_0020994_3157_4809 | 516 |
| 249 | 3300049587 | Ga0501071_0068660 | Ga0501071_0068660_317_1924 | 516 |
| 250 | 3300049824 | Ga0501045_0057341 | Ga0501045_0057341_95_1702 | 516 |
| 251 | 3300050507 | nmdc:mga05p37_19988_c1 | nmdc:mga05p37_19988_c1_673_2277 | 516 |
| 252 | 3300050512 | nmdc:mga0n895_5649_c1 | nmdc:mga0n895_5649_c1_7003_8607 | 516 |
| 253 | 3300050515 | nmdc:mga0a205_31262_c1 | nmdc:mga0a205_31262_c1_2813_4417 | 516 |
| 254 | 3300050515 | nmdc:mga0a205_5842_c1 | nmdc:mga0a205_5842_c1_1557_3161 | 516 |
| 255 | 3300005293 | Ga0065715_10013849 | Ga0065715_100138492 | 517 |
| 256 | 3300005327 | Ga0070658_10001372 | Ga0070658_100013725 | 517 |
| 257 | 3300005337 | Ga0070682_100026421 | Ga0070682_1000264211 | 517 |
| 258 | 3300005339 | Ga0070660_100000773 | Ga0070660_1000007735 | 517 |
| 259 | 3300005339 | Ga0070660_100036539 | Ga0070660_1000365394 | 517 |
| 260 | 3300005530 | Ga0070679_100069664 | Ga0070679_1000696643 | 517 |
| 261 | 3300005563 | Ga0068855_100002571 | Ga0068855_1000025714 | 517 |
| 262 | 3300005577 | Ga0068857_100048315 | Ga0068857_1000483152 | 517 |
| 263 | 3300005616 | Ga0068852_100004781 | Ga0068852_1000047818 | 517 |
| 264 | 3300005616 | Ga0068852_100006343 | Ga0068852_1000063434 | 517 |
| 265 | 3300013102 | Ga0157371_10000892 | Ga0157371_1000089216 | 517 |
| 266 | 3300013102 | Ga0157371_10020196 | Ga0157371_100201965 | 517 |
| 267 | 3300013104 | Ga0157370_10002480 | Ga0157370_100024802 | 517 |
| 268 | 3300025901 | Ga0207688_10010552 | Ga0207688_100105522 | 517 |
| 269 | 3300025904 | Ga0207647_10007033 | Ga0207647_100070332 | 517 |
| 270 | 3300025904 | Ga0207647_10011034 | Ga0207647_100110343 | 517 |
| 271 | 3300025909 | Ga0207705_10000419 | Ga0207705_1000041918 | 517 |
| 272 | 3300025909 | Ga0207705_10007786 | Ga0207705_100077864 | 517 |
| 273 | 3300025909 | Ga0207705_10065583 | Ga0207705_100655832 | 517 |
| 274 | 3300025909 | Ga0207705_10094081 | Ga0207705_100940812 | 517 |
| 275 | 3300025912 | Ga0207707_10043614 | Ga0207707_100436142 | 517 |
| 276 | 3300025913 | Ga0207695_10044125 | Ga0207695_100441255 | 517 |
| 277 | 3300025914 | Ga0207671_10038188 | Ga0207671_100381883 | 517 |
| 278 | 3300025917 | Ga0207660_10001220 | Ga0207660_1000122018 | 517 |
| 279 | 3300025917 | Ga0207660_10001524 | Ga0207660_100015246 | 517 |
| 280 | 3300025917 | Ga0207660_10014935 | Ga0207660_100149352 | 517 |
| 281 | 3300025919 | Ga0207657_10000159 | Ga0207657_1000015918 | 517 |
| 282 | 3300025919 | Ga0207657_10003049 | Ga0207657_1000304914 | 517 |
| 283 | 3300025921 | Ga0207652_10058987 | Ga0207652_100589873 | 517 |
| 284 | 3300025921 | Ga0207652_10089999 | Ga0207652_100899992 | 517 |
| 285 | 3300025933 | Ga0207706_10002112 | Ga0207706_1000211212 | 517 |
| 286 | 3300025944 | Ga0207661_10002226 | Ga0207661_1000222615 | 517 |
| 287 | 3300025944 | Ga0207661_10028936 | Ga0207661_100289363 | 517 |
| 288 | 3300025945 | Ga0207679_10106471 | Ga0207679_101064712 | 517 |
| 289 | 3300025949 | Ga0207667_10000314 | Ga0207667_1000031465 | 517 |
| 290 | 3300025949 | Ga0207667_10006431 | Ga0207667_100064315 | 517 |
| 291 | 3300025949 | Ga0207667_10028616 | Ga0207667_100286164 | 517 |
| 292 | 3300025949 | Ga0207667_10092112 | Ga0207667_100921123 | 517 |
| 293 | 3300026041 | Ga0207639_10017610 | Ga0207639_100176103 | 517 |
| 294 | 3300026078 | Ga0207702_10009071 | Ga0207702_100090718 | 517 |
| 295 | 3300026116 | Ga0207674_10001151 | Ga0207674_1000115119 | 517 |
| 296 | 3300026116 | Ga0207674_10021224 | Ga0207674_100212244 | 517 |
| 297 | 3300026142 | Ga0207698_10000912 | Ga0207698_1000091222 | 517 |
| 298 | 3300026142 | Ga0207698_10012327 | Ga0207698_100123273 | 517 |
| 299 | 3300026142 | Ga0207698_10014443 | Ga0207698_100144435 | 517 |
| 300 | 3300026142 | Ga0207698_10138172 | Ga0207698_101381722 | 517 |
| 301 | 3300037068 | Ga0373925_0006140 | Ga0373925_0006140_4545_6161 | 517 |
| 302 | 3300037418 | Ga0395900_0058197 | Ga0395900_0058197_1085_2704 | 517 |
| 303 | 3300037466 | Ga0395898_0033031 | Ga0395898_0033031_1943_3562 | 517 |
| 304 | 3300037471 | Ga0395905_0035459 | Ga0395905_0035459_1596_3215 | 517 |
| 305 | 3300038443 | Ga0395901_0005170 | Ga0395901_0005170_9263_10882 | 517 |
| 306 | 3300038443 | Ga0395901_0008749 | Ga0395901_0008749_3103_4722 | 517 |
| 307 | 3300038443 | Ga0395901_0252214 | Ga0395901_0252214_165_1784 | 517 |
| 308 | 3300044656 | Ga0466969_0036131 | Ga0466969_0036131_862_2481 | 517 |
| 309 | 3300045976 | Ga0466967_0005247 | Ga0466967_0005247_2509_4128 | 517 |
| 310 | 3300045976 | Ga0466967_0007210 | Ga0466967_0007210_389_2008 | 517 |
