F476925

General Info

Members Datasets Scaffolds Average Seq Length
714 405 1428 232

Family's Representative Sequence

Representative Sequence 3300005439|Ga0070711_100274834|Ga0070711_1002748342
Length 253
Sequence MTEAQSRLAATRVGDNRSVVSMSIANSIRAQIPPVHPEGYPFIGGFALASLILFWIWTPLGWLGTLLTIWCALFFRDPVRVTPVREGIVVAPADGRISMVTQVLPPAELALGDKPLPRISIFMSVFNCHVNRSPAAGRIDRIAYRPGTFVNAELDKASEDNERNSLVISTPNGRIGVIQIAGLVARRIVSFVREGQSIGTGERFGLIRFGSRLDVYLPEGTRALVSEGQTAVAGETILADFRLGEDGRSFRPD

Samples

Sample ID Description Type Environment
1 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
60 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
64 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
65 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
71 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
72 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
73 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
74 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
83 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
86 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
87 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
88 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
115 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
116 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
117 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
168 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
169 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
170 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
172 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
176 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
177 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
178 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
179 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
180 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
181 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
182 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
183 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
184 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
185 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
186 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
187 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
188 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
189 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
190 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
191 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
192 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
193 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
194 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
195 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
196 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
197 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
198 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
199 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
200 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
201 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
202 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
203 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
204 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
205 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
206 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
207 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
208 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
209 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
210 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
211 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
212 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
213 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
214 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
215 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
216 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
217 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
218 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
219 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
220 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
221 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
222 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
223 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
224 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
225 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
226 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
227 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
228 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
229 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
230 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
231 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
232 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
233 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
234 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
235 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
236 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
237 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
238 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
239 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
240 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
241 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
242 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
243 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
244 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
245 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
246 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
247 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
248 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
249 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
250 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
251 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
252 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
253 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
254 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
255 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
256 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
257 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
258 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
259 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
260 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
261 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
262 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
263 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
264 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
265 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
266 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
267 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
268 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
269 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
270 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
271 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
272 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
273 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
274 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
275 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
276 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
277 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
278 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
279 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
280 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
281 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
282 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
283 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
284 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
285 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
286 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
287 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
288 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
289 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
290 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
291 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
292 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
293 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