| 311 | 3300045976 | Ga0466967_0008683 | Ga0466967_0008683_2240_3859 | 517 |
| 312 | 3300045976 | Ga0466967_0028238 | Ga0466967_0028238_2584_4203 | 517 |
| 313 | 3300045976 | Ga0466967_0102638 | Ga0466967_0102638_969_2588 | 517 |
| 314 | 3300046472 | Ga0495580_0075523 | Ga0495580_0075523_541_2145 | 517 |
| 315 | 3300005330 | Ga0070690_100011506 | Ga0070690_1000115063 | 518 |
| 316 | 3300005331 | Ga0070670_100010077 | Ga0070670_1000100777 | 518 |
| 317 | 3300005334 | Ga0068869_100012085 | Ga0068869_1000120855 | 518 |
| 318 | 3300005337 | Ga0070682_100086289 | Ga0070682_1000862892 | 518 |
| 319 | 3300005338 | Ga0068868_100001688 | Ga0068868_1000016885 | 518 |
| 320 | 3300005344 | Ga0070661_100007607 | Ga0070661_1000076074 | 518 |
| 321 | 3300005355 | Ga0070671_100051197 | Ga0070671_1000511972 | 518 |
| 322 | 3300005364 | Ga0070673_100001367 | Ga0070673_1000013675 | 518 |
| 323 | 3300005364 | Ga0070673_100073115 | Ga0070673_1000731153 | 518 |
| 324 | 3300005434 | Ga0070709_10023151 | Ga0070709_100231512 | 518 |
| 325 | 3300005435 | Ga0070714_100009936 | Ga0070714_1000099362 | 518 |
| 326 | 3300005435 | Ga0070714_100082797 | Ga0070714_1000827972 | 518 |
| 327 | 3300005436 | Ga0070713_100010519 | Ga0070713_1000105194 | 518 |
| 328 | 3300005437 | Ga0070710_10009681 | Ga0070710_100096812 | 518 |
| 329 | 3300005439 | Ga0070711_100004233 | Ga0070711_1000042333 | 518 |
| 330 | 3300005459 | Ga0068867_100003528 | Ga0068867_1000035283 | 518 |
| 331 | 3300005530 | Ga0070679_100081316 | Ga0070679_1000813162 | 518 |
| 332 | 3300005543 | Ga0070672_100019537 | Ga0070672_1000195374 | 518 |
| 333 | 3300005563 | Ga0068855_100000561 | Ga0068855_1000005615 | 518 |
| 334 | 3300005564 | Ga0070664_100003647 | Ga0070664_1000036475 | 518 |
| 335 | 3300005577 | Ga0068857_100000419 | Ga0068857_1000004196 | 518 |
| 336 | 3300005614 | Ga0068856_100000394 | Ga0068856_10000039440 | 518 |
| 337 | 3300005614 | Ga0068856_100002997 | Ga0068856_10000299717 | 518 |
| 338 | 3300005617 | Ga0068859_100000290 | Ga0068859_10000029021 | 518 |
| 339 | 3300005618 | Ga0068864_100001429 | Ga0068864_1000014295 | 518 |
| 340 | 3300005718 | Ga0068866_10001078 | Ga0068866_100010784 | 518 |
| 341 | 3300005842 | Ga0068858_100002722 | Ga0068858_1000027224 | 518 |
| 342 | 3300006028 | Ga0070717_10051695 | Ga0070717_100516952 | 518 |
| 343 | 3300006028 | Ga0070717_10141495 | Ga0070717_101414952 | 518 |
| 344 | 3300006173 | Ga0070716_100057929 | Ga0070716_1000579292 | 518 |
| 345 | 3300006175 | Ga0070712_100016363 | Ga0070712_1000163632 | 518 |
| 346 | 3300006175 | Ga0070712_100036163 | Ga0070712_1000361633 | 518 |
| 347 | 3300006237 | Ga0097621_100001063 | Ga0097621_10000106317 | 518 |
| 348 | 3300006358 | Ga0068871_100029931 | Ga0068871_1000299314 | 518 |
| 349 | 3300006931 | Ga0097620_100000290 | Ga0097620_10000029021 | 518 |
| 350 | 3300007076 | Ga0075435_100002073 | Ga0075435_1000020736 | 518 |
| 351 | 3300009093 | Ga0105240_10205380 | Ga0105240_102053801 | 518 |
| 352 | 3300013100 | Ga0157373_10024462 | Ga0157373_100244622 | 518 |
| 353 | 3300013102 | Ga0157371_10036902 | Ga0157371_100369021 | 518 |
| 354 | 3300013102 | Ga0157371_10126702 | Ga0157371_101267022 | 518 |
| 355 | 3300013296 | Ga0157374_10000517 | Ga0157374_1000051712 | 518 |
| 356 | 3300013297 | Ga0157378_10000517 | Ga0157378_1000051723 | 518 |
| 357 | 3300013307 | Ga0157372_10000629 | Ga0157372_1000062916 | 518 |
| 358 | 3300014325 | Ga0163163_10159075 | Ga0163163_101590752 | 518 |
| 359 | 3300014969 | Ga0157376_10040249 | Ga0157376_100402492 | 518 |
| 360 | 3300025898 | Ga0207692_10005300 | Ga0207692_100053005 | 518 |
| 361 | 3300025899 | Ga0207642_10000509 | Ga0207642_100005099 | 518 |
| 362 | 3300025904 | Ga0207647_10004022 | Ga0207647_100040224 | 518 |
| 363 | 3300025906 | Ga0207699_10022367 | Ga0207699_100223672 | 518 |
| 364 | 3300025906 | Ga0207699_10023187 | Ga0207699_100231872 | 518 |
| 365 | 3300025915 | Ga0207693_10005882 | Ga0207693_100058825 | 518 |
| 366 | 3300025915 | Ga0207693_10026475 | Ga0207693_100264752 | 518 |
| 367 | 3300025916 | Ga0207663_10035866 | Ga0207663_100358661 | 518 |
| 368 | 3300025916 | Ga0207663_10058173 | Ga0207663_100581732 | 518 |
| 369 | 3300025925 | Ga0207650_10007616 | Ga0207650_100076164 | 518 |
| 370 | 3300025929 | Ga0207664_10006945 | Ga0207664_100069455 | 518 |
| 371 | 3300025931 | Ga0207644_10008669 | Ga0207644_100086692 | 518 |
| 372 | 3300025940 | Ga0207691_10001855 | Ga0207691_1000185514 | 518 |
| 373 | 3300025941 | Ga0207711_10020787 | Ga0207711_100207875 | 518 |
| 374 | 3300025942 | Ga0207689_10016908 | Ga0207689_100169083 | 518 |
| 375 | 3300025945 | Ga0207679_10006991 | Ga0207679_100069914 | 518 |
| 376 | 3300025949 | Ga0207667_10002750 | Ga0207667_100027505 | 518 |
| 377 | 3300025960 | Ga0207651_10001825 | Ga0207651_100018255 | 518 |
| 378 | 3300025981 | Ga0207640_10012164 | Ga0207640_100121645 | 518 |
| 379 | 3300026023 | Ga0207677_10002130 | Ga0207677_100021308 | 518 |
| 380 | 3300026035 | Ga0207703_10000881 | Ga0207703_100008814 | 518 |
| 381 | 3300026035 | Ga0207703_10013106 | Ga0207703_100131064 | 518 |
| 382 | 3300026078 | Ga0207702_10001896 | Ga0207702_1000189616 | 518 |
| 383 | 3300026088 | Ga0207641_10033229 | Ga0207641_100332292 | 518 |
| 384 | 3300026089 | Ga0207648_10015008 | Ga0207648_100150084 | 518 |
| 385 | 3300026095 | Ga0207676_10001522 | Ga0207676_1000152216 | 518 |
| 386 | 3300026116 | Ga0207674_10000229 | Ga0207674_1000022940 | 518 |
| 387 | 3300026116 | Ga0207674_10010596 | Ga0207674_100105967 | 518 |
| 388 | 3300035691 | Ga0373931_0029980 | Ga0373931_0029980_207_1847 | 518 |
| 389 | 3300037853 | Ga0436364_0488840 | Ga0436364_0488840_97_1737 | 518 |
| 390 | 3300039450 | Ga0436363_0796445 | Ga0436363_0796445_1948_3588 | 518 |
| 391 | 3300044673 | Ga0453683_0003521 | Ga0453683_0003521_8364_10007 | 518 |
| 392 | 3300044694 | Ga0466963_0000208 | Ga0466963_0000208_3272_4894 | 518 |
| 393 | 3300044694 | Ga0466963_0036753 | Ga0466963_0036753_344_1966 | 518 |
| 394 | 3300044842 | Ga0466957_0001777 | Ga0466957_0001777_3601_5223 | 518 |
| 395 | 3300044842 | Ga0466957_0008613 | Ga0466957_0008613_923_2545 | 518 |
| 396 | 3300045836 | Ga0466958_0000543 | Ga0466958_0000543_13859_15481 | 518 |
| 397 | 3300045976 | Ga0466967_0000567 | Ga0466967_0000567_3272_4894 | 518 |
| 398 | 3300046472 | Ga0495580_0007152 | Ga0495580_0007152_2372_4018 | 518 |
| 399 | 3300046531 | Ga0495665_0014551 | Ga0495665_0014551_2461_4095 | 518 |
| 400 | 3300046684 | Ga0495669_0028301 | Ga0495669_0028301_314_1948 | 518 |
| 401 | 3300046689 | Ga0495613_0007406 | Ga0495613_0007406_5371_6999 | 518 |
| 402 | 3300048915 | Ga0496112_0009917 | Ga0496112_0009917_3120_4760 | 518 |
| 403 | 3300050512 | nmdc:mga0n895_12303_c1 | nmdc:mga0n895_12303_c1_5597_7219 | 518 |
| 404 | 3300050513 | nmdc:mga0rr50_6394_c1 | nmdc:mga0rr50_6394_c1_5317_6939 | 518 |
| 405 | 3300005327 | Ga0070658_10027582 | Ga0070658_100275823 | 519 |
| 406 | 3300005327 | Ga0070658_10043442 | Ga0070658_100434422 | 519 |
| 407 | 3300005329 | Ga0070683_100004771 | Ga0070683_1000047717 | 519 |
| 408 | 3300005336 | Ga0070680_100057450 | Ga0070680_1000574501 | 519 |
| 409 | 3300005339 | Ga0070660_100005907 | Ga0070660_1000059078 | 519 |
| 410 | 3300005339 | Ga0070660_100020550 | Ga0070660_1000205505 | 519 |
| 411 | 3300005344 | Ga0070661_100034547 | Ga0070661_1000345473 | 519 |
| 412 | 3300005458 | Ga0070681_10002214 | Ga0070681_100022146 | 519 |
| 413 | 3300005458 | Ga0070681_10003473 | Ga0070681_100034734 | 519 |
| 414 | 3300005530 | Ga0070679_100000327 | Ga0070679_10000032715 | 519 |
| 415 | 3300005530 | Ga0070679_100010134 | Ga0070679_1000101345 | 519 |
| 416 | 3300005545 | Ga0070695_100001059 | Ga0070695_1000010596 | 519 |
| 417 | 3300005563 | Ga0068855_100032252 | Ga0068855_1000322526 | 519 |
| 418 | 3300005563 | Ga0068855_100039129 | Ga0068855_1000391294 | 519 |
| 419 | 3300005577 | Ga0068857_100008356 | Ga0068857_1000083565 | 519 |
| 420 | 3300005577 | Ga0068857_100032487 | Ga0068857_1000324872 | 519 |
| 421 | 3300005578 | Ga0068854_100038957 | Ga0068854_1000389572 | 519 |
| 422 | 3300005614 | Ga0068856_100009823 | Ga0068856_1000098233 | 519 |
| 423 | 3300005616 | Ga0068852_100004628 | Ga0068852_10000462810 | 519 |
| 424 | 3300009093 | Ga0105240_10002877 | Ga0105240_1000287712 | 519 |
| 425 | 3300009093 | Ga0105240_10051192 | Ga0105240_100511922 | 519 |
| 426 | 3300009545 | Ga0105237_10007734 | Ga0105237_100077342 | 519 |
| 427 | 3300009551 | Ga0105238_10007685 | Ga0105238_100076856 | 519 |
| 428 | 3300009551 | Ga0105238_10014246 | Ga0105238_100142466 | 519 |
| 429 | 3300013102 | Ga0157371_10054559 | Ga0157371_100545591 | 519 |
| 430 | 3300013104 | Ga0157370_10002254 | Ga0157370_1000225414 | 519 |
| 431 | 3300013105 | Ga0157369_10011416 | Ga0157369_100114166 | 519 |
| 432 | 3300013307 | Ga0157372_10000125 | Ga0157372_1000012556 | 519 |
| 433 | 3300025909 | Ga0207705_10002757 | Ga0207705_100027574 | 519 |
| 434 | 3300025912 | Ga0207707_10008348 | Ga0207707_100083485 | 519 |
| 435 | 3300025912 | Ga0207707_10091905 | Ga0207707_100919052 | 519 |