294 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
295 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
296 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
297 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
298 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
299 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
300 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
301 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
302 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
303 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
304 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
305 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
306 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
307 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
308 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
309 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
310 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
311 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
312 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
313 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
314 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
315 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
316 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
317 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
320 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
321 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
322 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
323 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
324 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
325 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
326 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
327 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
328 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
329 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
330 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
331 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
332 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
333 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
334 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
335 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
336 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
337 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
338 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
339 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
340 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
341 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
342 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
343 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
344 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
345 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
346 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
347 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
348 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
349 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
350 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
351 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
352 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
353 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
354 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
355 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
356 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
357 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
358 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
359 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
360 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
361 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
362 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
363 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
364 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
365 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
366 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
367 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
368 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
369 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
370 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
371 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
372 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
373 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
374 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
375 2791355199
376 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
377 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
378 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
379 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
380 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
381 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
382 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
383 2904699407
384 2906610324
385 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
386 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
387 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
388 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
389 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
390 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
391 2922425934
392 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
393 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
394 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
395 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
396 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
397 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
398 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
399 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
400 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
401 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
402 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
403 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
404 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
405 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.08
Metatranscriptomes 0.28
Isolates 5.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.42
Nodule 5.32
Rhizoplane 7.28
Rhizosphere 73.95
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070711_100274834 3300005439 Bacteria 1331
2 JGI25153J46596_10002102 3300003215 Bacteria 11668
3 JGI25404J52841_10002404 3300003659 Bacteria 3534
4 JGI25404J52841_10002915 3300003659 Bacteria 3315
5 JGI25405J52794_10008076 3300003911 Bacteria 1956
6 Ga0070676_10291185 3300005328 Bacteria 1103
7 Ga0070683_100110038 3300005329 Bacteria 2599
8 Ga0070683_100198458 3300005329 Bacteria 1905
9 Ga0070690_100063213 3300005330 Bacteria 2388
10 Ga0070670_100121850 3300005331 Bacteria 2250
11 Ga0068869_100145749 3300005334 Bacteria 1832
12 Ga0068869_100300226 3300005334 Bacteria 1296
13 Ga0068869_100326568 3300005334 Bacteria 1245
14 Ga0070666_10229912 3300005335 Bacteria 1309
15 Ga0070680_100183513 3300005336 Bacteria 1762
16 Ga0070680_100419972 3300005336 Bacteria 1141
17 Ga0070682_100339151 3300005337 Bacteria 1117
18 Ga0068868_100046352 3300005338 Bacteria 3402
19 Ga0068868_100279405 3300005338 Bacteria 1413
20 Ga0068868_100358419 3300005338 Bacteria 1250
21 Ga0070660_100499904 3300005339 Bacteria 1011
22 Ga0070691_10114201 3300005341 Bacteria 1354
23 Ga0070661_100100008 3300005344 Bacteria 2156
24 Ga0070668_100080026 3300005347 Bacteria 2559
25 Ga0070668_100175212 3300005347 Bacteria 1748
26 Ga0070668_100191224 3300005347 Bacteria 1676
27 Ga0070668_100206908 3300005347 Bacteria 1612
28 Ga0070669_100510073 3300005353 Bacteria 998
29 Ga0070674_100090569 3300005356 Bacteria 2206
30 Ga0070688_100303043 3300005365 Bacteria 1156
31 Ga0070659_100138613 3300005366 Bacteria 1979
32 Ga0070659_100276659 3300005366 Bacteria 1396
33 Ga0070709_10000406 3300005434 Bacteria 26303
34 Ga0070709_10002491 3300005434 Bacteria 9968
35 Ga0070709_10274579 3300005434 Bacteria 1222
36 Ga0070714_100007873 3300005435 Bacteria 8299
37 Ga0070714_100009376 3300005435 Bacteria 7690
38 Ga0070714_100036118 3300005435 Bacteria 4143
39 Ga0070713_100010069 3300005436 Bacteria 6817
40 Ga0070710_10002506 3300005437 Bacteria 8706
41 Ga0070710_10004939 3300005437 Bacteria 6306
42 Ga0070710_10181616 3300005437 Bacteria 1318