| 436 | 3300025913 | Ga0207695_10001093 | Ga0207695_1000109312 | 519 |
| 437 | 3300025919 | Ga0207657_10002194 | Ga0207657_100021949 | 519 |
| 438 | 3300025919 | Ga0207657_10008065 | Ga0207657_100080657 | 519 |
| 439 | 3300025921 | Ga0207652_10006183 | Ga0207652_100061834 | 519 |
| 440 | 3300025924 | Ga0207694_10001478 | Ga0207694_100014786 | 519 |
| 441 | 3300025932 | Ga0207690_10006311 | Ga0207690_100063115 | 519 |
| 442 | 3300025944 | Ga0207661_10077319 | Ga0207661_100773192 | 519 |
| 443 | 3300025949 | Ga0207667_10000123 | Ga0207667_1000012328 | 519 |
| 444 | 3300025949 | Ga0207667_10028027 | Ga0207667_100280275 | 519 |
| 445 | 3300026067 | Ga0207678_10006379 | Ga0207678_100063792 | 519 |
| 446 | 3300026116 | Ga0207674_10006007 | Ga0207674_100060074 | 519 |
| 447 | 3300026116 | Ga0207674_10035662 | Ga0207674_100356625 | 519 |
| 448 | 3300026142 | Ga0207698_10004145 | Ga0207698_100041455 | 519 |
| 449 | 3300036401 | Ga0373937_0005073 | Ga0373937_0005073_6457_8112 | 519 |
| 450 | 3300038443 | Ga0395901_0104883 | Ga0395901_0104883_253_1881 | 519 |
| 451 | 3300046684 | Ga0495669_0021164 | Ga0495669_0021164_924_2561 | 519 |
| 452 | 3300049589 | Ga0501073_0043084 | Ga0501073_0043084_467_2104 | 519 |
| 453 | 3300053103 | Ga0500555_001047 | Ga0500555_001047_2444_4066 | 519 |
| 454 | 3300053730 | Ga0500645_002423 | Ga0500645_002423_2448_4070 | 519 |
| 455 | 3300005327 | Ga0070658_10000010 | Ga0070658_10000010110 | 520 |
| 456 | 3300005435 | Ga0070714_100117168 | Ga0070714_1001171682 | 520 |
| 457 | 3300005535 | Ga0070684_100043366 | Ga0070684_1000433662 | 520 |
| 458 | 3300005563 | Ga0068855_100065797 | Ga0068855_1000657972 | 520 |
| 459 | 3300006881 | Ga0068865_100082825 | Ga0068865_1000828252 | 520 |
| 460 | 3300007265 | Ga0099794_10011502 | Ga0099794_100115022 | 520 |
| 461 | 3300009093 | Ga0105240_10209187 | Ga0105240_102091872 | 520 |
| 462 | 3300013104 | Ga0157370_10029113 | Ga0157370_100291134 | 520 |
| 463 | 3300013105 | Ga0157369_10118493 | Ga0157369_101184933 | 520 |
| 464 | 3300013307 | Ga0157372_10010413 | Ga0157372_100104133 | 520 |
| 465 | 3300025909 | Ga0207705_10000016 | Ga0207705_10000016176 | 520 |
| 466 | 3300025938 | Ga0207704_10004923 | Ga0207704_100049236 | 520 |
| 467 | 3300026067 | Ga0207678_10000102 | Ga0207678_1000010257 | 520 |
| 468 | 3300027671 | Ga0209588_1002342 | Ga0209588_10023423 | 520 |
| 469 | 3300027671 | Ga0209588_1015655 | Ga0209588_10156552 | 520 |
| 470 | 3300028800 | Ga0265338_10114654 | Ga0265338_101146542 | 520 |
| 471 | 3300005458 | Ga0070681_10010707 | Ga0070681_100107074 | 521 |
| 472 | 3300005544 | Ga0070686_100002740 | Ga0070686_1000027402 | 521 |
| 473 | 3300005548 | Ga0070665_100002180 | Ga0070665_1000021806 | 521 |
| 474 | 3300024227 | Ga0228598_1000409 | Ga0228598_10004098 | 521 |
| 475 | 3300025893 | Ga0207682_10024110 | Ga0207682_100241101 | 521 |
| 476 | 3300025912 | Ga0207707_10100155 | Ga0207707_101001552 | 521 |
| 477 | 3300025924 | Ga0207694_10071576 | Ga0207694_100715762 | 521 |
| 478 | 3300025941 | Ga0207711_10083347 | Ga0207711_100833472 | 521 |
| 479 | 3300025944 | Ga0207661_10045545 | Ga0207661_100455453 | 521 |
| 480 | 3300026121 | Ga0207683_10004353 | Ga0207683_100043538 | 521 |
| 481 | 3300028379 | Ga0268266_10032306 | Ga0268266_100323064 | 521 |
| 482 | 3300028379 | Ga0268266_10033892 | Ga0268266_100338922 | 521 |
| 483 | 3300046543 | Ga0495645_0001271 | Ga0495645_0001271_8913_10535 | 521 |
| 484 | 3300047471 | Ga0495684_0050536 | Ga0495684_0050536_905_2542 | 521 |
| 485 | 3300048913 | Ga0496110_0061495 | Ga0496110_0061495_786_2408 | 521 |
| 486 | 3300005439 | Ga0070711_100003054 | Ga0070711_1000030544 | 522 |
| 487 | 3300005439 | Ga0070711_100014844 | Ga0070711_1000148444 | 522 |
| 488 | 3300009094 | Ga0111539_10020976 | Ga0111539_100209763 | 522 |
| 489 | 3300009545 | Ga0105237_10037757 | Ga0105237_100377574 | 522 |
| 490 | 3300013307 | Ga0157372_10028289 | Ga0157372_100282893 | 522 |
| 491 | 3300025906 | Ga0207699_10025017 | Ga0207699_100250172 | 522 |
| 492 | 3300025923 | Ga0207681_10000044 | Ga0207681_1000004434 | 522 |
| 493 | 3300027671 | Ga0209588_1013405 | Ga0209588_10134052 | 522 |
| 494 | 3300027876 | Ga0209974_10001602 | Ga0209974_100016026 | 522 |
| 495 | 3300031616 | Ga0307508_10014924 | Ga0307508_100149249 | 522 |
| 496 | 3300035692 | Ga0373935_0000591 | Ga0373935_0000591_2348_4024 | 522 |
| 497 | 3300048917 | Ga0496114_0000031 | Ga0496114_0000031_140910_142583 | 522 |
| 498 | 3300050511 | nmdc:mga08y16_36066_c1 | nmdc:mga08y16_36066_c1_1170_2795 | 522 |
| 499 | 3300005614 | Ga0068856_100023859 | Ga0068856_1000238596 | 523 |
| 500 | 3300014968 | Ga0157379_10000346 | Ga0157379_100003463 | 523 |
| 501 | 3300035725 | Ga0373947_0006738 | Ga0373947_0006738_4121_5758 | 523 |
| 502 | 3300036401 | Ga0373937_0013628 | Ga0373937_0013628_3445_5064 | 523 |
| 503 | 3300037068 | Ga0373925_0010712 | Ga0373925_0010712_95_1732 | 523 |
| 504 | 3300046472 | Ga0495580_0003395 | Ga0495580_0003395_4956_6593 | 523 |
| 505 | 3300053119 | Ga0500595_000039 | Ga0500595_000039_52491_54146 | 523 |
| 506 | 3300005458 | Ga0070681_10000261 | Ga0070681_100002617 | 524 |
| 507 | 3300005530 | Ga0070679_100003583 | Ga0070679_1000035834 | 524 |
| 508 | 3300005535 | Ga0070684_100016031 | Ga0070684_1000160314 | 524 |
| 509 | 3300005545 | Ga0070695_100034537 | Ga0070695_1000345375 | 524 |
| 510 | 3300005981 | Ga0081538_10003485 | Ga0081538_1000348510 | 524 |
| 511 | 3300009093 | Ga0105240_10133163 | Ga0105240_101331633 | 524 |
| 512 | 3300009098 | Ga0105245_10100566 | Ga0105245_101005662 | 524 |
| 513 | 3300013297 | Ga0157378_10059811 | Ga0157378_100598112 | 524 |
| 514 | 3300025912 | Ga0207707_10000003 | Ga0207707_10000003362 | 524 |
| 515 | 3300025912 | Ga0207707_10175375 | Ga0207707_101753752 | 524 |
| 516 | 3300025913 | Ga0207695_10087992 | Ga0207695_100879922 | 524 |
| 517 | 3300025921 | Ga0207652_10000024 | Ga0207652_1000002420 | 524 |
| 518 | 3300025944 | Ga0207661_10048712 | Ga0207661_100487122 | 524 |
| 519 | 3300035241 | Ga0373961_0000297 | Ga0373961_0000297_9868_11550 | 524 |
| 520 | 3300036401 | Ga0373937_0000340 | Ga0373937_0000340_24408_26045 | 524 |
| 521 | 3300048905 | Ga0496102_0098945 | Ga0496102_0098945_630_2267 | 524 |
| 522 | 3300048915 | Ga0496112_0011999 | Ga0496112_0011999_4789_6426 | 524 |
| 523 | 3300006846 | Ga0075430_100035481 | Ga0075430_1000354812 | 525 |
| 524 | 3300035171 | Ga0373946_0004832 | Ga0373946_0004832_508_2190 | 525 |
| 525 | 3300035695 | Ga0373927_0001772 | Ga0373927_0001772_12386_14068 | 525 |
| 526 | 3300035725 | Ga0373947_0004469 | Ga0373947_0004469_1681_3363 | 525 |
| 527 | 3300037068 | Ga0373925_0000615 | Ga0373925_0000615_2617_4299 | 525 |
| 528 | 3300037418 | Ga0395900_0029601 | Ga0395900_0029601_1828_3504 | 525 |
| 529 | 3300049592 | Ga0501076_0083010 | Ga0501076_0083010_431_2059 | 525 |
| 530 | 3300050514 | nmdc:mga08x19_16488_c1 | nmdc:mga08x19_16488_c1_2357_4039 | 525 |
| 531 | iso_pu_bacteria | 2595698237 | 2596374901 | 525 |
| 532 | iso_pu_bacteria | 2889306138 | 2889306534 | 525 |
| 533 | iso_pu_bacteria | 2902330777 | 2902332357 | 525 |
| 534 | iso_pu_bacteria | 2902405164 | 2902411473 | 525 |
| 535 | iso_pu_bacteria | 2928125067 | 2928129824 | 525 |
| 536 | 3300005336 | Ga0070680_100026993 | Ga0070680_1000269931 | 526 |
| 537 | 3300005406 | Ga0070703_10006223 | Ga0070703_100062233 | 526 |
| 538 | 3300005436 | Ga0070713_100000907 | Ga0070713_10000090710 | 526 |
| 539 | 3300005444 | Ga0070694_100002730 | Ga0070694_1000027302 | 526 |
| 540 | 3300005445 | Ga0070708_100011685 | Ga0070708_1000116853 | 526 |
| 541 | 3300005445 | Ga0070708_100088845 | Ga0070708_1000888451 | 526 |
| 542 | 3300005467 | Ga0070706_100038332 | Ga0070706_1000383324 | 526 |
| 543 | 3300005467 | Ga0070706_100110895 | Ga0070706_1001108952 | 526 |
| 544 | 3300005471 | Ga0070698_100000236 | Ga0070698_10000023622 | 526 |
| 545 | 3300005518 | Ga0070699_100069043 | Ga0070699_1000690433 | 526 |
| 546 | 3300005530 | Ga0070679_100034853 | Ga0070679_1000348534 | 526 |
| 547 | 3300005536 | Ga0070697_100001253 | Ga0070697_10000125314 | 526 |
| 548 | 3300005545 | Ga0070695_100011378 | Ga0070695_1000113785 | 526 |
| 549 | 3300005546 | Ga0070696_100054662 | Ga0070696_1000546622 | 526 |
| 550 | 3300005547 | Ga0070693_100000102 | Ga0070693_10000010222 | 526 |
| 551 | 3300005549 | Ga0070704_100001455 | Ga0070704_10000145512 | 526 |
| 552 | 3300005549 | Ga0070704_100036561 | Ga0070704_1000365612 | 526 |
| 553 | 3300005563 | Ga0068855_100035466 | Ga0068855_1000354664 | 526 |
| 554 | 3300005843 | Ga0068860_100003559 | Ga0068860_1000035595 | 526 |
| 555 | 3300006173 | Ga0070716_100000297 | Ga0070716_1000002976 | 526 |
| 556 | 3300006173 | Ga0070716_100005379 | Ga0070716_1000053794 | 526 |
| 557 | 3300006847 | Ga0075431_100023037 | Ga0075431_1000230372 | 526 |
| 558 | 3300006852 | Ga0075433_10004780 | Ga0075433_100047804 | 526 |
| 559 | 3300006871 | Ga0075434_100001703 | Ga0075434_1000017034 | 526 |
| 560 | 3300007265 | Ga0099794_10013424 | Ga0099794_100134244 | 526 |