43 Ga0070711_100006571 3300005439 Bacteria 7018
44 Ga0070711_100011302 3300005439 Bacteria 5540
45 Ga0070705_100204368 3300005440 Bacteria 1357
46 Ga0070708_100268725 3300005445 Bacteria 1604
47 Ga0070663_100056761 3300005455 Bacteria 2807
48 Ga0070663_100088159 3300005455 Bacteria 2294
49 Ga0070663_100387274 3300005455 Bacteria 1140
50 Ga0070678_100245310 3300005456 Bacteria 1499
51 Ga0070678_100589117 3300005456 Bacteria 991
52 Ga0070662_100195580 3300005457 Bacteria 1601
53 Ga0068867_100024058 3300005459 Bacteria 4364
54 Ga0070706_100570232 3300005467 Bacteria 1052
55 Ga0070707_100294144 3300005468 Bacteria 1578
56 Ga0070698_100105570 3300005471 Bacteria 2786
57 Ga0070699_100087780 3300005518 Bacteria 2715
58 Ga0070679_100134496 3300005530 Bacteria 2453
59 Ga0070679_100251884 3300005530 Bacteria 1722
60 Ga0070679_100891787 3300005530 Bacteria 833
61 Ga0070684_100001930 3300005535 Bacteria 15207
62 Ga0070684_100139733 3300005535 Bacteria 2190
63 Ga0070684_100533574 3300005535 Bacteria 1088
64 Ga0070697_100170146 3300005536 Bacteria 1844
65 Ga0068853_100000785 3300005539 Bacteria 22086
66 Ga0068853_100059481 3300005539 Bacteria 3301
67 Ga0070672_100057787 3300005543 Bacteria 3046
68 Ga0070672_100535598 3300005543 Bacteria 1016
69 Ga0070693_100254417 3300005547 Bacteria 1166
70 Ga0070665_100058553 3300005548 Bacteria 3862
71 Ga0070665_100450611 3300005548 Bacteria 1296
72 Ga0070665_100581779 3300005548 Bacteria 1132
73 Ga0070704_100165347 3300005549 Bacteria 1754
74 Ga0070704_100276024 3300005549 Bacteria 1390
75 Ga0068855_100186336 3300005563 Bacteria 2343
76 Ga0068855_100451436 3300005563 Bacteria 1403
77 Ga0068857_100098840 3300005577 Bacteria 2618
78 Ga0068857_100424668 3300005577 Bacteria 1240
79 Ga0068857_100761656 3300005577 Bacteria 923
80 Ga0068854_100013500 3300005578 Bacteria 5364
81 Ga0068854_100188063 3300005578 Bacteria 1617
82 Ga0068856_100001102 3300005614 Bacteria 28542
83 Ga0068856_100006806 3300005614 Bacteria 11188
84 Ga0068852_100138950 3300005616 Bacteria 2246
85 Ga0068859_100199898 3300005617 Bacteria 2083
86 Ga0068859_100425398 3300005617 Bacteria 1424
87 Ga0068866_10074037 3300005718 Bacteria 1809
88 Ga0068861_100048002 3300005719 Bacteria 3225
89 Ga0068851_10002497 3300005834 Bacteria 8086
90 Ga0068870_10207059 3300005840 Bacteria 1192
91 Ga0068870_10215356 3300005840 Bacteria 1172
92 Ga0068863_100106895 3300005841 Bacteria 2662
93 Ga0068858_100450238 3300005842 Bacteria 1241
94 Ga0068858_100464123 3300005842 Bacteria 1221
95 Ga0068858_100464468 3300005842 Bacteria 1220
96 Ga0068858_100493454 3300005842 Bacteria 1182
97 Ga0068860_100000213 3300005843 Bacteria 91105
98 Ga0068860_100092658 3300005843 Bacteria 2879
99 Ga0068860_100134269 3300005843 Bacteria 2376
100 Ga0068860_100455767 3300005843 Bacteria 1272
101 Ga0068862_100181261 3300005844 Bacteria 1890
102 Ga0068862_100400094 3300005844 Bacteria 1284
103 Ga0068862_100538138 3300005844 Bacteria 1114
104 Ga0081455_10007979 3300005937 Bacteria 11070
105 Ga0081455_10008327 3300005937 Bacteria 10801
106 Ga0081455_10106985 3300005937 Bacteria 2230
107 Ga0081538_10007674 3300005981 Bacteria 9300
108 Ga0081540_1007133 3300005983 Bacteria 8019
109 Ga0081540_1007585 3300005983 Bacteria 7707
110 Ga0081540_1008782 3300005983 Bacteria 7021
111 Ga0081540_1009218 3300005983 Bacteria 6806
112 Ga0081540_1015852 3300005983 Bacteria 4750
113 Ga0081540_1061324 3300005983 Bacteria 1793
114 Ga0081539_10000148 3300005985 Bacteria 163442
115 Ga0081539_10018102 3300005985 Bacteria 4907
116 Ga0081539_10212272 3300005985 Bacteria 886
117 Ga0070717_10018001 3300006028 Bacteria 5511
118 Ga0070717_10535007 3300006028 Bacteria 1061
119 Ga0075365_10013283 3300006038 Bacteria 4916
120 Ga0075368_10122986 3300006042 Bacteria 1076
121 Ga0075368_10129416 3300006042 Bacteria 1048
122 Ga0075363_100015949 3300006048 Bacteria 3704
123 Ga0075363_100472388 3300006048 Bacteria 743
124 Ga0075364_10020660 3300006051 Bacteria 4143
125 Ga0075364_10051738 3300006051 Bacteria 2683
126 Ga0070715_10000111 3300006163 Bacteria 20025
127 Ga0070715_10128283 3300006163 Bacteria 1218
128 Ga0070716_100019234 3300006173 Bacteria 3567
129 Ga0070716_100030299 3300006173 Bacteria 2934
130 Ga0070712_100050814 3300006175 Bacteria 2886
131 Ga0070712_100083216 3300006175 Bacteria 2323
132 Ga0070712_100097971 3300006175 Bacteria 2162
133 Ga0075362_10290257 3300006177 Bacteria 810
134 Ga0075367_10031751 3300006178 Bacteria 3034
135 Ga0075367_10035997 3300006178 Bacteria 2868
136 Ga0075367_10057714 3300006178 Bacteria 2308
137 Ga0075367_10108302 3300006178 Bacteria 1703
138 Ga0075367_10134549 3300006178 Bacteria 1529
139 Ga0075367_10401355 3300006178 Bacteria 867
140 Ga0075427_10000818 3300006194 Bacteria 3793
141 Ga0075366_10049585 3300006195 Bacteria 2491
142 Ga0075370_10016464 3300006353 Bacteria 3978
143 Ga0075370_10017555 3300006353 Bacteria 3868
144 Ga0075370_10103127 3300006353 Bacteria 1652
145 Ga0075370_10162371 3300006353 Bacteria 1311
146 Ga0075428_100000363 3300006844 Bacteria 45033
147 Ga0075428_100045907 3300006844 Bacteria 4800
148 Ga0075430_100000717 3300006846 Bacteria 25305
149 Ga0075430_100024258 3300006846 Bacteria 5161
150 Ga0075431_100000990 3300006847 Bacteria 25307
151 Ga0075431_100036558 3300006847 Bacteria 5058
152 Ga0075433_10000187 3300006852 Bacteria 34883
153 Ga0075434_100002790 3300006871 Bacteria 15468
154 Ga0075434_100150988 3300006871 Bacteria 2343
155 Ga0075434_100158903 3300006871 Bacteria 2280
156 Ga0075429_100000846 3300006880 Bacteria 24030
157 Ga0075429_100013723 3300006880 Bacteria 7023
158 Ga0097620_100199892 3300006931 Bacteria 2083
159 Ga0097620_100425409 3300006931 Bacteria 1424
160 Ga0099824_1004142 3300006942 Bacteria 20984
161 Ga0099822_1000454 3300006943 Bacteria 37516
162 Ga0075435_100064842 3300007076 Bacteria 2969
163 Ga0075435_100169185 3300007076 Bacteria 1843
164 Ga0075435_100215136 3300007076 Bacteria 1631
165 Ga0075435_100457802 3300007076 Bacteria 1100
166 Ga0099794_10016927 3300007265 Bacteria 3241
167 Ga0099795_10052507 3300007788 Bacteria 1489
168 Ga0099795_10137400 3300007788 Bacteria 991
169 Ga0105244_10207473 3300009036 Bacteria 922
170 Ga0105250_10015581 3300009092 Bacteria 3112
171 Ga0105250_10116772 3300009092 Bacteria 1095
172 Ga0105240_10006571 3300009093 Bacteria 17074
173 Ga0105240_10040606 3300009093 Bacteria 5948
174 Ga0105240_10308819 3300009093 Bacteria 1807
175 Ga0111539_10000196 3300009094 Bacteria 70998
176 Ga0111539_10001652 3300009094 Bacteria 29773
177 Ga0111539_10042454 3300009094 Bacteria 5460
178 Ga0105245_10111313 3300009098 Bacteria 2546
179 Ga0105245_10121835 3300009098 Bacteria 2437
180 Ga0105245_10124637 3300009098 Bacteria 2410
181 Ga0114129_10001020 3300009147 Bacteria 36568
182 Ga0114129_10002010 3300009147 Bacteria 27861
183 Ga0114129_10307789 3300009147 Bacteria 2110
184 Ga0105243_10227531 3300009148 Bacteria 1652
185 Ga0105243_10323648 3300009148 Bacteria 1406
186 Ga0105241_10001021 3300009174 Bacteria 21313
187 Ga0105241_10405222 3300009174 Bacteria 1197
188 Ga0105242_10549970 3300009176 Bacteria 1107
189 Ga0105248_10285459 3300009177 Bacteria 1858
190 Ga0105237_10038408 3300009545 Bacteria 4834
191 Ga0105237_10103026 3300009545 Bacteria 2846
192 Ga0105238_10002878 3300009551 Bacteria 17208
193 Ga0105238_10038955 3300009551 Bacteria 4824
194 Ga0105238_10059650 3300009551 Bacteria 3821
195 Ga0105238_10167306 3300009551 Bacteria 2174
196 Ga0105238_10241439 3300009551 Bacteria 1784
197 Ga0105238_10519561 3300009551 Bacteria 1193
198 Ga0099796_10006120 3300010159 Bacteria 3061
199 Ga0105239_10003672 3300010375 Bacteria 18737
200 Ga0105239_10224443 3300010375 Bacteria 2107
201 Ga0105239_10596463 3300010375 Bacteria 1260
202 Ga0105239_10676404 3300010375 Bacteria 1179
203 Ga0105246_10483171 3300011119 Bacteria 1048
204 Ga0157314_1009402 3300012500 Bacteria 826
205 Ga0157374_10116372 3300013296 Bacteria 2576
206 Ga0157378_10144692 3300013297 Bacteria 2210
207 Ga0163162_11045964 3300013306 Bacteria 924
208 Ga0157375_10061161 3300013308 Bacteria 3738
209 Ga0157375_10277678 3300013308 Bacteria 1838
210 Ga0157375_10634475 3300013308 Bacteria 1225
211 Ga0163163_11282949 3300014325 Bacteria 795
212 Ga0157380_10074167 3300014326 Bacteria 2761
213 Ga0157380_10494127 3300014326 Bacteria 1187
214 Ga0182008_10252312 3300014497 Bacteria 910
215 Ga0182008_10327202 3300014497 Bacteria 808
216 Ga0157376_10331706 3300014969 Bacteria 1450
217 Ga0157376_10828448 3300014969 Bacteria 939