| 561 | 3300013297 | Ga0157378_10000915 | Ga0157378_1000091512 | 526 |
| 562 | 3300014969 | Ga0157376_10002022 | Ga0157376_100020229 | 526 |
| 563 | 3300025885 | Ga0207653_10007131 | Ga0207653_100071313 | 526 |
| 564 | 3300025910 | Ga0207684_10010867 | Ga0207684_100108676 | 526 |
| 565 | 3300025917 | Ga0207660_10054259 | Ga0207660_100542591 | 526 |
| 566 | 3300025922 | Ga0207646_10011190 | Ga0207646_100111906 | 526 |
| 567 | 3300025928 | Ga0207700_10003312 | Ga0207700_100033126 | 526 |
| 568 | 3300025939 | Ga0207665_10000020 | Ga0207665_1000002069 | 526 |
| 569 | 3300025939 | Ga0207665_10004248 | Ga0207665_100042487 | 526 |
| 570 | 3300025939 | Ga0207665_10030902 | Ga0207665_100309023 | 526 |
| 571 | 3300028016 | Ga0265354_1000380 | Ga0265354_10003803 | 526 |
| 572 | 3300030879 | Ga0265765_1000017 | Ga0265765_10000173 | 526 |
| 573 | 3300031090 | Ga0265760_10000038 | Ga0265760_100000384 | 526 |
| 574 | 3300035118 | Ga0373954_0001152 | Ga0373954_0001152_7578_9257 | 526 |
| 575 | 3300035119 | Ga0373956_0003549 | Ga0373956_0003549_4086_5765 | 526 |
| 576 | 3300035120 | Ga0373957_0002185 | Ga0373957_0002185_3222_4901 | 526 |
| 577 | 3300036401 | Ga0373937_0004081 | Ga0373937_0004081_8256_9935 | 526 |
| 578 | 3300037068 | Ga0373925_0080403 | Ga0373925_0080403_673_2355 | 526 |
| 579 | 3300046472 | Ga0495580_0021725 | Ga0495580_0021725_166_1848 | 526 |
| 580 | 3300046499 | Ga0495594_0007810 | Ga0495594_0007810_2465_4147 | 526 |
| 581 | 3300046511 | Ga0495608_0012838 | Ga0495608_0012838_2512_4191 | 526 |
| 582 | 3300046517 | Ga0495630_0069437 | Ga0495630_0069437_251_1933 | 526 |
| 583 | 3300046535 | Ga0495586_0017915 | Ga0495586_0017915_2024_3706 | 526 |
| 584 | 3300046536 | Ga0495587_0006021 | Ga0495587_0006021_4242_5921 | 526 |
| 585 | 3300046642 | Ga0495634_0014457 | Ga0495634_0014457_3699_5381 | 526 |
| 586 | 3300046679 | Ga0495623_0016226 | Ga0495623_0016226_2754_4433 | 526 |
| 587 | 3300046683 | Ga0495658_0032729 | Ga0495658_0032729_729_2411 | 526 |
| 588 | 3300046689 | Ga0495613_0074590 | Ga0495613_0074590_716_2398 | 526 |
| 589 | 3300047317 | Ga0495604_0007016 | Ga0495604_0007016_4913_6592 | 526 |
| 590 | 3300047319 | Ga0495674_0036665 | Ga0495674_0036665_825_2507 | 526 |
| 591 | 3300047471 | Ga0495684_0029266 | Ga0495684_0029266_2411_4090 | 526 |
| 592 | 3300048088 | Ga0495602_0026633 | Ga0495602_0026633_1294_2973 | 526 |
| 593 | 3300048905 | Ga0496102_0000997 | Ga0496102_0000997_12108_13781 | 526 |
| 594 | 3300050512 | nmdc:mga0n895_17278_c1 | nmdc:mga0n895_17278_c1_2390_4024 | 526 |
| 595 | 3300050513 | nmdc:mga0rr50_16574_c1 | nmdc:mga0rr50_16574_c1_205_1839 | 526 |
| 596 | 3300050515 | nmdc:mga0a205_1777_c1 | nmdc:mga0a205_1777_c1_9224_10858 | 526 |
| 597 | 3300053077 | Ga0495601_0003196 | Ga0495601_0003196_366_2045 | 526 |
| 598 | iso_pu_bacteria | 2738543032 | 2739356750 | 526 |
| 599 | 3300005536 | Ga0070697_100036116 | Ga0070697_1000361161 | 527 |
| 600 | 3300025939 | Ga0207665_10024622 | Ga0207665_100246222 | 527 |
| 601 | 3300005434 | Ga0070709_10050905 | Ga0070709_100509052 | 528 |
| 602 | 3300005841 | Ga0068863_100007676 | Ga0068863_1000076767 | 528 |
| 603 | 3300005842 | Ga0068858_100068455 | Ga0068858_1000684553 | 528 |
| 604 | 3300006358 | Ga0068871_100023496 | Ga0068871_1000234964 | 528 |
| 605 | 3300006871 | Ga0075434_100007292 | Ga0075434_1000072928 | 528 |
| 606 | 3300014969 | Ga0157376_10000005 | Ga0157376_1000000598 | 528 |
| 607 | 3300025939 | Ga0207665_10020602 | Ga0207665_100206024 | 528 |
| 608 | 3300026088 | Ga0207641_10008320 | Ga0207641_100083204 | 528 |
| 609 | 3300028381 | Ga0268264_10112011 | Ga0268264_101120112 | 528 |
| 610 | 3300046472 | Ga0495580_0003222 | Ga0495580_0003222_9908_11542 | 528 |
| 611 | 3300048918 | Ga0496115_0001061 | Ga0496115_0001061_2463_4157 | 528 |
| 612 | 3300050512 | nmdc:mga0n895_60541_c1 | nmdc:mga0n895_60541_c1_373_2067 | 528 |
| 613 | 3300050515 | nmdc:mga0a205_73990_c1 | nmdc:mga0a205_73990_c1_199_1830 | 528 |
| 614 | 3300005536 | Ga0070697_100033366 | Ga0070697_1000333662 | 529 |
| 615 | 3300005548 | Ga0070665_100001198 | Ga0070665_1000011988 | 529 |
| 616 | 3300005937 | Ga0081455_10000777 | Ga0081455_1000077732 | 529 |
| 617 | 3300005981 | Ga0081538_10014573 | Ga0081538_100145734 | 529 |
| 618 | 3300007076 | Ga0075435_100097171 | Ga0075435_1000971712 | 529 |
| 619 | 3300009101 | Ga0105247_10044304 | Ga0105247_100443042 | 529 |
| 620 | 3300009147 | Ga0114129_10009458 | Ga0114129_100094585 | 529 |
| 621 | 3300009545 | Ga0105237_10160182 | Ga0105237_101601822 | 529 |
| 622 | 3300013308 | Ga0157375_10151509 | Ga0157375_101515092 | 529 |
| 623 | 3300028379 | Ga0268266_10000661 | Ga0268266_1000066117 | 529 |
| 624 | 3300028381 | Ga0268264_10035546 | Ga0268264_100355464 | 529 |
| 625 | 3300046472 | Ga0495580_0001149 | Ga0495580_0001149_15489_17186 | 529 |
| 626 | 3300046473 | Ga0495582_0009311 | Ga0495582_0009311_1440_3137 | 529 |
| 627 | 3300050507 | nmdc:mga05p37_2525_c1 | nmdc:mga05p37_2525_c1_4285_5925 | 529 |
| 628 | 3300050512 | nmdc:mga0n895_41796_c1 | nmdc:mga0n895_41796_c1_315_2012 | 529 |
| 629 | 3300050513 | nmdc:mga0rr50_45870_c1 | nmdc:mga0rr50_45870_c1_412_2109 | 529 |
| 630 | 3300005518 | Ga0070699_100029983 | Ga0070699_1000299832 | 530 |
| 631 | 3300005289 | Ga0065704_10011117 | Ga0065704_100111172 | 531 |
| 632 | 3300005290 | Ga0065712_10068711 | Ga0065712_100687112 | 531 |
| 633 | 3300005293 | Ga0065715_10116775 | Ga0065715_101167752 | 531 |
| 634 | 3300005295 | Ga0065707_10102087 | Ga0065707_101020872 | 531 |
| 635 | 3300005335 | Ga0070666_10006111 | Ga0070666_100061112 | 531 |
| 636 | 3300005336 | Ga0070680_100056287 | Ga0070680_1000562874 | 531 |
| 637 | 3300005339 | Ga0070660_100007349 | Ga0070660_1000073494 | 531 |
| 638 | 3300005341 | Ga0070691_10056091 | Ga0070691_100560911 | 531 |
| 639 | 3300005344 | Ga0070661_100012735 | Ga0070661_1000127354 | 531 |
| 640 | 3300005353 | Ga0070669_100011901 | Ga0070669_1000119014 | 531 |
| 641 | 3300005354 | Ga0070675_100068417 | Ga0070675_1000684173 | 531 |
| 642 | 3300005355 | Ga0070671_100009092 | Ga0070671_1000090922 | 531 |
| 643 | 3300005355 | Ga0070671_100030645 | Ga0070671_1000306452 | 531 |
| 644 | 3300005364 | Ga0070673_100051111 | Ga0070673_1000511112 | 531 |
| 645 | 3300005366 | Ga0070659_100024406 | Ga0070659_1000244064 | 531 |
| 646 | 3300005456 | Ga0070678_100019606 | Ga0070678_1000196063 | 531 |
| 647 | 3300005457 | Ga0070662_100011219 | Ga0070662_1000112195 | 531 |
| 648 | 3300005457 | Ga0070662_100063297 | Ga0070662_1000632972 | 531 |
| 649 | 3300005458 | Ga0070681_10013899 | Ga0070681_100138998 | 531 |
| 650 | 3300005471 | Ga0070698_100142906 | Ga0070698_1001429062 | 531 |
| 651 | 3300005530 | Ga0070679_100013022 | Ga0070679_1000130225 | 531 |
| 652 | 3300005536 | Ga0070697_100103873 | Ga0070697_1001038731 | 531 |
| 653 | 3300005564 | Ga0070664_100000830 | Ga0070664_10000083013 | 531 |
| 654 | 3300005617 | Ga0068859_100171430 | Ga0068859_1001714302 | 531 |
| 655 | 3300005843 | Ga0068860_100045562 | Ga0068860_1000455622 | 531 |
| 656 | 3300006058 | Ga0075432_10005885 | Ga0075432_100058852 | 531 |
| 657 | 3300006844 | Ga0075428_100045517 | Ga0075428_1000455176 | 531 |
| 658 | 3300006846 | Ga0075430_100038743 | Ga0075430_1000387433 | 531 |
| 659 | 3300006847 | Ga0075431_100148741 | Ga0075431_1001487412 | 531 |
| 660 | 3300006852 | Ga0075433_10072540 | Ga0075433_100725403 | 531 |
| 661 | 3300006852 | Ga0075433_10082392 | Ga0075433_100823922 | 531 |
| 662 | 3300006880 | Ga0075429_100052768 | Ga0075429_1000527682 | 531 |
| 663 | 3300006914 | Ga0075436_100036828 | Ga0075436_1000368283 | 531 |
| 664 | 3300006931 | Ga0097620_100171420 | Ga0097620_1001714202 | 531 |
| 665 | 3300007076 | Ga0075435_100037178 | Ga0075435_1000371783 | 531 |
| 666 | 3300009094 | Ga0111539_10032522 | Ga0111539_100325223 | 531 |
| 667 | 3300013100 | Ga0157373_10092562 | Ga0157373_100925622 | 531 |
| 668 | 3300013296 | Ga0157374_10120964 | Ga0157374_101209642 | 531 |
| 669 | 3300013297 | Ga0157378_10007804 | Ga0157378_100078044 | 531 |
| 670 | 3300013306 | Ga0163162_10149096 | Ga0163162_101490963 | 531 |
| 671 | 3300025315 | Ga0207697_10023558 | Ga0207697_100235582 | 531 |
| 672 | 3300025907 | Ga0207645_10001511 | Ga0207645_1000151116 | 531 |
| 673 | 3300025912 | Ga0207707_10031062 | Ga0207707_100310622 | 531 |
| 674 | 3300025912 | Ga0207707_10096586 | Ga0207707_100965863 | 531 |
| 675 | 3300025917 | Ga0207660_10041799 | Ga0207660_100417992 | 531 |
| 676 | 3300025919 | Ga0207657_10007180 | Ga0207657_100071803 | 531 |
| 677 | 3300025921 | Ga0207652_10003474 | Ga0207652_100034744 | 531 |
| 678 | 3300025923 | Ga0207681_10014504 | Ga0207681_100145043 | 531 |
| 679 | 3300025925 | Ga0207650_10001148 | Ga0207650_100011484 | 531 |
| 680 | 3300025931 | Ga0207644_10025878 | Ga0207644_100258782 | 531 |
| 681 | 3300025932 | Ga0207690_10009340 | Ga0207690_100093405 | 531 |
| 682 | 3300025933 | Ga0207706_10024322 | Ga0207706_100243223 | 531 |
| 683 | 3300025933 | Ga0207706_10078919 | Ga0207706_100789192 | 531 |
| 684 | 3300025940 | Ga0207691_10022008 | Ga0207691_100220083 | 531 |