218 Ga0163161_10092436 3300017792 Bacteria 2240
219 Ga0206354_10053259 3300020081 Bacteria 1187
220 Ga0206353_10729413 3300020082 Bacteria 2061
221 Ga0213876_10028716 3300021384 Bacteria 2933
222 Ga0209233_1002800 3300025261 Bacteria 6260
223 Ga0209758_1010993 3300025297 Bacteria 5312
224 Ga0207697_10090772 3300025315 Bacteria 1294
225 Ga0207653_10037968 3300025885 Bacteria 1572
226 Ga0207692_10000175 3300025898 Bacteria 20519
227 Ga0207692_10002381 3300025898 Bacteria 7221
228 Ga0207642_10088031 3300025899 Bacteria 1527
229 Ga0207642_10193658 3300025899 Bacteria 1117
230 Ga0207688_10103008 3300025901 Bacteria 1650
231 Ga0207647_10001081 3300025904 Bacteria 20998
232 Ga0207685_10002732 3300025905 Bacteria 4116
233 Ga0207699_10000618 3300025906 Bacteria 17312
234 Ga0207699_10005953 3300025906 Bacteria 5869
235 Ga0207699_10257558 3300025906 Bacteria 1205
236 Ga0207645_10055827 3300025907 Bacteria 2521
237 Ga0207643_10097437 3300025908 Bacteria 1721
238 Ga0207654_10000163 3300025911 Bacteria 42749
239 Ga0207707_10031530 3300025912 Bacteria 4638
240 Ga0207707_10127394 3300025912 Bacteria 2226
241 Ga0207695_10001547 3300025913 Bacteria 37828
242 Ga0207695_10031001 3300025913 Bacteria 5876
243 Ga0207695_10309411 3300025913 Bacteria 1470
244 Ga0207671_10036003 3300025914 Bacteria 3671
245 Ga0207693_10000445 3300025915 Bacteria 37840
246 Ga0207693_10004737 3300025915 Bacteria 11439
247 Ga0207693_10007171 3300025915 Bacteria 9182
248 Ga0207693_10113958 3300025915 Bacteria 2121
249 Ga0207663_10001290 3300025916 Bacteria 11612
250 Ga0207663_10065287 3300025916 Bacteria 2326
251 Ga0207663_10180997 3300025916 Bacteria 1505
252 Ga0207663_10362525 3300025916 Bacteria 1100
253 Ga0207663_10370972 3300025916 Bacteria 1088
254 Ga0207660_10220763 3300025917 Bacteria 1487
255 Ga0207660_10379578 3300025917 Bacteria 1136
256 Ga0207662_10067356 3300025918 Bacteria 2159
257 Ga0207657_10451863 3300025919 Bacteria 1008
258 Ga0207649_10023691 3300025920 Bacteria 3558
259 Ga0207652_10198389 3300025921 Bacteria 1806
260 Ga0207652_10555607 3300025921 Bacteria 1031
261 Ga0207646_10216411 3300025922 Bacteria 1730
262 Ga0207681_10197054 3300025923 Bacteria 1544
263 Ga0207694_10000050 3300025924 Bacteria 159920
264 Ga0207694_10004359 3300025924 Bacteria 11057
265 Ga0207694_10208745 3300025924 Bacteria 1590
266 Ga0207694_10486822 3300025924 Bacteria 1032
267 Ga0207650_10268591 3300025925 Bacteria 1386
268 Ga0207659_10216431 3300025926 Bacteria 1538
269 Ga0207687_10210476 3300025927 Bacteria 1525
270 Ga0207687_10266734 3300025927 Bacteria 1367
271 Ga0207687_10339080 3300025927 Bacteria 1222
272 Ga0207700_10152008 3300025928 Bacteria 1914
273 Ga0207700_10346755 3300025928 Bacteria 1292
274 Ga0207664_10004578 3300025929 Bacteria 9370
275 Ga0207664_10017510 3300025929 Bacteria 5255
276 Ga0207664_10741897 3300025929 Bacteria 883
277 Ga0207690_10538377 3300025932 Bacteria 948
278 Ga0207690_10590114 3300025932 Bacteria 906
279 Ga0207709_10235960 3300025935 Bacteria 1328
280 Ga0207709_10318126 3300025935 Bacteria 1164
281 Ga0207669_10014799 3300025937 Bacteria 3919
282 Ga0207665_10000651 3300025939 Bacteria 23346
283 Ga0207665_10045418 3300025939 Bacteria 2941
284 Ga0207665_10081699 3300025939 Bacteria 2226
285 Ga0207691_10114053 3300025940 Bacteria 2401
286 Ga0207691_10336686 3300025940 Bacteria 1292
287 Ga0207661_10028889 3300025944 Bacteria 4251
288 Ga0207667_10012112 3300025949 Bacteria 9965
289 Ga0207667_10170755 3300025949 Bacteria 2235
290 Ga0207667_10426789 3300025949 Bacteria 1348
291 Ga0207667_10660358 3300025949 Bacteria 1050
292 Ga0207668_10014275 3300025972 Bacteria 4914
293 Ga0207668_10168660 3300025972 Bacteria 1714
294 Ga0207668_10367955 3300025972 Bacteria 1206
295 Ga0207668_10410886 3300025972 Bacteria 1146
296 Ga0207640_10019310 3300025981 Bacteria 4024
297 Ga0207640_10038923 3300025981 Bacteria 3005
298 Ga0207640_10218733 3300025981 Bacteria 1457
299 Ga0207658_10189208 3300025986 Bacteria 1709
300 Ga0207677_10047407 3300026023 Bacteria 2885
301 Ga0207703_10075656 3300026035 Bacteria 2791
302 Ga0207703_10282044 3300026035 Bacteria 1509
303 Ga0207703_10338383 3300026035 Bacteria 1382
304 Ga0207639_10003890 3300026041 Bacteria 10067
305 Ga0207639_10042094 3300026041 Bacteria 3422
306 Ga0207639_10094945 3300026041 Bacteria 2395
307 Ga0207678_10038284 3300026067 Bacteria 4167
308 Ga0207678_10258766 3300026067 Bacteria 1491
309 Ga0207678_10700670 3300026067 Bacteria 891
310 Ga0207702_10000002 3300026078 Bacteria 491507
311 Ga0207702_10001047 3300026078 Bacteria 28331
312 Ga0207702_10009454 3300026078 Bacteria 8188
313 Ga0207641_10126230 3300026088 Bacteria 2291
314 Ga0207648_10078294 3300026089 Bacteria 2883
315 Ga0207674_10005123 3300026116 Bacteria 15638
316 Ga0207674_10011035 3300026116 Bacteria 10160
317 Ga0207674_10106906 3300026116 Bacteria 2775
318 Ga0207674_10191461 3300026116 Bacteria 1995
319 Ga0207675_100100807 3300026118 Bacteria 2720
320 Ga0207675_100247407 3300026118 Bacteria 1725
321 Ga0207675_100558089 3300026118 Bacteria 1145
322 Ga0207683_10041716 3300026121 Bacteria 4007
323 Ga0207683_10101864 3300026121 Bacteria 2564
324 Ga0207683_10556301 3300026121 Bacteria 1061
325 Ga0207698_10407137 3300026142 Bacteria 1302
326 Ga0209589_1000001 3300027357 Bacteria 794224
327 Ga0209489_100001 3300027361 Bacteria 794224
328 Ga0209700_100001 3300027363 Bacteria 794224
329 Ga0209179_1001163 3300027512 Bacteria 3097
330 Ga0207428_10000250 3300027907 Bacteria 73217
331 Ga0207428_10007766 3300027907 Bacteria 9761
332 Ga0207428_10081072 3300027907 Bacteria 2534
333 Ga0268266_10002184 3300028379 Bacteria 21420
334 Ga0268266_10053337 3300028379 Bacteria 3473
335 Ga0268266_10532083 3300028379 Bacteria 1124
336 Ga0268265_10032816 3300028380 Bacteria 3767
337 Ga0268265_10193939 3300028380 Bacteria 1756
338 Ga0268265_10353899 3300028380 Bacteria 1342
339 Ga0268264_10000065 3300028381 Bacteria 298403
340 Ga0268264_10305314 3300028381 Bacteria 1499
341 Ga0268264_10344540 3300028381 Bacteria 1416
342 Ga0268264_10505813 3300028381 Bacteria 1179
343 Ga0265334_10047264 3300028573 Bacteria 1661
344 Ga0265338_10079216 3300028800 Bacteria 2766
345 Ga0265330_10012607 3300031235 Bacteria 3951
346 Ga0265330_10039625 3300031235 Bacteria 2093
347 Ga0265330_10043741 3300031235 Bacteria 1980
348 Ga0265332_10007077 3300031238 Bacteria 5080
349 Ga0265332_10010528 3300031238 Bacteria 4118
350 Ga0265320_10015104 3300031240 Bacteria 4372
351 Ga0265325_10004321 3300031241 Bacteria 9002
352 Ga0265325_10084307 3300031241 Bacteria 1575
353 Ga0265340_10017688 3300031247 Bacteria 3687
354 Ga0265339_10001858 3300031249 Bacteria 15532
355 Ga0265331_10135621 3300031250 Bacteria 1121
356 Ga0265316_10095721 3300031344 Bacteria 2261
357 Ga0265316_10351310 3300031344 Bacteria 1067
358 Ga0307513_10230752 3300031456 Bacteria 1664
359 Ga0307509_10091918 3300031507 Bacteria 3104
360 Ga0307508_10046054 3300031616 Bacteria 3895
361 Ga0307508_10208901 3300031616 Bacteria 1552
362 Ga0265314_10073740 3300031711 Bacteria 2275
363 Ga0265314_10117002 3300031711 Bacteria 1685
364 Ga0265342_10134800 3300031712 Bacteria 1381
365 Ga0265342_10136570 3300031712 Bacteria 1370
366 Ga0265342_10215670 3300031712 Bacteria 1036
367 Ga0307413_10039002 3300031824 Bacteria 2758
368 Ga0307413_10152641 3300031824 Bacteria 1612
369 Ga0307409_100517270 3300031995 Bacteria 1165
370 Ga0307416_100062417 3300032002 Bacteria 3047
371 Ga0307415_100300563 3300032126 Bacteria 1329
372 Ga0307415_100406734 3300032126 Bacteria 1164
373 Ga0307507_10031270 3300033179 Bacteria 5591
374 Ga0307510_10021118 3300033180 Bacteria 7594
375 Ga0307510_10034144 3300033180 Bacteria 5700
376 Ga0307510_10146621 3300033180 Bacteria 1990
377 Ga0315911_1000006 3300033442 Bacteria 414563
378 Ga0373930_0018279 3300034816 Bacteria 1346
379 Ga0373948_0001401 3300034817 Bacteria 3326
380 Ga0373950_0025845 3300034818 Bacteria 1062
381 Ga0373959_0021738 3300034820 Bacteria 1234
382 Ga0373938_0032377 3300034957 Bacteria 1126
383 Ga0373940_0006395 3300035088 Bacteria 2613
384 Ga0373944_0122140 3300035089 Bacteria 898
385 Ga0373951_0014701 3300035091 Bacteria 1760
386 Ga0373923_0259686 3300035111 Bacteria 815
387 Ga0373936_0047940 3300035113 Bacteria 1724
388 Ga0373941_0221643 3300035115 Bacteria 727
389 Ga0373956_0007962 3300035119 Bacteria 4281
390 Ga0373957_0003656 3300035120 Bacteria 4584
391 Ga0373960_0074121 3300035121 Bacteria 1059
392 Ga0373960_0123414 3300035121 Bacteria 861
393 Ga0373943_0051656 3300035170 Bacteria 2025
394 Ga0373943_0139852 3300035170 Bacteria 1303
395 Ga0373946_0285627 3300035171 Bacteria 813
396 Ga0373955_0000848 3300035172 Bacteria 13090
397 Ga0373955_0027989 3300035172 Bacteria 2919
398 Ga0373942_0044569 3300035207 Bacteria 1222
399 Ga0373942_0141157 3300035207 Bacteria 767
400 Ga0373962_0105207 3300035242 Bacteria 884
401 Ga0373924_0063206 3300035410 Bacteria 1552
402 Ga0373931_0013805 3300035691 Bacteria 3938
403 Ga0373931_0073237 3300035691 Bacteria 1874
404 Ga0373935_0000186 3300035692 Bacteria 29290
405 Ga0373935_0008682 3300035692 Bacteria 6084
406 Ga0373935_0302433 3300035692 Bacteria 1131
407 Ga0373927_0001401 3300035695 Bacteria 18162
408 Ga0373927_0008512 3300035695 Bacteria 6901
409 Ga0373927_0015297 3300035695 Bacteria 5067
410 Ga0373927_0018326 3300035695 Bacteria 4601
411 Ga0373927_0036482 3300035695 Bacteria 3197
412 Ga0373927_0105884 3300035695 Bacteria 1831
413 Ga0373933_0006901 3300035724 Bacteria 6187
414 Ga0373947_0007200 3300035725 Bacteria 6447
415 Ga0373947_0007324 3300035725 Bacteria 6389
416 Ga0373947_0012405 3300035725 Bacteria 4883
417 Ga0373947_0069267 3300035725 Bacteria 2159
418 Ga0373947_0118761 3300035725 Bacteria 1678
419 Ga0373937_0027189 3300036401 Bacteria 5171
420 Ga0373937_0215379 3300036401 Bacteria 1807
421 Ga0373937_0377820 3300036401 Bacteria 1344
422 Ga0373925_0002553 3300037068 Bacteria 14496
423 Ga0373925_0044441 3300037068 Bacteria 3298
424 Ga0373925_0093474 3300037068 Bacteria 2302
425 Ga0395898_0287964 3300037466 Bacteria 1567
426 Ga0436365_0641618 3300039437 Bacteria 2486
427 Ga0436365_0919787 3300039437 Bacteria 3799
428 Ga0436363_0292837 3300039450 Bacteria 3697
429 Ga0436363_1472986 3300039450 Bacteria 1408
430 Ga0451797_1406699 3300041453 Bacteria 2150
431 Ga0451800_1037900 3300041459 Bacteria 889
432 Ga0451807_1338646 3300041486 Bacteria 970
433 Ga0451843_0944616 3300041509 Bacteria 1013
434 Ga0439446_0006873 3300042156 Bacteria 2980
435 Ga0466969_0075002 3300044656 Bacteria 1622
436 Ga0466970_0330990 3300044765 Bacteria 862
437 Ga0466957_0074288 3300044842 Bacteria 2108
438 Ga0466967_0088384 3300045976 Bacteria 2812
439 Ga0495592_0001299 3300046454 Bacteria 17352
440 Ga0495603_0001707 3300046455 Bacteria 12934
441 Ga0495603_0019417 3300046455 Bacteria 4113
442 Ga0495603_0257106 3300046455 Bacteria 1005
443 Ga0495590_0075391 3300046457 Bacteria 1186
444 Ga0495591_066561 3300046458 Bacteria 945
445 Ga0495629_0000606 3300046459 Bacteria 29232
446 Ga0495629_0005522 3300046459 Bacteria 9436
447 Ga0495641_0002686 3300046461 Bacteria 13835
448 Ga0495641_0010400 3300046461 Bacteria 5397
449 Ga0495651_0037223 3300046462 Bacteria 3788
450 Ga0495651_0058917 3300046462 Bacteria 2946
451 Ga0495650_0060382 3300046471 Bacteria 1523
452 Ga0495650_0116673 3300046471 Bacteria 986
453 Ga0495580_0001307 3300046472 Bacteria 21998
454 Ga0495582_0001692 3300046473 Bacteria 12451
455 Ga0495582_0007172 3300046473 Bacteria 6188
456 Ga0495582_0016553 3300046473 Bacteria 4038
457 Ga0495582_0134775 3300046473 Bacteria 1397
458 Ga0495605_0071460 3300046474 Bacteria 1639
459 Ga0495639_0000136 3300046475 Bacteria 37792
460 Ga0495639_0057840 3300046475 Bacteria 1772
461 Ga0495662_0000392 3300046476 Bacteria 19571
462 Ga0495594_0000843 3300046499 Bacteria 15801
463 Ga0495594_0045176 3300046499 Bacteria 2418
464 Ga0495594_0112661 3300046499 Bacteria 1534
465 Ga0495606_0003785 3300046507 Bacteria 15720
466 Ga0495606_0221551 3300046507 Bacteria 1065
467 Ga0495608_0038614 3300046511 Bacteria 3205
468 Ga0495608_0396845 3300046511 Bacteria 844
469 Ga0495618_0097869 3300046514 Bacteria 1877
470 Ga0495643_0072477 3300046522 Bacteria 1806
471 Ga0495644_0065738 3300046523 Bacteria 1362
472 Ga0495648_0002991 3300046524 Bacteria 15159
473 Ga0495648_0008609 3300046524 Bacteria 8003
474 Ga0495663_0073023 3300046525 Bacteria 1095
475 Ga0495666_0264652 3300046526 Bacteria 781
476 Ga0495652_0026021 3300046529 Bacteria 5171
477 Ga0495665_0000026 3300046531 Bacteria 56855
478 Ga0495640_0012296 3300046533 Bacteria 6547
479 Ga0495587_0079142 3300046536 Bacteria 1906
480 Ga0495598_0009970 3300046537 Bacteria 2261
481 Ga0495598_0109106 3300046537 Bacteria 925
482 Ga0495621_0052773 3300046539 Bacteria 1458
483 Ga0495645_0123626 3300046543 Bacteria 1820
484 Ga0495667_0099070 3300046559 Bacteria 1887
485 Ga0495667_0226820 3300046559 Bacteria 1191
486 Ga0495634_0000634 3300046642 Bacteria 34163
487 Ga0495634_0279655 3300046642 Bacteria 1014
488 Ga0495625_0107333 3300046660 Bacteria 1911
489 Ga0495635_0000827 3300046663 Bacteria 20282
490 Ga0495588_0010887 3300046674 Bacteria 4251
491 Ga0495657_0027053 3300046675 Bacteria 4053
492 Ga0495657_0239914 3300046675 Bacteria 1094
493 Ga0495646_0030827 3300046680 Bacteria 3346
494 Ga0495647_0001263 3300046681 Bacteria 7804
495 Ga0495647_0007767 3300046681 Bacteria 3602
496 Ga0495647_0197285 3300046681 Bacteria 882
497 Ga0495658_0000278 3300046683 Bacteria 29065
498 Ga0495658_0002383 3300046683 Bacteria 9484
499 Ga0495658_0088242 3300046683 Bacteria 1833
500 Ga0495669_0007025 3300046684 Bacteria 4713
501 Ga0495613_0006647 3300046689 Bacteria 8639
502 Ga0495613_0020275 3300046689 Bacteria 4957
503 Ga0495624_0000201 3300046690 Bacteria 45984
504 Ga0495624_0041652 3300046690 Bacteria 2937
505 Ga0495624_0205691 3300046690 Bacteria 1195
506 Ga0495624_0336957 3300046690 Bacteria 908
507 Ga0495589_0076065 3300046794 Bacteria 1637
508 Ga0495600_0010238 3300046809 Bacteria 5813
509 Ga0495581_0000828 3300047315 Bacteria 16501
510 Ga0495581_0051878 3300047315 Bacteria 2369
511 Ga0495581_0180056 3300047315 Bacteria 1236
512 Ga0495581_0327165 3300047315 Bacteria 895
513 Ga0495636_0120917 3300047318 Bacteria 1158
514 Ga0495674_0023985 3300047319 Bacteria 5612
515 Ga0495672_0019491 3300047320 Bacteria 4471
516 Ga0495676_0082122 3300047321 Bacteria 2440
517 Ga0495676_0204964 3300047321 Bacteria 1368
518 Ga0495680_0005700 3300047322 Bacteria 11659
519 Ga0495680_0051958 3300047322 Bacteria 3197
520 Ga0495673_0025196 3300047469 Bacteria 2860
521 Ga0495684_0013981 3300047471 Bacteria 6176
522 Ga0495686_0135290 3300047472 Bacteria 1458
523 Ga0495593_0000282 3300047673 Bacteria 27666
524 Ga0495602_0022737 3300048088 Bacteria 6131
525 Ga0495602_0278366 3300048088 Bacteria 1234
526 Ga0495602_0441704 3300048088 Bacteria 920
527 Ga0495614_0042323 3300048089 Bacteria 1953
528 Ga0495615_0027994 3300048090 Bacteria 1327
529 Ga0496100_0223771 3300048903 Bacteria 1382
530 Ga0496100_0390056 3300048903 Bacteria 1059
531 Ga0496101_0068749 3300048904 Bacteria 2590
532 Ga0496101_0372150 3300048904 Bacteria 1123
533 Ga0496101_0378472 3300048904 Bacteria 1114
534 Ga0496102_0054754 3300048905 Bacteria 3638
535 Ga0496102_0072210 3300048905 Bacteria 3171
536 Ga0496102_0407936 3300048905 Bacteria 1277
537 Ga0496102_0501114 3300048905 Bacteria 1136
538 Ga0496103_0089263 3300048906 Bacteria 1944
539 Ga0496104_0075695 3300048907 Bacteria 3205
540 Ga0496104_0113103 3300048907 Bacteria 2603
541 Ga0496104_0584086 3300048907 Bacteria 1028
542 Ga0496105_0178130 3300048908 Bacteria 1741
543 Ga0496105_0261442 3300048908 Bacteria 1399
544 Ga0496106_0002133 3300048909 Bacteria 14779
545 Ga0496106_0083214 3300048909 Bacteria 2461
546 Ga0496106_0380461 3300048909 Bacteria 1134
547 Ga0496106_0459947 3300048909 Bacteria 1022
548 Ga0496106_0496353 3300048909 Bacteria 980
549 Ga0496107_0074689 3300048910 Bacteria 2466
550 Ga0496107_0188823 3300048910 Bacteria 1531
551 Ga0496108_0120609 3300048911 Bacteria 2249
552 Ga0496109_0023474 3300048912 Bacteria 5476
553 Ga0496109_0161425 3300048912 Bacteria 2100
554 Ga0496109_0294755 3300048912 Bacteria 1529
555 Ga0496109_0455839 3300048912 Bacteria 1208
556 Ga0496110_0092380 3300048913 Bacteria 2708
557 Ga0496110_0143055 3300048913 Bacteria 2162
558 Ga0496110_0192225 3300048913 Bacteria 1853
559 Ga0496111_0048441 3300048914 Bacteria 3061
560 Ga0496111_0092043 3300048914 Bacteria 2222
561 Ga0496111_0240601 3300048914 Bacteria 1344
562 Ga0496112_0000004 3300048915 Bacteria 553294
563 Ga0496112_0037597 3300048915 Bacteria 4724
564 Ga0496112_0091691 3300048915 Bacteria 3007
565 Ga0496112_0100520 3300048915 Bacteria 2861
566 Ga0496112_0158882 3300048915 Bacteria 2227
567 Ga0496112_0291987 3300048915 Bacteria 1576
568 Ga0496113_0149548 3300048916 Bacteria 1841
569 Ga0496114_0147432 3300048917 Bacteria 2040
570 Ga0496114_0344092 3300048917 Bacteria 1319
571 Ga0496115_0008261 3300048918 Bacteria 7694
572 Ga0496115_0017594 3300048918 Bacteria 5470
573 Ga0496115_0088001 3300048918 Bacteria 2535
574 Ga0496115_0098692 3300048918 Bacteria 2392
575 Ga0496115_0160119 3300048918 Bacteria 1860
576 Ga0496115_0435227 3300048918 Bacteria 1061
577 Ga0496117_0058895 3300048920 Bacteria 2657
578 Ga0496118_0011549 3300048921 Bacteria 8605
579 Ga0496118_0076136 3300048921 Bacteria 2388
580 Ga0496118_0225655 3300048921 Bacteria 1086
581 Ga0496119_0074699 3300048922 Bacteria 1973
582 Ga0496119_0209801 3300048922 Bacteria 1003
583 Ga0496121_0002279 3300048924 Bacteria 29850
584 Ga0496121_0002820 3300048924 Bacteria 25702
585 Ga0496121_0183234 3300048924 Bacteria 1509
586 Ga0496121_0219157 3300048924 Bacteria 1341
587 Ga0496124_0000722 3300048927 Bacteria 54175
588 Ga0496124_0108081 3300048927 Bacteria 2243
589 Ga0496124_0147632 3300048927 Bacteria 1849
590 Ga0496126_0006670 3300048929 Bacteria 12833
591 Ga0496126_0010727 3300048929 Bacteria 9569
592 Ga0496126_0067735 3300048929 Bacteria 3189
593 Ga0496126_0090027 3300048929 Bacteria 2700
594 Ga0496126_0375983 3300048929 Bacteria 1157
595 Ga0495678_133134 3300049459 Bacteria 822
596 Ga0501033_0101675 3300049570 Bacteria 2097
597 Ga0501039_0364836 3300049575 Bacteria 1135
598 Ga0501041_0269914 3300049577 Bacteria 1070
599 Ga0501047_0281461 3300049581 Bacteria 1508
600 Ga0501047_0420728 3300049581 Bacteria 1167
601 Ga0501067_0000745 3300049583 Bacteria 17505
602 Ga0501067_0302874 3300049583 Bacteria 890
603 Ga0501072_0341753 3300049588 Bacteria 1189
604 Ga0501073_0033428 3300049589 Bacteria 3662
605 Ga0501076_0351223 3300049592 Bacteria 1211
606 Ga0501077_0141945 3300049593 Bacteria 1523
607 Ga0501083_0044572 3300049744 Bacteria 3002
608 Ga0501083_0098316 3300049744 Bacteria 1930
609 Ga0501044_0164966 3300049823 Bacteria 2190
610 nmdc:mga03n38_1488_c1 3300050490 Bacteria 6754
611 nmdc:mga00v17_13507_c1 3300050491 Bacteria 4537
612 nmdc:mga00v17_146863_c1 3300050491 Bacteria 1514
613 nmdc:mga0yw44_11625_c1 3300050492 Bacteria 4555
614 nmdc:mga0yw44_14499_c1 3300050492 Bacteria 4188
615 nmdc:mga0yw44_4769_c2 3300050492 Bacteria 5717
616 nmdc:mga0yw44_91687_c1 3300050492 Bacteria 1922
617 nmdc:mga06z11_83400_c1 3300050494 Bacteria 1720
618 nmdc:mga06z11_89446_c1 3300050494 Bacteria 1669
619 nmdc:mga07m45_10308_c1 3300050496 Bacteria 4876
620 nmdc:mga07m45_13377_c1 3300050496 Bacteria 4354
621 nmdc:mga07m45_143549_c1 3300050496 Bacteria 1383
622 nmdc:mga05p37_354_c1 3300050507 Bacteria 49188
623 nmdc:mga05p37_4031_c1 3300050507 Bacteria 17172
624 nmdc:mga05p37_77938_c1 3300050507 Bacteria 4080
625 nmdc:mga09592_21598_c1 3300050508 Bacteria 5306
626 nmdc:mga09592_4746_c1 3300050508 Bacteria 11013
627 nmdc:mga0qj67_303385_c1 3300050509 Bacteria 1293
628 nmdc:mga0qj67_935_c1 3300050509 Bacteria 20095
629 nmdc:mga06r32_147_c1 3300050510 Bacteria 53171
630 nmdc:mga06r32_2724_c1 3300050510 Bacteria 15809
631 nmdc:mga08y16_142808_c1 3300050511 Bacteria 2489
632 nmdc:mga08y16_289_c1 3300050511 Bacteria 45654
633 nmdc:mga08y16_843_c1 3300050511 Bacteria 22807
634 nmdc:mga0n895_132405_c1 3300050512 Bacteria 2519
635 nmdc:mga0n895_246098_c1 3300050512 Bacteria 1815
636 nmdc:mga0n895_40050_c1 3300050512 Bacteria 4551
637 nmdc:mga0n895_545_c1 3300050512 Bacteria 25797
638 nmdc:mga0n895_58554_c1 3300050512 Bacteria 3798
639 nmdc:mga0rr50_1502_c1 3300050513 Bacteria 12829
640 nmdc:mga0rr50_71805_c1 3300050513 Bacteria 2642
641 nmdc:mga0rr50_8013_c1 3300050513 Bacteria 6552
642 nmdc:mga0a205_60_c1 3300050515 Bacteria 60202
643 nmdc:mga0sz30_217798_c1 3300050516 Bacteria 849
644 Ga0495601_0019340 3300053077 Bacteria 4153
645 Ga0495601_0266609 3300053077 Bacteria 1117
646 Ga0495612_0029163 3300053078 Bacteria 2222
647 Ga0495595_0002637 3300053084 Bacteria 7039
648 Ga0495619_0000996 3300053085 Bacteria 18589
649 Ga0495619_0002254 3300053085 Bacteria 12749
650 Ga0500578_0218453 3300053086 Bacteria 1160
651 Ga0500644_0064795 3300053088 Bacteria 1299
652 Ga0500647_0030293 3300053091 Bacteria 2570
653 Ga0500641_0004635 3300053096 Bacteria 4860
654 Ga0500554_000594 3300053102 Bacteria 7370
655 Ga0500569_017447 3300053109 Bacteria 1836
656 Ga0500595_003152 3300053119 Bacteria 7809
657 Ga0500595_009148 3300053119 Bacteria 4012
658 Ga0500655_025636 3300053133 Bacteria 1119
659 Ga0500559_0089934 3300053136 Bacteria 1404
660 Ga0500568_0071220 3300053139 Bacteria 1331
661 Ga0500603_000431 3300053150 Bacteria 10890
662 Ga0500616_0000034 3300053153 Bacteria 396651
663 Ga0500616_0022170 3300053153 Bacteria 3550
664 Ga0500638_134553 3300053162 Bacteria 1117
665 Ga0500637_0005636 3300053178 Bacteria 6086
666 Ga0500645_055605 3300053730 Bacteria 1149
667 Ga0500596_010434 3300053735 Bacteria 1434
668 Ga0501084_0099517 3300054114 Bacteria 2441
669 Ga0501084_0156096 3300054114 Bacteria 1924
670 Ga0501082_0066954 3300060353 Bacteria 3092
671 2509151459 2508501128 Bacteria 8613869
672 2513657031 2513237096 Bacteria 8722461
673 2513696747 2513237101 Bacteria 7952346
674 2513703410 2513237102 Bacteria 7703324
675 2513855472 2513237137 Bacteria 9558895
676 2513889987 2513237141 Bacteria 8496279
677 2513918771 2513237145 Bacteria 8979722
678 2517892020 2517572143 Bacteria 9484767
679 2524534095 2524023228 Bacteria 10118060
680 2671121942 2667528175 Bacteria 7532676
681 2723846585 2721755755 Bacteria 8322773
682 2728753039 2728368998 Bacteria 8720350
683 2793068905 2791355197 Bacteria 8420563
684 2793080591
685 2874605624 2874604998 Bacteria 7834745
686 2876814666 2876808645 Bacteria 8824342
687 2879115913 2879110137 Bacteria 8907982
688 2885375970 2885374607 Bacteria 8927485
689 2889039366 2889033259 Bacteria 9099371
690 2903751021 2903748898 Bacteria 9972761
691 2904694924 2904690495 Bacteria 9412302
692 2904702119
693 2906617148
694 2906639208 2906635258 Bacteria 8601019
695 2906662408 2906660503 Bacteria 8595048
696 2908742296 2908739725 Bacteria 8628932
697 2908759936 2908756301 Bacteria 8864324
698 2922365786 2922361189 Bacteria 7436256
699 2922391344 2922386360 Bacteria 7017218
700 2922430697
701 2935636398 2935630451 Bacteria 8169952
702 2941509892 2941507105 Bacteria 8166816
703 2941520864 2941515067 Bacteria 8166720
704 2941525291 2941523033 Bacteria 8169134
705 3005480600 3005474847 Bacteria 9259049
706 8006940171 8006933436 Bacteria 10410654
707 8006969710 8006964411 Bacteria 8966052
708 8006979952 8006973647 Bacteria 10679141
709 8006987847 8006984368 Bacteria 9651211
710 8007000835 8006994254 Bacteria 8309700
711 8019556149 8019555841 Bacteria 9642137
712 8019569158 8019565922 Bacteria 9639779
713 8056676968 8056673599 Bacteria 7871253
714 8056692201 8056689827 Bacteria 6712655
715 Ga0070711_100274834
716 JGI25153J46596_10002102
717 JGI25404J52841_10002404
718 JGI25404J52841_10002915
719 JGI25405J52794_10008076
720 Ga0070676_10291185
721 Ga0070683_100110038
722 Ga0070683_100198458
723 Ga0070690_100063213
724 Ga0070670_100121850
725 Ga0068869_100145749
726 Ga0068869_100300226
727 Ga0068869_100326568
728 Ga0070666_10229912
729 Ga0070680_100183513
730 Ga0070680_100419972
731 Ga0070682_100339151
732 Ga0068868_100046352
733 Ga0068868_100279405
734 Ga0068868_100358419
735 Ga0070660_100499904
736 Ga0070691_10114201
737 Ga0070661_100100008
738 Ga0070668_100080026
739 Ga0070668_100175212
740 Ga0070668_100191224
741 Ga0070668_100206908
742 Ga0070669_100510073
743 Ga0070674_100090569
744 Ga0070688_100303043
745 Ga0070659_100138613
746 Ga0070659_100276659
747 Ga0070709_10000406
748 Ga0070709_10002491
749 Ga0070709_10274579
750 Ga0070714_100007873
751 Ga0070714_100009376
752 Ga0070714_100036118
753 Ga0070713_100010069
754 Ga0070710_10002506
755 Ga0070710_10004939
756 Ga0070710_10181616
757 Ga0070711_100006571
758 Ga0070711_100011302
759 Ga0070705_100204368
760 Ga0070708_100268725
761 Ga0070663_100056761
762 Ga0070663_100088159
763 Ga0070663_100387274
764 Ga0070678_100245310
765 Ga0070678_100589117
766 Ga0070662_100195580
767 Ga0068867_100024058
768 Ga0070706_100570232
769 Ga0070707_100294144
770 Ga0070698_100105570
771 Ga0070699_100087780
772 Ga0070679_100134496
773 Ga0070679_100251884
774 Ga0070679_100891787
775 Ga0070684_100001930
776 Ga0070684_100139733
777 Ga0070684_100533574
778 Ga0070697_100170146
779 Ga0068853_100000785
780 Ga0068853_100059481
781 Ga0070672_100057787
782 Ga0070672_100535598
783 Ga0070693_100254417
784 Ga0070665_100058553
785 Ga0070665_100450611
786 Ga0070665_100581779
787 Ga0070704_100165347
788 Ga0070704_100276024
789 Ga0068855_100186336
790 Ga0068855_100451436
791 Ga0068857_100098840
792 Ga0068857_100424668
793 Ga0068857_100761656
794 Ga0068854_100013500
795 Ga0068854_100188063
796 Ga0068856_100001102
797 Ga0068856_100006806
798 Ga0068852_100138950
799 Ga0068859_100199898
800 Ga0068859_100425398
801 Ga0068866_10074037
802 Ga0068861_100048002
803 Ga0068851_10002497
804 Ga0068870_10207059
805 Ga0068870_10215356
806 Ga0068863_100106895
807 Ga0068858_100450238
808 Ga0068858_100464123
809 Ga0068858_100464468
810 Ga0068858_100493454
811 Ga0068860_100000213
812 Ga0068860_100092658
813 Ga0068860_100134269
814 Ga0068860_100455767
815 Ga0068862_100181261
816 Ga0068862_100400094
817 Ga0068862_100538138
818 Ga0081455_10007979
819 Ga0081455_10008327
820 Ga0081455_10106985
821 Ga0081538_10007674
822 Ga0081540_1007133
823 Ga0081540_1007585
824 Ga0081540_1008782
825 Ga0081540_1009218
826 Ga0081540_1015852
827 Ga0081540_1061324
828 Ga0081539_10000148
829 Ga0081539_10018102
830 Ga0081539_10212272
831 Ga0070717_10018001
832 Ga0070717_10535007
833 Ga0075365_10013283
834 Ga0075368_10122986
835 Ga0075368_10129416
836 Ga0075363_100015949
837 Ga0075363_100472388
838 Ga0075364_10020660
839 Ga0075364_10051738
840 Ga0070715_10000111
841 Ga0070715_10128283
842 Ga0070716_100019234
843 Ga0070716_100030299
844 Ga0070712_100050814
845 Ga0070712_100083216
846 Ga0070712_100097971
847 Ga0075362_10290257
848 Ga0075367_10031751
849 Ga0075367_10035997
850 Ga0075367_10057714
851 Ga0075367_10108302
852 Ga0075367_10134549
853 Ga0075367_10401355
854 Ga0075427_10000818
855 Ga0075366_10049585
856 Ga0075370_10016464
857 Ga0075370_10017555
858 Ga0075370_10103127
859 Ga0075370_10162371
860 Ga0075428_100000363
861 Ga0075428_100045907
862 Ga0075430_100000717
863 Ga0075430_100024258
864 Ga0075431_100000990
865 Ga0075431_100036558
866 Ga0075433_10000187
867 Ga0075434_100002790
868 Ga0075434_100150988
869 Ga0075434_100158903
870 Ga0075429_100000846
871 Ga0075429_100013723
872 Ga0097620_100199892
873 Ga0097620_100425409
874 Ga0099824_1004142
875 Ga0099822_1000454
876 Ga0075435_100064842
877 Ga0075435_100169185
878 Ga0075435_100215136
879 Ga0075435_100457802
880 Ga0099794_10016927
881 Ga0099795_10052507
882 Ga0099795_10137400
883 Ga0105244_10207473
884 Ga0105250_10015581
885 Ga0105250_10116772
886 Ga0105240_10006571
887 Ga0105240_10040606
888 Ga0105240_10308819
889 Ga0111539_10000196
890 Ga0111539_10001652
891 Ga0111539_10042454
892 Ga0105245_10111313
893 Ga0105245_10121835
894 Ga0105245_10124637
895 Ga0114129_10001020
896 Ga0114129_10002010
897 Ga0114129_10307789
898 Ga0105243_10227531
899 Ga0105243_10323648
900 Ga0105241_10001021
901 Ga0105241_10405222
902 Ga0105242_10549970
903 Ga0105248_10285459
904 Ga0105237_10038408
905 Ga0105237_10103026
906 Ga0105238_10002878
907 Ga0105238_10038955
908 Ga0105238_10059650
909 Ga0105238_10167306
910 Ga0105238_10241439
911 Ga0105238_10519561
912 Ga0099796_10006120
913 Ga0105239_10003672
914 Ga0105239_10224443
915 Ga0105239_10596463
916 Ga0105239_10676404
917 Ga0105246_10483171
918 Ga0157314_1009402
919 Ga0157374_10116372
920 Ga0157378_10144692
921 Ga0163162_11045964
922 Ga0157375_10061161
923 Ga0157375_10277678
924 Ga0157375_10634475
925 Ga0163163_11282949
926 Ga0157380_10074167
927 Ga0157380_10494127
928 Ga0182008_10252312
929 Ga0182008_10327202
930 Ga0157376_10331706
931 Ga0157376_10828448
932 Ga0163161_10092436
933 Ga0206354_10053259
934 Ga0206353_10729413
935 Ga0213876_10028716
936 Ga0209233_1002800
937 Ga0209758_1010993
938 Ga0207697_10090772
939 Ga0207653_10037968
940 Ga0207692_10000175
941 Ga0207692_10002381
942 Ga0207642_10088031
943 Ga0207642_10193658
944 Ga0207688_10103008
945 Ga0207647_10001081
946 Ga0207685_10002732
947 Ga0207699_10000618
948 Ga0207699_10005953
949 Ga0207699_10257558
950 Ga0207645_10055827
951 Ga0207643_10097437
952 Ga0207654_10000163
953 Ga0207707_10031530
954 Ga0207707_10127394
955 Ga0207695_10001547
956 Ga0207695_10031001
957 Ga0207695_10309411
958 Ga0207671_10036003
959 Ga0207693_10000445
960 Ga0207693_10004737
961 Ga0207693_10007171
962 Ga0207693_10113958
963 Ga0207663_10001290
964 Ga0207663_10065287
965 Ga0207663_10180997
966 Ga0207663_10362525
967 Ga0207663_10370972
968 Ga0207660_10220763
969 Ga0207660_10379578
970 Ga0207662_10067356
971 Ga0207657_10451863
972 Ga0207649_10023691
973 Ga0207652_10198389
974 Ga0207652_10555607
975 Ga0207646_10216411
976 Ga0207681_10197054
977 Ga0207694_10000050
978 Ga0207694_10004359
979 Ga0207694_10208745
980 Ga0207694_10486822
981 Ga0207650_10268591
982 Ga0207659_10216431
983 Ga0207687_10210476
984 Ga0207687_10266734
985 Ga0207687_10339080
986 Ga0207700_10152008
987 Ga0207700_10346755
988 Ga0207664_10004578
989 Ga0207664_10017510
990 Ga0207664_10741897
991 Ga0207690_10538377
992 Ga0207690_10590114
993 Ga0207709_10235960
994 Ga0207709_10318126
995 Ga0207669_10014799
996 Ga0207665_10000651
997 Ga0207665_10045418
998 Ga0207665_10081699
999 Ga0207691_10114053
1000 Ga0207691_10336686
1001 Ga0207661_10028889
1002 Ga0207667_10012112
1003 Ga0207667_10170755
1004 Ga0207667_10426789
1005 Ga0207667_10660358
1006 Ga0207668_10014275
1007 Ga0207668_10168660
1008 Ga0207668_10367955
1009 Ga0207668_10410886
1010 Ga0207640_10019310
1011 Ga0207640_10038923
1012 Ga0207640_10218733
1013 Ga0207658_10189208
1014 Ga0207677_10047407
1015 Ga0207703_10075656
1016 Ga0207703_10282044
1017 Ga0207703_10338383
1018 Ga0207639_10003890
1019 Ga0207639_10042094
1020 Ga0207639_10094945
1021 Ga0207678_10038284
1022 Ga0207678_10258766
1023 Ga0207678_10700670
1024 Ga0207702_10000002
1025 Ga0207702_10001047
1026 Ga0207702_10009454
1027 Ga0207641_10126230
1028 Ga0207648_10078294
1029 Ga0207674_10005123
1030 Ga0207674_10011035
1031 Ga0207674_10106906
1032 Ga0207674_10191461
1033 Ga0207675_100100807
1034 Ga0207675_100247407
1035 Ga0207675_100558089
1036 Ga0207683_10041716
1037 Ga0207683_10101864
1038 Ga0207683_10556301
1039 Ga0207698_10407137
1040 Ga0209589_1000001
1041 Ga0209489_100001
1042 Ga0209700_100001
1043 Ga0209179_1001163
1044 Ga0207428_10000250
1045 Ga0207428_10007766
1046 Ga0207428_10081072
1047 Ga0268266_10002184
1048 Ga0268266_10053337
1049 Ga0268266_10532083
1050 Ga0268265_10032816
1051 Ga0268265_10193939
1052 Ga0268265_10353899
1053 Ga0268264_10000065
1054 Ga0268264_10305314
1055 Ga0268264_10344540
1056 Ga0268264_10505813
1057 Ga0265334_10047264
1058 Ga0265338_10079216
1059 Ga0265330_10012607
1060 Ga0265330_10039625
1061 Ga0265330_10043741
1062 Ga0265332_10007077
1063 Ga0265332_10010528
1064 Ga0265320_10015104
1065 Ga0265325_10004321
1066 Ga0265325_10084307
1067 Ga0265340_10017688
1068 Ga0265339_10001858
1069 Ga0265331_10135621
1070 Ga0265316_10095721
1071 Ga0265316_10351310
1072 Ga0307513_10230752
1073 Ga0307509_10091918
1074 Ga0307508_10046054
1075 Ga0307508_10208901
1076 Ga0265314_10073740
1077 Ga0265314_10117002
1078 Ga0265342_10134800
1079 Ga0265342_10136570
1080 Ga0265342_10215670
1081 Ga0307413_10039002
1082 Ga0307413_10152641
1083 Ga0307409_100517270
1084 Ga0307416_100062417
1085 Ga0307415_100300563
1086 Ga0307415_100406734
1087 Ga0307507_10031270
1088 Ga0307510_10021118
1089 Ga0307510_10034144
1090 Ga0307510_10146621
1091 Ga0315911_1000006
1092 Ga0373930_0018279
1093 Ga0373948_0001401
1094 Ga0373950_0025845
1095 Ga0373959_0021738
1096 Ga0373938_0032377
1097 Ga0373940_0006395
1098 Ga0373944_0122140
1099 Ga0373951_0014701
1100 Ga0373923_0259686
1101 Ga0373936_0047940
1102 Ga0373941_0221643
1103 Ga0373956_0007962
1104 Ga0373957_0003656
1105 Ga0373960_0074121
1106 Ga0373960_0123414
1107 Ga0373943_0051656
1108 Ga0373943_0139852
1109 Ga0373946_0285627
1110 Ga0373955_0000848
1111 Ga0373955_0027989
1112 Ga0373942_0044569
1113 Ga0373942_0141157
1114 Ga0373962_0105207
1115 Ga0373924_0063206
1116 Ga0373931_0013805
1117 Ga0373931_0073237
1118 Ga0373935_0000186
1119 Ga0373935_0008682
1120 Ga0373935_0302433
1121 Ga0373927_0001401
1122 Ga0373927_0008512
1123 Ga0373927_0015297
1124 Ga0373927_0018326
1125 Ga0373927_0036482
1126 Ga0373927_0105884
1127 Ga0373933_0006901
1128 Ga0373947_0007200
1129 Ga0373947_0007324
1130 Ga0373947_0012405
1131 Ga0373947_0069267
1132 Ga0373947_0118761
1133 Ga0373937_0027189
1134 Ga0373937_0215379
1135 Ga0373937_0377820
1136 Ga0373925_0002553
1137 Ga0373925_0044441
1138 Ga0373925_0093474
1139 Ga0395898_0287964
1140 Ga0436365_0641618
1141 Ga0436365_0919787
1142 Ga0436363_0292837
1143 Ga0436363_1472986
1144 Ga0451797_1406699
1145 Ga0451800_1037900
1146 Ga0451807_1338646
1147 Ga0451843_0944616
1148 Ga0439446_0006873
1149 Ga0466969_0075002
1150 Ga0466970_0330990
1151 Ga0466957_0074288
1152 Ga0466967_0088384
1153 Ga0495592_0001299
1154 Ga0495603_0001707
1155 Ga0495603_0019417
1156 Ga0495603_0257106
1157 Ga0495590_0075391
1158 Ga0495591_066561
1159 Ga0495629_0000606
1160 Ga0495629_0005522
1161 Ga0495641_0002686
1162 Ga0495641_0010400
1163 Ga0495651_0037223
1164 Ga0495651_0058917
1165 Ga0495650_0060382
1166 Ga0495650_0116673
1167 Ga0495580_0001307
1168 Ga0495582_0001692
1169 Ga0495582_0007172
1170 Ga0495582_0016553
1171 Ga0495582_0134775
1172 Ga0495605_0071460
1173 Ga0495639_0000136
1174 Ga0495639_0057840
1175 Ga0495662_0000392
1176 Ga0495594_0000843
1177 Ga0495594_0045176
1178 Ga0495594_0112661
1179 Ga0495606_0003785
1180 Ga0495606_0221551
1181 Ga0495608_0038614
1182 Ga0495608_0396845
1183 Ga0495618_0097869
1184 Ga0495643_0072477
1185 Ga0495644_0065738
1186 Ga0495648_0002991
1187 Ga0495648_0008609
1188 Ga0495663_0073023
1189 Ga0495666_0264652
1190 Ga0495652_0026021
1191 Ga0495665_0000026
1192 Ga0495640_0012296
1193 Ga0495587_0079142
1194 Ga0495598_0009970
1195 Ga0495598_0109106
1196 Ga0495621_0052773
1197 Ga0495645_0123626
1198 Ga0495667_0099070
1199 Ga0495667_0226820
1200 Ga0495634_0000634
1201 Ga0495634_0279655
1202 Ga0495625_0107333
1203 Ga0495635_0000827
1204 Ga0495588_0010887
1205 Ga0495657_0027053
1206 Ga0495657_0239914
1207 Ga0495646_0030827
1208 Ga0495647_0001263
1209 Ga0495647_0007767
1210 Ga0495647_0197285
1211 Ga0495658_0000278
1212 Ga0495658_0002383
1213 Ga0495658_0088242
1214 Ga0495669_0007025
1215 Ga0495613_0006647
1216 Ga0495613_0020275
1217 Ga0495624_0000201
1218 Ga0495624_0041652
1219 Ga0495624_0205691
1220 Ga0495624_0336957
1221 Ga0495589_0076065
1222 Ga0495600_0010238
1223 Ga0495581_0000828
1224 Ga0495581_0051878
1225 Ga0495581_0180056
1226 Ga0495581_0327165
1227 Ga0495636_0120917
1228 Ga0495674_0023985
1229 Ga0495672_0019491
1230 Ga0495676_0082122
1231 Ga0495676_0204964
1232 Ga0495680_0005700
1233 Ga0495680_0051958
1234 Ga0495673_0025196
1235 Ga0495684_0013981
1236 Ga0495686_0135290
1237 Ga0495593_0000282
1238 Ga0495602_0022737
1239 Ga0495602_0278366
1240 Ga0495602_0441704
1241 Ga0495614_0042323
1242 Ga0495615_0027994
1243 Ga0496100_0223771
1244 Ga0496100_0390056
1245 Ga0496101_0068749
1246 Ga0496101_0372150
1247 Ga0496101_0378472
1248 Ga0496102_0054754
1249 Ga0496102_0072210
1250 Ga0496102_0407936
1251 Ga0496102_0501114
1252 Ga0496103_0089263
1253 Ga0496104_0075695
1254 Ga0496104_0113103
1255 Ga0496104_0584086
1256 Ga0496105_0178130
1257 Ga0496105_0261442
1258 Ga0496106_0002133
1259 Ga0496106_0083214
1260 Ga0496106_0380461
1261 Ga0496106_0459947
1262 Ga0496106_0496353
1263 Ga0496107_0074689
1264 Ga0496107_0188823
1265 Ga0496108_0120609
1266 Ga0496109_0023474
1267 Ga0496109_0161425
1268 Ga0496109_0294755
1269 Ga0496109_0455839
1270 Ga0496110_0092380
1271 Ga0496110_0143055
1272 Ga0496110_0192225
1273 Ga0496111_0048441
1274 Ga0496111_0092043
1275 Ga0496111_0240601
1276 Ga0496112_0000004
1277 Ga0496112_0037597
1278 Ga0496112_0091691
1279 Ga0496112_0100520
1280 Ga0496112_0158882
1281 Ga0496112_0291987
1282 Ga0496113_0149548
1283 Ga0496114_0147432
1284 Ga0496114_0344092
1285 Ga0496115_0008261
1286 Ga0496115_0017594
1287 Ga0496115_0088001
1288 Ga0496115_0098692
1289 Ga0496115_0160119
1290 Ga0496115_0435227
1291 Ga0496117_0058895
1292 Ga0496118_0011549
1293 Ga0496118_0076136
1294 Ga0496118_0225655
1295 Ga0496119_0074699
1296 Ga0496119_0209801
1297 Ga0496121_0002279
1298 Ga0496121_0002820
1299 Ga0496121_0183234
1300 Ga0496121_0219157
1301 Ga0496124_0000722
1302 Ga0496124_0108081
1303 Ga0496124_0147632
1304 Ga0496126_0006670
1305 Ga0496126_0010727
1306 Ga0496126_0067735
1307 Ga0496126_0090027
1308 Ga0496126_0375983
1309 Ga0495678_133134
1310 Ga0501033_0101675
1311 Ga0501039_0364836
1312 Ga0501041_0269914
1313 Ga0501047_0281461
1314 Ga0501047_0420728
1315 Ga0501067_0000745
1316 Ga0501067_0302874
1317 Ga0501072_0341753
1318 Ga0501073_0033428
1319 Ga0501076_0351223
1320 Ga0501077_0141945
1321 Ga0501083_0044572
1322 Ga0501083_0098316
1323 Ga0501044_0164966
1324 nmdc:mga03n38_1488_c1
1325 nmdc:mga00v17_13507_c1
1326 nmdc:mga00v17_146863_c1
1327 nmdc:mga0yw44_11625_c1
1328 nmdc:mga0yw44_14499_c1
1329 nmdc:mga0yw44_4769_c2
1330 nmdc:mga0yw44_91687_c1
1331 nmdc:mga06z11_83400_c1
1332 nmdc:mga06z11_89446_c1
1333 nmdc:mga07m45_10308_c1
1334 nmdc:mga07m45_13377_c1
1335 nmdc:mga07m45_143549_c1
1336 nmdc:mga05p37_354_c1
1337 nmdc:mga05p37_4031_c1
1338 nmdc:mga05p37_77938_c1
1339 nmdc:mga09592_21598_c1
1340 nmdc:mga09592_4746_c1
1341 nmdc:mga0qj67_303385_c1
1342 nmdc:mga0qj67_935_c1
1343 nmdc:mga06r32_147_c1
1344 nmdc:mga06r32_2724_c1
1345 nmdc:mga08y16_142808_c1
1346 nmdc:mga08y16_289_c1
1347 nmdc:mga08y16_843_c1
1348 nmdc:mga0n895_132405_c1
1349 nmdc:mga0n895_246098_c1
1350 nmdc:mga0n895_40050_c1
1351 nmdc:mga0n895_545_c1
1352 nmdc:mga0n895_58554_c1
1353 nmdc:mga0rr50_1502_c1
1354 nmdc:mga0rr50_71805_c1
1355 nmdc:mga0rr50_8013_c1
1356 nmdc:mga0a205_60_c1
1357 nmdc:mga0sz30_217798_c1
1358 Ga0495601_0019340
1359 Ga0495601_0266609
1360 Ga0495612_0029163
1361 Ga0495595_0002637
1362 Ga0495619_0000996
1363 Ga0495619_0002254
1364 Ga0500578_0218453
1365 Ga0500644_0064795
1366 Ga0500647_0030293
1367 Ga0500641_0004635
1368 Ga0500554_000594
1369 Ga0500569_017447
1370 Ga0500595_003152
1371 Ga0500595_009148
1372 Ga0500655_025636
1373 Ga0500559_0089934
1374 Ga0500568_0071220
1375 Ga0500603_000431
1376 Ga0500616_0000034
1377 Ga0500616_0022170
1378 Ga0500638_134553
1379 Ga0500637_0005636
1380 Ga0500645_055605
1381 Ga0500596_010434
1382 Ga0501084_0099517
1383 Ga0501084_0156096
1384 Ga0501082_0066954
1385 2509151459
1386 2513657031
1387 2513696747
1388 2513703410
1389 2513855472
1390 2513889987
1391 2513918771
1392 2517892020
1393 2524534095
1394 2671121942
1395 2723846585
1396 2728753039
1397 2793068905
1398 2793080591
1399 2874605624
1400 2876814666
1401 2879115913
1402 2885375970
1403 2889039366
1404 2903751021
1405 2904694924
1406 2904702119
1407 2906617148
1408 2906639208
1409 2906662408
1410 2908742296
1411 2908759936
1412 2922365786
1413 2922391344
1414 2922430697
1415 2935636398
1416 2941509892
1417 2941520864
1418 2941525291
1419 3005480600
1420 8006940171
1421 8006969710
1422 8006979952
1423 8006987847
1424 8007000835
1425 8019556149
1426 8019569158
1427 8056676968
1428 8056692201

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02666

PS_Dcarbxylase

Phosphatidylserine decarboxylase

67

239

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5a65-assembly2.cif.gz_B crystal structure of mouse thiamine triphosphatase in complex with thiamine diphosphate, orthophosphate and magnesium ions. 0.5813 140 199
4zdg-assembly1.cif.gz_B structure of the adenovirus 14p1 knob domain 0.4573 121 161
2bhz-assembly1.cif.gz_A crystal structure of deinococcus radiodurans maltooligosyltrehalose trehalohydrolase in complex with maltose 0.411 141 193
6ik4-assembly1.cif.gz_A a novel m23 metalloprotease pseudoalterin from deep-sea 0.4106 64 230
6ik4-assembly1.cif.gz_A a novel m23 metalloprotease pseudoalterin from deep-sea 0.3973 64 230
ID Description Score Start End Superfamily
af_P9WHQ5_55_228_2.70.70.10 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.9423 48 218 2.70.70.10
af_P9WHQ5_55_228_2.70.70.10 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.9214 48 218 2.70.70.10
af_Q58227_16_200_2.70.70.10 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.8869 48 218 2.70.70.10
af_Q9UTB5_356_515_2.70.70.10 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.8247 97 215 2.70.70.10
af_P0A8K1_63_285_2.70.70.10 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.8238 61 218 2.70.70.10
ID Description Score Start End GO Terms
AF-Q2NBU9-F1-model_v4 Phosphatidylserine decarboxylase proenzyme (EC 4.1.1.65) [Cleaved into: Phosphatidylserine decarboxylase alpha chain; Phosphatidylserine decarboxylase beta chain] 0.9446 12 221 GO:0004609
GO:0005886
GO:0006646
AF-A0A848SXX3-F1-model_v4 Phosphatidylserine decarboxylase proenzyme (EC 4.1.1.65) [Cleaved into: Phosphatidylserine decarboxylase alpha chain; Phosphatidylserine decarboxylase beta chain] 0.9436 12 221 GO:0004609
GO:0005886
GO:0006646
AF-A0A845S2C7-F1-model_v4 Phosphatidylserine decarboxylase (EC 4.1.1.65) 0.9423 42 220 GO:0004609
GO:0005886
GO:0008654
AF-A0A662RX69-F1-model_v4 Phosphatidylserine decarboxylase family protein 0.9423 67 218 GO:0004609
GO:0005886
GO:0008654
AF-S9TJ73-F1-model_v4 Phosphatidylserine decarboxylase proenzyme (EC 4.1.1.65) [Cleaved into: Phosphatidylserine decarboxylase alpha chain; Phosphatidylserine decarboxylase beta chain] 0.9419 14 224 GO:0004609
GO:0005886
GO:0006646

Map