| 685 | 3300025945 | Ga0207679_10000457 | Ga0207679_100004579 | 531 |
| 686 | 3300025949 | Ga0207667_10087272 | Ga0207667_100872722 | 531 |
| 687 | 3300027682 | Ga0209971_1009224 | Ga0209971_10092242 | 531 |
| 688 | 3300027876 | Ga0209974_10002919 | Ga0209974_100029195 | 531 |
| 689 | 3300031241 | Ga0265325_10003991 | Ga0265325_100039916 | 531 |
| 690 | 3300031249 | Ga0265339_10031676 | Ga0265339_100316762 | 531 |
| 691 | 3300037068 | Ga0373925_0024619 | Ga0373925_0024619_1054_2697 | 531 |
| 692 | 3300042876 | Ga0451577_0118145 | Ga0451577_0118145_455_2101 | 531 |
| 693 | 3300049572 | Ga0501036_0019842 | Ga0501036_0019842_1720_3363 | 531 |
| 694 | 3300049573 | Ga0501037_0039371 | Ga0501037_0039371_663_2306 | 531 |
| 695 | 3300049574 | Ga0501038_0004670 | Ga0501038_0004670_5237_6880 | 531 |
| 696 | 3300049575 | Ga0501039_0000444 | Ga0501039_0000444_9247_10890 | 531 |
| 697 | 3300049576 | Ga0501040_0002905 | Ga0501040_0002905_2834_4477 | 531 |
| 698 | 3300049577 | Ga0501041_0003652 | Ga0501041_0003652_1277_2920 | 531 |
| 699 | 3300049578 | Ga0501042_0000113 | Ga0501042_0000113_17986_19629 | 531 |
| 700 | 3300049580 | Ga0501046_0003595 | Ga0501046_0003595_4042_5751 | 531 |
| 701 | 3300049584 | Ga0501068_0001152 | Ga0501068_0001152_5488_7131 | 531 |
| 702 | 3300049587 | Ga0501071_0004316 | Ga0501071_0004316_4904_6547 | 531 |
| 703 | 3300049588 | Ga0501072_0001120 | Ga0501072_0001120_8996_10639 | 531 |
| 704 | 3300049591 | Ga0501075_0001035 | Ga0501075_0001035_6911_8554 | 531 |
| 705 | 3300049592 | Ga0501076_0001002 | Ga0501076_0001002_9295_10938 | 531 |
| 706 | 3300049741 | Ga0501079_0002646 | Ga0501079_0002646_1405_3048 | 531 |
| 707 | 3300049742 | Ga0501080_0009479 | Ga0501080_0009479_1197_2840 | 531 |
| 708 | 3300049743 | Ga0501081_0000575 | Ga0501081_0000575_9930_11573 | 531 |
| 709 | 3300050508 | nmdc:mga09592_82961_c1 | nmdc:mga09592_82961_c1_505_2148 | 531 |
| 710 | 3300050510 | nmdc:mga06r32_77178_c1 | nmdc:mga06r32_77178_c1_1422_3062 | 531 |
| 711 | 3300050512 | nmdc:mga0n895_36604_c1 | nmdc:mga0n895_36604_c1_2248_3894 | 531 |
| 712 | 3300050515 | nmdc:mga0a205_43485_c1 | nmdc:mga0a205_43485_c1_2182_3828 | 531 |
| 713 | 3300054114 | Ga0501084_0004456 | Ga0501084_0004456_2482_4125 | 531 |
| 714 | 3300061734 | Ga0530510_0015151 | Ga0530510_0015151_1344_2987 | 531 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3abk-assembly1.cif.gz_A | bovine heart cytochrome c oxidase at the no-bound fully reduced state (50k) | 0.9093 | 19 | 509 |
| 3omi-assembly2.cif.gz_C | catalytic core subunits (i and ii) of cytochrome c oxidase from rhodobacter sphaeroides with d132a mutation | 0.9092 | 22 | 498 |
| 1m57-assembly2.cif.gz_G | structure of cytochrome c oxidase from rhodobacter sphaeroides (eq(i-286) mutant)) | 0.9081 | 17 | 507 |
| 8c8q-assembly1.cif.gz_A | cytochrome c oxidase from schizosaccharomyces pombe | 0.9079 | 19 | 510 |
| 6pw1-assembly2.cif.gz_C | cytochrome c oxidase delta 16 | 0.9053 | 21 | 498 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q7HP04_41_512_1.20.210.10 | Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain | 0.9007 | 20 | 464 | 1.20.210.10 |
| af_Q2FZK0_30_556_1.20.210.10 | Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain | 0.8989 | 20 | 509 | 1.20.210.10 |
| 2yevD01 | Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain | 0.8884 | 20 | 514 | 1.20.210.10 |
| af_P9WP71_20_544_1.20.210.10 | Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain | 0.8849 | 16 | 516 | 1.20.210.10 |
| af_O21042_10_509_1.20.210.10 | Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain | 0.8775 | 21 | 471 | 1.20.210.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A351NZH6-F1-model_v4 | Cytochrome o ubiquinol oxidase subunit I | 0.961 | 217 | 354 |
GO:0004129
GO:0005886 GO:0009060 GO:0009486 GO:0015990 GO:0020037 GO:0022904 |
| AF-A0A3D2M157-F1-model_v4 | Cytochrome c oxidase subunit I | 0.9531 | 243 | 508 |
GO:0004129
GO:0009060 GO:0015990 GO:0016020 GO:0020037 GO:0022904 |
| AF-F2YID4-F1-model_v4 | Cytochrome c oxidase subunit 1 (EC 7.1.1.9) | 0.9531 | 217 | 426 |
GO:0004129
GO:0005743 GO:0006123 GO:0015990 GO:0020037 GO:0046872 |
| AF-A0A422QD25-F1-model_v4 | Cytochrome oxidase subunit I | 0.9514 | 236 | 425 |
GO:0004129
GO:0009060 GO:0015990 GO:0016020 GO:0020037 GO:0022904 |
| AF-M4M3I1-F1-model_v4 | Cytochrome c oxidase subunit 1 (EC 7.1.1.9) | 0.9512 | 220 | 426 |
GO:0004129
GO:0005743 GO:0006123 GO:0015990 GO:0020037 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar