F476925
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 714 | 405 | 1428 | 232 |
Family's Representative Sequence
| Representative Sequence | 3300005439|Ga0070711_100274834|Ga0070711_1002748342 |
| Length | 253 |
| Sequence | MTEAQSRLAATRVGDNRSVVSMSIANSIRAQIPPVHPEGYPFIGGFALASLILFWIWTPLGWLGTLLTIWCALFFRDPVRVTPVREGIVVAPADGRISMVTQVLPPAELALGDKPLPRISIFMSVFNCHVNRSPAAGRIDRIAYRPGTFVNAELDKASEDNERNSLVISTPNGRIGVIQIAGLVARRIVSFVREGQSIGTGERFGLIRFGSRLDVYLPEGTRALVSEGQTAVAGETILADFRLGEDGRSFRPD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 3 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 4 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 46 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 47 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 51 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 52 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 53 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 54 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 55 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 56 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 57 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 58 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 59 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 60 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 61 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 62 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 64 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 65 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 66 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 67 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 71 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 72 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 73 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 74 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 75 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 76 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 77 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 78 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 79 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 80 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 81 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 83 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 84 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 85 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 86 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 87 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 100 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 103 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 110 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 113 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 114 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 115 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 168 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 169 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 170 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 172 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 176 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 177 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 178 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 179 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 180 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 181 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 182 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 183 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 184 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 185 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 186 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 187 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 188 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 189 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 190 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 191 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 192 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 193 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 194 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 195 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 196 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 197 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 198 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 199 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 200 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 201 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 202 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 203 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 204 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 205 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 206 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 207 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 208 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 209 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 210 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 211 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 212 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 213 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 214 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 215 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 216 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 217 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 218 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 219 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 220 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 221 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 222 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 223 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 224 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 225 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 226 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 227 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 228 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 229 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 230 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 231 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 232 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 233 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 234 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 235 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 236 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 293 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 294 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 295 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 296 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 297 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 298 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 299 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 300 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 301 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 302 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 303 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 304 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 305 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 306 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 307 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 308 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 309 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 310 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 311 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 312 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 313 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 314 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 327 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 328 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 329 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 330 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 331 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 340 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 345 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 346 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 347 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 348 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 349 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 350 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 351 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 352 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 353 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 354 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 355 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 356 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 357 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 358 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 359 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 360 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 362 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 363 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 364 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 365 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 366 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 367 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 368 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 369 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 370 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 371 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 372 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 373 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 374 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 375 | 2791355199 | |||
| 376 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 377 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 378 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 379 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 380 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 381 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 382 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 383 | 2904699407 | |||
| 384 | 2906610324 | |||
| 385 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 386 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 387 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 388 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 389 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 390 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 391 | 2922425934 | |||
| 392 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 393 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 394 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 395 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 396 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 397 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 398 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 399 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 400 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 401 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 402 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 403 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 404 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 405 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.08 |
| Metatranscriptomes | 0.28 |
| Isolates | 5.63 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.42 |
| Nodule | 5.32 |
| Rhizoplane | 7.28 |
| Rhizosphere | 73.95 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070711_100274834 | 3300005439 | Bacteria | 1331 |
| 2 | JGI25153J46596_10002102 | 3300003215 | Bacteria | 11668 |
| 3 | JGI25404J52841_10002404 | 3300003659 | Bacteria | 3534 |
| 4 | JGI25404J52841_10002915 | 3300003659 | Bacteria | 3315 |
| 5 | JGI25405J52794_10008076 | 3300003911 | Bacteria | 1956 |
| 6 | Ga0070676_10291185 | 3300005328 | Bacteria | 1103 |
| 7 | Ga0070683_100110038 | 3300005329 | Bacteria | 2599 |
| 8 | Ga0070683_100198458 | 3300005329 | Bacteria | 1905 |
| 9 | Ga0070690_100063213 | 3300005330 | Bacteria | 2388 |
| 10 | Ga0070670_100121850 | 3300005331 | Bacteria | 2250 |
| 11 | Ga0068869_100145749 | 3300005334 | Bacteria | 1832 |
| 12 | Ga0068869_100300226 | 3300005334 | Bacteria | 1296 |
| 13 | Ga0068869_100326568 | 3300005334 | Bacteria | 1245 |
| 14 | Ga0070666_10229912 | 3300005335 | Bacteria | 1309 |
| 15 | Ga0070680_100183513 | 3300005336 | Bacteria | 1762 |
| 16 | Ga0070680_100419972 | 3300005336 | Bacteria | 1141 |
| 17 | Ga0070682_100339151 | 3300005337 | Bacteria | 1117 |
| 18 | Ga0068868_100046352 | 3300005338 | Bacteria | 3402 |
| 19 | Ga0068868_100279405 | 3300005338 | Bacteria | 1413 |
| 20 | Ga0068868_100358419 | 3300005338 | Bacteria | 1250 |
| 21 | Ga0070660_100499904 | 3300005339 | Bacteria | 1011 |
| 22 | Ga0070691_10114201 | 3300005341 | Bacteria | 1354 |
| 23 | Ga0070661_100100008 | 3300005344 | Bacteria | 2156 |
| 24 | Ga0070668_100080026 | 3300005347 | Bacteria | 2559 |
| 25 | Ga0070668_100175212 | 3300005347 | Bacteria | 1748 |
| 26 | Ga0070668_100191224 | 3300005347 | Bacteria | 1676 |
| 27 | Ga0070668_100206908 | 3300005347 | Bacteria | 1612 |
| 28 | Ga0070669_100510073 | 3300005353 | Bacteria | 998 |
| 29 | Ga0070674_100090569 | 3300005356 | Bacteria | 2206 |
| 30 | Ga0070688_100303043 | 3300005365 | Bacteria | 1156 |
| 31 | Ga0070659_100138613 | 3300005366 | Bacteria | 1979 |
| 32 | Ga0070659_100276659 | 3300005366 | Bacteria | 1396 |
| 33 | Ga0070709_10000406 | 3300005434 | Bacteria | 26303 |
| 34 | Ga0070709_10002491 | 3300005434 | Bacteria | 9968 |
| 35 | Ga0070709_10274579 | 3300005434 | Bacteria | 1222 |
| 36 | Ga0070714_100007873 | 3300005435 | Bacteria | 8299 |
| 37 | Ga0070714_100009376 | 3300005435 | Bacteria | 7690 |
| 38 | Ga0070714_100036118 | 3300005435 | Bacteria | 4143 |
| 39 | Ga0070713_100010069 | 3300005436 | Bacteria | 6817 |
| 40 | Ga0070710_10002506 | 3300005437 | Bacteria | 8706 |
| 41 | Ga0070710_10004939 | 3300005437 | Bacteria | 6306 |
| 42 | Ga0070710_10181616 | 3300005437 | Bacteria | 1318 |
| 43 | Ga0070711_100006571 | 3300005439 | Bacteria | 7018 |
| 44 | Ga0070711_100011302 | 3300005439 | Bacteria | 5540 |
| 45 | Ga0070705_100204368 | 3300005440 | Bacteria | 1357 |
| 46 | Ga0070708_100268725 | 3300005445 | Bacteria | 1604 |
| 47 | Ga0070663_100056761 | 3300005455 | Bacteria | 2807 |
| 48 | Ga0070663_100088159 | 3300005455 | Bacteria | 2294 |
| 49 | Ga0070663_100387274 | 3300005455 | Bacteria | 1140 |
| 50 | Ga0070678_100245310 | 3300005456 | Bacteria | 1499 |
| 51 | Ga0070678_100589117 | 3300005456 | Bacteria | 991 |
| 52 | Ga0070662_100195580 | 3300005457 | Bacteria | 1601 |
| 53 | Ga0068867_100024058 | 3300005459 | Bacteria | 4364 |
| 54 | Ga0070706_100570232 | 3300005467 | Bacteria | 1052 |
| 55 | Ga0070707_100294144 | 3300005468 | Bacteria | 1578 |
| 56 | Ga0070698_100105570 | 3300005471 | Bacteria | 2786 |
| 57 | Ga0070699_100087780 | 3300005518 | Bacteria | 2715 |
| 58 | Ga0070679_100134496 | 3300005530 | Bacteria | 2453 |
| 59 | Ga0070679_100251884 | 3300005530 | Bacteria | 1722 |
| 60 | Ga0070679_100891787 | 3300005530 | Bacteria | 833 |
| 61 | Ga0070684_100001930 | 3300005535 | Bacteria | 15207 |
| 62 | Ga0070684_100139733 | 3300005535 | Bacteria | 2190 |
| 63 | Ga0070684_100533574 | 3300005535 | Bacteria | 1088 |
| 64 | Ga0070697_100170146 | 3300005536 | Bacteria | 1844 |
| 65 | Ga0068853_100000785 | 3300005539 | Bacteria | 22086 |
| 66 | Ga0068853_100059481 | 3300005539 | Bacteria | 3301 |
| 67 | Ga0070672_100057787 | 3300005543 | Bacteria | 3046 |
| 68 | Ga0070672_100535598 | 3300005543 | Bacteria | 1016 |
| 69 | Ga0070693_100254417 | 3300005547 | Bacteria | 1166 |
| 70 | Ga0070665_100058553 | 3300005548 | Bacteria | 3862 |
| 71 | Ga0070665_100450611 | 3300005548 | Bacteria | 1296 |
| 72 | Ga0070665_100581779 | 3300005548 | Bacteria | 1132 |
| 73 | Ga0070704_100165347 | 3300005549 | Bacteria | 1754 |
| 74 | Ga0070704_100276024 | 3300005549 | Bacteria | 1390 |
| 75 | Ga0068855_100186336 | 3300005563 | Bacteria | 2343 |
| 76 | Ga0068855_100451436 | 3300005563 | Bacteria | 1403 |
| 77 | Ga0068857_100098840 | 3300005577 | Bacteria | 2618 |
| 78 | Ga0068857_100424668 | 3300005577 | Bacteria | 1240 |
| 79 | Ga0068857_100761656 | 3300005577 | Bacteria | 923 |
| 80 | Ga0068854_100013500 | 3300005578 | Bacteria | 5364 |
| 81 | Ga0068854_100188063 | 3300005578 | Bacteria | 1617 |
| 82 | Ga0068856_100001102 | 3300005614 | Bacteria | 28542 |
| 83 | Ga0068856_100006806 | 3300005614 | Bacteria | 11188 |
| 84 | Ga0068852_100138950 | 3300005616 | Bacteria | 2246 |
| 85 | Ga0068859_100199898 | 3300005617 | Bacteria | 2083 |
| 86 | Ga0068859_100425398 | 3300005617 | Bacteria | 1424 |
| 87 | Ga0068866_10074037 | 3300005718 | Bacteria | 1809 |
| 88 | Ga0068861_100048002 | 3300005719 | Bacteria | 3225 |
| 89 | Ga0068851_10002497 | 3300005834 | Bacteria | 8086 |
| 90 | Ga0068870_10207059 | 3300005840 | Bacteria | 1192 |
| 91 | Ga0068870_10215356 | 3300005840 | Bacteria | 1172 |
| 92 | Ga0068863_100106895 | 3300005841 | Bacteria | 2662 |
| 93 | Ga0068858_100450238 | 3300005842 | Bacteria | 1241 |
| 94 | Ga0068858_100464123 | 3300005842 | Bacteria | 1221 |
| 95 | Ga0068858_100464468 | 3300005842 | Bacteria | 1220 |
| 96 | Ga0068858_100493454 | 3300005842 | Bacteria | 1182 |
| 97 | Ga0068860_100000213 | 3300005843 | Bacteria | 91105 |
| 98 | Ga0068860_100092658 | 3300005843 | Bacteria | 2879 |
| 99 | Ga0068860_100134269 | 3300005843 | Bacteria | 2376 |
| 100 | Ga0068860_100455767 | 3300005843 | Bacteria | 1272 |
| 101 | Ga0068862_100181261 | 3300005844 | Bacteria | 1890 |
| 102 | Ga0068862_100400094 | 3300005844 | Bacteria | 1284 |
| 103 | Ga0068862_100538138 | 3300005844 | Bacteria | 1114 |
| 104 | Ga0081455_10007979 | 3300005937 | Bacteria | 11070 |
| 105 | Ga0081455_10008327 | 3300005937 | Bacteria | 10801 |
| 106 | Ga0081455_10106985 | 3300005937 | Bacteria | 2230 |
| 107 | Ga0081538_10007674 | 3300005981 | Bacteria | 9300 |
| 108 | Ga0081540_1007133 | 3300005983 | Bacteria | 8019 |
| 109 | Ga0081540_1007585 | 3300005983 | Bacteria | 7707 |
| 110 | Ga0081540_1008782 | 3300005983 | Bacteria | 7021 |
| 111 | Ga0081540_1009218 | 3300005983 | Bacteria | 6806 |
| 112 | Ga0081540_1015852 | 3300005983 | Bacteria | 4750 |
| 113 | Ga0081540_1061324 | 3300005983 | Bacteria | 1793 |
| 114 | Ga0081539_10000148 | 3300005985 | Bacteria | 163442 |
| 115 | Ga0081539_10018102 | 3300005985 | Bacteria | 4907 |
| 116 | Ga0081539_10212272 | 3300005985 | Bacteria | 886 |
| 117 | Ga0070717_10018001 | 3300006028 | Bacteria | 5511 |
| 118 | Ga0070717_10535007 | 3300006028 | Bacteria | 1061 |
| 119 | Ga0075365_10013283 | 3300006038 | Bacteria | 4916 |
| 120 | Ga0075368_10122986 | 3300006042 | Bacteria | 1076 |
| 121 | Ga0075368_10129416 | 3300006042 | Bacteria | 1048 |
| 122 | Ga0075363_100015949 | 3300006048 | Bacteria | 3704 |
| 123 | Ga0075363_100472388 | 3300006048 | Bacteria | 743 |
| 124 | Ga0075364_10020660 | 3300006051 | Bacteria | 4143 |
| 125 | Ga0075364_10051738 | 3300006051 | Bacteria | 2683 |
| 126 | Ga0070715_10000111 | 3300006163 | Bacteria | 20025 |
| 127 | Ga0070715_10128283 | 3300006163 | Bacteria | 1218 |
| 128 | Ga0070716_100019234 | 3300006173 | Bacteria | 3567 |
| 129 | Ga0070716_100030299 | 3300006173 | Bacteria | 2934 |
| 130 | Ga0070712_100050814 | 3300006175 | Bacteria | 2886 |
| 131 | Ga0070712_100083216 | 3300006175 | Bacteria | 2323 |
| 132 | Ga0070712_100097971 | 3300006175 | Bacteria | 2162 |
| 133 | Ga0075362_10290257 | 3300006177 | Bacteria | 810 |
| 134 | Ga0075367_10031751 | 3300006178 | Bacteria | 3034 |
| 135 | Ga0075367_10035997 | 3300006178 | Bacteria | 2868 |
| 136 | Ga0075367_10057714 | 3300006178 | Bacteria | 2308 |
| 137 | Ga0075367_10108302 | 3300006178 | Bacteria | 1703 |
| 138 | Ga0075367_10134549 | 3300006178 | Bacteria | 1529 |
| 139 | Ga0075367_10401355 | 3300006178 | Bacteria | 867 |
| 140 | Ga0075427_10000818 | 3300006194 | Bacteria | 3793 |
| 141 | Ga0075366_10049585 | 3300006195 | Bacteria | 2491 |
| 142 | Ga0075370_10016464 | 3300006353 | Bacteria | 3978 |
| 143 | Ga0075370_10017555 | 3300006353 | Bacteria | 3868 |
| 144 | Ga0075370_10103127 | 3300006353 | Bacteria | 1652 |
| 145 | Ga0075370_10162371 | 3300006353 | Bacteria | 1311 |
| 146 | Ga0075428_100000363 | 3300006844 | Bacteria | 45033 |
| 147 | Ga0075428_100045907 | 3300006844 | Bacteria | 4800 |
| 148 | Ga0075430_100000717 | 3300006846 | Bacteria | 25305 |
| 149 | Ga0075430_100024258 | 3300006846 | Bacteria | 5161 |
| 150 | Ga0075431_100000990 | 3300006847 | Bacteria | 25307 |
| 151 | Ga0075431_100036558 | 3300006847 | Bacteria | 5058 |
| 152 | Ga0075433_10000187 | 3300006852 | Bacteria | 34883 |
| 153 | Ga0075434_100002790 | 3300006871 | Bacteria | 15468 |
| 154 | Ga0075434_100150988 | 3300006871 | Bacteria | 2343 |
| 155 | Ga0075434_100158903 | 3300006871 | Bacteria | 2280 |
| 156 | Ga0075429_100000846 | 3300006880 | Bacteria | 24030 |
| 157 | Ga0075429_100013723 | 3300006880 | Bacteria | 7023 |
| 158 | Ga0097620_100199892 | 3300006931 | Bacteria | 2083 |
| 159 | Ga0097620_100425409 | 3300006931 | Bacteria | 1424 |
| 160 | Ga0099824_1004142 | 3300006942 | Bacteria | 20984 |
| 161 | Ga0099822_1000454 | 3300006943 | Bacteria | 37516 |
| 162 | Ga0075435_100064842 | 3300007076 | Bacteria | 2969 |
| 163 | Ga0075435_100169185 | 3300007076 | Bacteria | 1843 |
| 164 | Ga0075435_100215136 | 3300007076 | Bacteria | 1631 |
| 165 | Ga0075435_100457802 | 3300007076 | Bacteria | 1100 |
| 166 | Ga0099794_10016927 | 3300007265 | Bacteria | 3241 |
| 167 | Ga0099795_10052507 | 3300007788 | Bacteria | 1489 |
| 168 | Ga0099795_10137400 | 3300007788 | Bacteria | 991 |
| 169 | Ga0105244_10207473 | 3300009036 | Bacteria | 922 |
| 170 | Ga0105250_10015581 | 3300009092 | Bacteria | 3112 |
| 171 | Ga0105250_10116772 | 3300009092 | Bacteria | 1095 |
| 172 | Ga0105240_10006571 | 3300009093 | Bacteria | 17074 |
| 173 | Ga0105240_10040606 | 3300009093 | Bacteria | 5948 |
| 174 | Ga0105240_10308819 | 3300009093 | Bacteria | 1807 |
| 175 | Ga0111539_10000196 | 3300009094 | Bacteria | 70998 |
| 176 | Ga0111539_10001652 | 3300009094 | Bacteria | 29773 |
| 177 | Ga0111539_10042454 | 3300009094 | Bacteria | 5460 |
| 178 | Ga0105245_10111313 | 3300009098 | Bacteria | 2546 |
| 179 | Ga0105245_10121835 | 3300009098 | Bacteria | 2437 |
| 180 | Ga0105245_10124637 | 3300009098 | Bacteria | 2410 |
| 181 | Ga0114129_10001020 | 3300009147 | Bacteria | 36568 |
| 182 | Ga0114129_10002010 | 3300009147 | Bacteria | 27861 |
| 183 | Ga0114129_10307789 | 3300009147 | Bacteria | 2110 |
| 184 | Ga0105243_10227531 | 3300009148 | Bacteria | 1652 |
| 185 | Ga0105243_10323648 | 3300009148 | Bacteria | 1406 |
| 186 | Ga0105241_10001021 | 3300009174 | Bacteria | 21313 |
| 187 | Ga0105241_10405222 | 3300009174 | Bacteria | 1197 |
| 188 | Ga0105242_10549970 | 3300009176 | Bacteria | 1107 |
| 189 | Ga0105248_10285459 | 3300009177 | Bacteria | 1858 |
| 190 | Ga0105237_10038408 | 3300009545 | Bacteria | 4834 |
| 191 | Ga0105237_10103026 | 3300009545 | Bacteria | 2846 |
| 192 | Ga0105238_10002878 | 3300009551 | Bacteria | 17208 |
| 193 | Ga0105238_10038955 | 3300009551 | Bacteria | 4824 |
| 194 | Ga0105238_10059650 | 3300009551 | Bacteria | 3821 |
| 195 | Ga0105238_10167306 | 3300009551 | Bacteria | 2174 |
| 196 | Ga0105238_10241439 | 3300009551 | Bacteria | 1784 |
| 197 | Ga0105238_10519561 | 3300009551 | Bacteria | 1193 |
| 198 | Ga0099796_10006120 | 3300010159 | Bacteria | 3061 |
| 199 | Ga0105239_10003672 | 3300010375 | Bacteria | 18737 |
| 200 | Ga0105239_10224443 | 3300010375 | Bacteria | 2107 |
| 201 | Ga0105239_10596463 | 3300010375 | Bacteria | 1260 |
| 202 | Ga0105239_10676404 | 3300010375 | Bacteria | 1179 |
| 203 | Ga0105246_10483171 | 3300011119 | Bacteria | 1048 |
| 204 | Ga0157314_1009402 | 3300012500 | Bacteria | 826 |
| 205 | Ga0157374_10116372 | 3300013296 | Bacteria | 2576 |
| 206 | Ga0157378_10144692 | 3300013297 | Bacteria | 2210 |
| 207 | Ga0163162_11045964 | 3300013306 | Bacteria | 924 |
| 208 | Ga0157375_10061161 | 3300013308 | Bacteria | 3738 |
| 209 | Ga0157375_10277678 | 3300013308 | Bacteria | 1838 |
| 210 | Ga0157375_10634475 | 3300013308 | Bacteria | 1225 |
| 211 | Ga0163163_11282949 | 3300014325 | Bacteria | 795 |
| 212 | Ga0157380_10074167 | 3300014326 | Bacteria | 2761 |
| 213 | Ga0157380_10494127 | 3300014326 | Bacteria | 1187 |
| 214 | Ga0182008_10252312 | 3300014497 | Bacteria | 910 |
| 215 | Ga0182008_10327202 | 3300014497 | Bacteria | 808 |
| 216 | Ga0157376_10331706 | 3300014969 | Bacteria | 1450 |
| 217 | Ga0157376_10828448 | 3300014969 | Bacteria | 939 |
| 218 | Ga0163161_10092436 | 3300017792 | Bacteria | 2240 |
| 219 | Ga0206354_10053259 | 3300020081 | Bacteria | 1187 |
| 220 | Ga0206353_10729413 | 3300020082 | Bacteria | 2061 |
| 221 | Ga0213876_10028716 | 3300021384 | Bacteria | 2933 |
| 222 | Ga0209233_1002800 | 3300025261 | Bacteria | 6260 |
| 223 | Ga0209758_1010993 | 3300025297 | Bacteria | 5312 |
| 224 | Ga0207697_10090772 | 3300025315 | Bacteria | 1294 |
| 225 | Ga0207653_10037968 | 3300025885 | Bacteria | 1572 |
| 226 | Ga0207692_10000175 | 3300025898 | Bacteria | 20519 |
| 227 | Ga0207692_10002381 | 3300025898 | Bacteria | 7221 |
| 228 | Ga0207642_10088031 | 3300025899 | Bacteria | 1527 |
| 229 | Ga0207642_10193658 | 3300025899 | Bacteria | 1117 |
| 230 | Ga0207688_10103008 | 3300025901 | Bacteria | 1650 |
| 231 | Ga0207647_10001081 | 3300025904 | Bacteria | 20998 |
| 232 | Ga0207685_10002732 | 3300025905 | Bacteria | 4116 |
| 233 | Ga0207699_10000618 | 3300025906 | Bacteria | 17312 |
| 234 | Ga0207699_10005953 | 3300025906 | Bacteria | 5869 |
| 235 | Ga0207699_10257558 | 3300025906 | Bacteria | 1205 |
| 236 | Ga0207645_10055827 | 3300025907 | Bacteria | 2521 |
| 237 | Ga0207643_10097437 | 3300025908 | Bacteria | 1721 |
| 238 | Ga0207654_10000163 | 3300025911 | Bacteria | 42749 |
| 239 | Ga0207707_10031530 | 3300025912 | Bacteria | 4638 |
| 240 | Ga0207707_10127394 | 3300025912 | Bacteria | 2226 |
| 241 | Ga0207695_10001547 | 3300025913 | Bacteria | 37828 |
| 242 | Ga0207695_10031001 | 3300025913 | Bacteria | 5876 |
| 243 | Ga0207695_10309411 | 3300025913 | Bacteria | 1470 |
| 244 | Ga0207671_10036003 | 3300025914 | Bacteria | 3671 |
| 245 | Ga0207693_10000445 | 3300025915 | Bacteria | 37840 |
| 246 | Ga0207693_10004737 | 3300025915 | Bacteria | 11439 |
| 247 | Ga0207693_10007171 | 3300025915 | Bacteria | 9182 |
| 248 | Ga0207693_10113958 | 3300025915 | Bacteria | 2121 |
| 249 | Ga0207663_10001290 | 3300025916 | Bacteria | 11612 |
| 250 | Ga0207663_10065287 | 3300025916 | Bacteria | 2326 |
| 251 | Ga0207663_10180997 | 3300025916 | Bacteria | 1505 |
| 252 | Ga0207663_10362525 | 3300025916 | Bacteria | 1100 |
| 253 | Ga0207663_10370972 | 3300025916 | Bacteria | 1088 |
| 254 | Ga0207660_10220763 | 3300025917 | Bacteria | 1487 |
| 255 | Ga0207660_10379578 | 3300025917 | Bacteria | 1136 |
| 256 | Ga0207662_10067356 | 3300025918 | Bacteria | 2159 |
| 257 | Ga0207657_10451863 | 3300025919 | Bacteria | 1008 |
| 258 | Ga0207649_10023691 | 3300025920 | Bacteria | 3558 |
| 259 | Ga0207652_10198389 | 3300025921 | Bacteria | 1806 |
| 260 | Ga0207652_10555607 | 3300025921 | Bacteria | 1031 |
| 261 | Ga0207646_10216411 | 3300025922 | Bacteria | 1730 |
| 262 | Ga0207681_10197054 | 3300025923 | Bacteria | 1544 |
| 263 | Ga0207694_10000050 | 3300025924 | Bacteria | 159920 |
| 264 | Ga0207694_10004359 | 3300025924 | Bacteria | 11057 |
| 265 | Ga0207694_10208745 | 3300025924 | Bacteria | 1590 |
| 266 | Ga0207694_10486822 | 3300025924 | Bacteria | 1032 |
| 267 | Ga0207650_10268591 | 3300025925 | Bacteria | 1386 |
| 268 | Ga0207659_10216431 | 3300025926 | Bacteria | 1538 |
| 269 | Ga0207687_10210476 | 3300025927 | Bacteria | 1525 |
| 270 | Ga0207687_10266734 | 3300025927 | Bacteria | 1367 |
| 271 | Ga0207687_10339080 | 3300025927 | Bacteria | 1222 |
| 272 | Ga0207700_10152008 | 3300025928 | Bacteria | 1914 |
| 273 | Ga0207700_10346755 | 3300025928 | Bacteria | 1292 |
| 274 | Ga0207664_10004578 | 3300025929 | Bacteria | 9370 |
| 275 | Ga0207664_10017510 | 3300025929 | Bacteria | 5255 |
| 276 | Ga0207664_10741897 | 3300025929 | Bacteria | 883 |
| 277 | Ga0207690_10538377 | 3300025932 | Bacteria | 948 |
| 278 | Ga0207690_10590114 | 3300025932 | Bacteria | 906 |
| 279 | Ga0207709_10235960 | 3300025935 | Bacteria | 1328 |
| 280 | Ga0207709_10318126 | 3300025935 | Bacteria | 1164 |
| 281 | Ga0207669_10014799 | 3300025937 | Bacteria | 3919 |
| 282 | Ga0207665_10000651 | 3300025939 | Bacteria | 23346 |
| 283 | Ga0207665_10045418 | 3300025939 | Bacteria | 2941 |
| 284 | Ga0207665_10081699 | 3300025939 | Bacteria | 2226 |
| 285 | Ga0207691_10114053 | 3300025940 | Bacteria | 2401 |
| 286 | Ga0207691_10336686 | 3300025940 | Bacteria | 1292 |
| 287 | Ga0207661_10028889 | 3300025944 | Bacteria | 4251 |
| 288 | Ga0207667_10012112 | 3300025949 | Bacteria | 9965 |
| 289 | Ga0207667_10170755 | 3300025949 | Bacteria | 2235 |
| 290 | Ga0207667_10426789 | 3300025949 | Bacteria | 1348 |
| 291 | Ga0207667_10660358 | 3300025949 | Bacteria | 1050 |
| 292 | Ga0207668_10014275 | 3300025972 | Bacteria | 4914 |
| 293 | Ga0207668_10168660 | 3300025972 | Bacteria | 1714 |
| 294 | Ga0207668_10367955 | 3300025972 | Bacteria | 1206 |
| 295 | Ga0207668_10410886 | 3300025972 | Bacteria | 1146 |
| 296 | Ga0207640_10019310 | 3300025981 | Bacteria | 4024 |
| 297 | Ga0207640_10038923 | 3300025981 | Bacteria | 3005 |
| 298 | Ga0207640_10218733 | 3300025981 | Bacteria | 1457 |
| 299 | Ga0207658_10189208 | 3300025986 | Bacteria | 1709 |
| 300 | Ga0207677_10047407 | 3300026023 | Bacteria | 2885 |
| 301 | Ga0207703_10075656 | 3300026035 | Bacteria | 2791 |
| 302 | Ga0207703_10282044 | 3300026035 | Bacteria | 1509 |
| 303 | Ga0207703_10338383 | 3300026035 | Bacteria | 1382 |
| 304 | Ga0207639_10003890 | 3300026041 | Bacteria | 10067 |
| 305 | Ga0207639_10042094 | 3300026041 | Bacteria | 3422 |
| 306 | Ga0207639_10094945 | 3300026041 | Bacteria | 2395 |
| 307 | Ga0207678_10038284 | 3300026067 | Bacteria | 4167 |
| 308 | Ga0207678_10258766 | 3300026067 | Bacteria | 1491 |
| 309 | Ga0207678_10700670 | 3300026067 | Bacteria | 891 |
| 310 | Ga0207702_10000002 | 3300026078 | Bacteria | 491507 |
| 311 | Ga0207702_10001047 | 3300026078 | Bacteria | 28331 |
| 312 | Ga0207702_10009454 | 3300026078 | Bacteria | 8188 |
| 313 | Ga0207641_10126230 | 3300026088 | Bacteria | 2291 |
| 314 | Ga0207648_10078294 | 3300026089 | Bacteria | 2883 |
| 315 | Ga0207674_10005123 | 3300026116 | Bacteria | 15638 |
| 316 | Ga0207674_10011035 | 3300026116 | Bacteria | 10160 |
| 317 | Ga0207674_10106906 | 3300026116 | Bacteria | 2775 |
| 318 | Ga0207674_10191461 | 3300026116 | Bacteria | 1995 |
| 319 | Ga0207675_100100807 | 3300026118 | Bacteria | 2720 |
| 320 | Ga0207675_100247407 | 3300026118 | Bacteria | 1725 |
| 321 | Ga0207675_100558089 | 3300026118 | Bacteria | 1145 |
| 322 | Ga0207683_10041716 | 3300026121 | Bacteria | 4007 |
| 323 | Ga0207683_10101864 | 3300026121 | Bacteria | 2564 |
| 324 | Ga0207683_10556301 | 3300026121 | Bacteria | 1061 |
| 325 | Ga0207698_10407137 | 3300026142 | Bacteria | 1302 |
| 326 | Ga0209589_1000001 | 3300027357 | Bacteria | 794224 |
| 327 | Ga0209489_100001 | 3300027361 | Bacteria | 794224 |
| 328 | Ga0209700_100001 | 3300027363 | Bacteria | 794224 |
| 329 | Ga0209179_1001163 | 3300027512 | Bacteria | 3097 |
| 330 | Ga0207428_10000250 | 3300027907 | Bacteria | 73217 |
| 331 | Ga0207428_10007766 | 3300027907 | Bacteria | 9761 |
| 332 | Ga0207428_10081072 | 3300027907 | Bacteria | 2534 |
| 333 | Ga0268266_10002184 | 3300028379 | Bacteria | 21420 |
| 334 | Ga0268266_10053337 | 3300028379 | Bacteria | 3473 |
| 335 | Ga0268266_10532083 | 3300028379 | Bacteria | 1124 |
| 336 | Ga0268265_10032816 | 3300028380 | Bacteria | 3767 |
| 337 | Ga0268265_10193939 | 3300028380 | Bacteria | 1756 |
| 338 | Ga0268265_10353899 | 3300028380 | Bacteria | 1342 |
| 339 | Ga0268264_10000065 | 3300028381 | Bacteria | 298403 |
| 340 | Ga0268264_10305314 | 3300028381 | Bacteria | 1499 |
| 341 | Ga0268264_10344540 | 3300028381 | Bacteria | 1416 |
| 342 | Ga0268264_10505813 | 3300028381 | Bacteria | 1179 |
| 343 | Ga0265334_10047264 | 3300028573 | Bacteria | 1661 |
| 344 | Ga0265338_10079216 | 3300028800 | Bacteria | 2766 |
| 345 | Ga0265330_10012607 | 3300031235 | Bacteria | 3951 |
| 346 | Ga0265330_10039625 | 3300031235 | Bacteria | 2093 |
| 347 | Ga0265330_10043741 | 3300031235 | Bacteria | 1980 |
| 348 | Ga0265332_10007077 | 3300031238 | Bacteria | 5080 |
| 349 | Ga0265332_10010528 | 3300031238 | Bacteria | 4118 |
| 350 | Ga0265320_10015104 | 3300031240 | Bacteria | 4372 |
| 351 | Ga0265325_10004321 | 3300031241 | Bacteria | 9002 |
| 352 | Ga0265325_10084307 | 3300031241 | Bacteria | 1575 |
| 353 | Ga0265340_10017688 | 3300031247 | Bacteria | 3687 |
| 354 | Ga0265339_10001858 | 3300031249 | Bacteria | 15532 |
| 355 | Ga0265331_10135621 | 3300031250 | Bacteria | 1121 |
| 356 | Ga0265316_10095721 | 3300031344 | Bacteria | 2261 |
| 357 | Ga0265316_10351310 | 3300031344 | Bacteria | 1067 |
| 358 | Ga0307513_10230752 | 3300031456 | Bacteria | 1664 |
| 359 | Ga0307509_10091918 | 3300031507 | Bacteria | 3104 |
| 360 | Ga0307508_10046054 | 3300031616 | Bacteria | 3895 |
| 361 | Ga0307508_10208901 | 3300031616 | Bacteria | 1552 |
| 362 | Ga0265314_10073740 | 3300031711 | Bacteria | 2275 |
| 363 | Ga0265314_10117002 | 3300031711 | Bacteria | 1685 |
| 364 | Ga0265342_10134800 | 3300031712 | Bacteria | 1381 |
| 365 | Ga0265342_10136570 | 3300031712 | Bacteria | 1370 |
| 366 | Ga0265342_10215670 | 3300031712 | Bacteria | 1036 |
| 367 | Ga0307413_10039002 | 3300031824 | Bacteria | 2758 |
| 368 | Ga0307413_10152641 | 3300031824 | Bacteria | 1612 |
| 369 | Ga0307409_100517270 | 3300031995 | Bacteria | 1165 |
| 370 | Ga0307416_100062417 | 3300032002 | Bacteria | 3047 |
| 371 | Ga0307415_100300563 | 3300032126 | Bacteria | 1329 |
| 372 | Ga0307415_100406734 | 3300032126 | Bacteria | 1164 |
| 373 | Ga0307507_10031270 | 3300033179 | Bacteria | 5591 |
| 374 | Ga0307510_10021118 | 3300033180 | Bacteria | 7594 |
| 375 | Ga0307510_10034144 | 3300033180 | Bacteria | 5700 |
| 376 | Ga0307510_10146621 | 3300033180 | Bacteria | 1990 |
| 377 | Ga0315911_1000006 | 3300033442 | Bacteria | 414563 |
| 378 | Ga0373930_0018279 | 3300034816 | Bacteria | 1346 |
| 379 | Ga0373948_0001401 | 3300034817 | Bacteria | 3326 |
| 380 | Ga0373950_0025845 | 3300034818 | Bacteria | 1062 |
| 381 | Ga0373959_0021738 | 3300034820 | Bacteria | 1234 |
| 382 | Ga0373938_0032377 | 3300034957 | Bacteria | 1126 |
| 383 | Ga0373940_0006395 | 3300035088 | Bacteria | 2613 |
| 384 | Ga0373944_0122140 | 3300035089 | Bacteria | 898 |
| 385 | Ga0373951_0014701 | 3300035091 | Bacteria | 1760 |
| 386 | Ga0373923_0259686 | 3300035111 | Bacteria | 815 |
| 387 | Ga0373936_0047940 | 3300035113 | Bacteria | 1724 |
| 388 | Ga0373941_0221643 | 3300035115 | Bacteria | 727 |
| 389 | Ga0373956_0007962 | 3300035119 | Bacteria | 4281 |
| 390 | Ga0373957_0003656 | 3300035120 | Bacteria | 4584 |
| 391 | Ga0373960_0074121 | 3300035121 | Bacteria | 1059 |
| 392 | Ga0373960_0123414 | 3300035121 | Bacteria | 861 |
| 393 | Ga0373943_0051656 | 3300035170 | Bacteria | 2025 |
| 394 | Ga0373943_0139852 | 3300035170 | Bacteria | 1303 |
| 395 | Ga0373946_0285627 | 3300035171 | Bacteria | 813 |
| 396 | Ga0373955_0000848 | 3300035172 | Bacteria | 13090 |
| 397 | Ga0373955_0027989 | 3300035172 | Bacteria | 2919 |
| 398 | Ga0373942_0044569 | 3300035207 | Bacteria | 1222 |
| 399 | Ga0373942_0141157 | 3300035207 | Bacteria | 767 |
| 400 | Ga0373962_0105207 | 3300035242 | Bacteria | 884 |
| 401 | Ga0373924_0063206 | 3300035410 | Bacteria | 1552 |
| 402 | Ga0373931_0013805 | 3300035691 | Bacteria | 3938 |
| 403 | Ga0373931_0073237 | 3300035691 | Bacteria | 1874 |
| 404 | Ga0373935_0000186 | 3300035692 | Bacteria | 29290 |
| 405 | Ga0373935_0008682 | 3300035692 | Bacteria | 6084 |
| 406 | Ga0373935_0302433 | 3300035692 | Bacteria | 1131 |
| 407 | Ga0373927_0001401 | 3300035695 | Bacteria | 18162 |
| 408 | Ga0373927_0008512 | 3300035695 | Bacteria | 6901 |
| 409 | Ga0373927_0015297 | 3300035695 | Bacteria | 5067 |
| 410 | Ga0373927_0018326 | 3300035695 | Bacteria | 4601 |
| 411 | Ga0373927_0036482 | 3300035695 | Bacteria | 3197 |
| 412 | Ga0373927_0105884 | 3300035695 | Bacteria | 1831 |
| 413 | Ga0373933_0006901 | 3300035724 | Bacteria | 6187 |
| 414 | Ga0373947_0007200 | 3300035725 | Bacteria | 6447 |
| 415 | Ga0373947_0007324 | 3300035725 | Bacteria | 6389 |
| 416 | Ga0373947_0012405 | 3300035725 | Bacteria | 4883 |
| 417 | Ga0373947_0069267 | 3300035725 | Bacteria | 2159 |
| 418 | Ga0373947_0118761 | 3300035725 | Bacteria | 1678 |
| 419 | Ga0373937_0027189 | 3300036401 | Bacteria | 5171 |
| 420 | Ga0373937_0215379 | 3300036401 | Bacteria | 1807 |
| 421 | Ga0373937_0377820 | 3300036401 | Bacteria | 1344 |
| 422 | Ga0373925_0002553 | 3300037068 | Bacteria | 14496 |
| 423 | Ga0373925_0044441 | 3300037068 | Bacteria | 3298 |
| 424 | Ga0373925_0093474 | 3300037068 | Bacteria | 2302 |
| 425 | Ga0395898_0287964 | 3300037466 | Bacteria | 1567 |
| 426 | Ga0436365_0641618 | 3300039437 | Bacteria | 2486 |
| 427 | Ga0436365_0919787 | 3300039437 | Bacteria | 3799 |
| 428 | Ga0436363_0292837 | 3300039450 | Bacteria | 3697 |
| 429 | Ga0436363_1472986 | 3300039450 | Bacteria | 1408 |
| 430 | Ga0451797_1406699 | 3300041453 | Bacteria | 2150 |
| 431 | Ga0451800_1037900 | 3300041459 | Bacteria | 889 |
| 432 | Ga0451807_1338646 | 3300041486 | Bacteria | 970 |
| 433 | Ga0451843_0944616 | 3300041509 | Bacteria | 1013 |
| 434 | Ga0439446_0006873 | 3300042156 | Bacteria | 2980 |
| 435 | Ga0466969_0075002 | 3300044656 | Bacteria | 1622 |
| 436 | Ga0466970_0330990 | 3300044765 | Bacteria | 862 |
| 437 | Ga0466957_0074288 | 3300044842 | Bacteria | 2108 |
| 438 | Ga0466967_0088384 | 3300045976 | Bacteria | 2812 |
| 439 | Ga0495592_0001299 | 3300046454 | Bacteria | 17352 |
| 440 | Ga0495603_0001707 | 3300046455 | Bacteria | 12934 |
| 441 | Ga0495603_0019417 | 3300046455 | Bacteria | 4113 |
| 442 | Ga0495603_0257106 | 3300046455 | Bacteria | 1005 |
| 443 | Ga0495590_0075391 | 3300046457 | Bacteria | 1186 |
| 444 | Ga0495591_066561 | 3300046458 | Bacteria | 945 |
| 445 | Ga0495629_0000606 | 3300046459 | Bacteria | 29232 |
| 446 | Ga0495629_0005522 | 3300046459 | Bacteria | 9436 |
| 447 | Ga0495641_0002686 | 3300046461 | Bacteria | 13835 |
| 448 | Ga0495641_0010400 | 3300046461 | Bacteria | 5397 |
| 449 | Ga0495651_0037223 | 3300046462 | Bacteria | 3788 |
| 450 | Ga0495651_0058917 | 3300046462 | Bacteria | 2946 |
| 451 | Ga0495650_0060382 | 3300046471 | Bacteria | 1523 |
| 452 | Ga0495650_0116673 | 3300046471 | Bacteria | 986 |
| 453 | Ga0495580_0001307 | 3300046472 | Bacteria | 21998 |
| 454 | Ga0495582_0001692 | 3300046473 | Bacteria | 12451 |
| 455 | Ga0495582_0007172 | 3300046473 | Bacteria | 6188 |
| 456 | Ga0495582_0016553 | 3300046473 | Bacteria | 4038 |
| 457 | Ga0495582_0134775 | 3300046473 | Bacteria | 1397 |
| 458 | Ga0495605_0071460 | 3300046474 | Bacteria | 1639 |
| 459 | Ga0495639_0000136 | 3300046475 | Bacteria | 37792 |
| 460 | Ga0495639_0057840 | 3300046475 | Bacteria | 1772 |
| 461 | Ga0495662_0000392 | 3300046476 | Bacteria | 19571 |
| 462 | Ga0495594_0000843 | 3300046499 | Bacteria | 15801 |
| 463 | Ga0495594_0045176 | 3300046499 | Bacteria | 2418 |
| 464 | Ga0495594_0112661 | 3300046499 | Bacteria | 1534 |
| 465 | Ga0495606_0003785 | 3300046507 | Bacteria | 15720 |
| 466 | Ga0495606_0221551 | 3300046507 | Bacteria | 1065 |
| 467 | Ga0495608_0038614 | 3300046511 | Bacteria | 3205 |
| 468 | Ga0495608_0396845 | 3300046511 | Bacteria | 844 |
| 469 | Ga0495618_0097869 | 3300046514 | Bacteria | 1877 |
| 470 | Ga0495643_0072477 | 3300046522 | Bacteria | 1806 |
| 471 | Ga0495644_0065738 | 3300046523 | Bacteria | 1362 |
| 472 | Ga0495648_0002991 | 3300046524 | Bacteria | 15159 |
| 473 | Ga0495648_0008609 | 3300046524 | Bacteria | 8003 |
| 474 | Ga0495663_0073023 | 3300046525 | Bacteria | 1095 |
| 475 | Ga0495666_0264652 | 3300046526 | Bacteria | 781 |
| 476 | Ga0495652_0026021 | 3300046529 | Bacteria | 5171 |
| 477 | Ga0495665_0000026 | 3300046531 | Bacteria | 56855 |
| 478 | Ga0495640_0012296 | 3300046533 | Bacteria | 6547 |
| 479 | Ga0495587_0079142 | 3300046536 | Bacteria | 1906 |
| 480 | Ga0495598_0009970 | 3300046537 | Bacteria | 2261 |
| 481 | Ga0495598_0109106 | 3300046537 | Bacteria | 925 |
| 482 | Ga0495621_0052773 | 3300046539 | Bacteria | 1458 |
| 483 | Ga0495645_0123626 | 3300046543 | Bacteria | 1820 |
| 484 | Ga0495667_0099070 | 3300046559 | Bacteria | 1887 |
| 485 | Ga0495667_0226820 | 3300046559 | Bacteria | 1191 |
| 486 | Ga0495634_0000634 | 3300046642 | Bacteria | 34163 |
| 487 | Ga0495634_0279655 | 3300046642 | Bacteria | 1014 |
| 488 | Ga0495625_0107333 | 3300046660 | Bacteria | 1911 |
| 489 | Ga0495635_0000827 | 3300046663 | Bacteria | 20282 |
| 490 | Ga0495588_0010887 | 3300046674 | Bacteria | 4251 |
| 491 | Ga0495657_0027053 | 3300046675 | Bacteria | 4053 |
| 492 | Ga0495657_0239914 | 3300046675 | Bacteria | 1094 |
| 493 | Ga0495646_0030827 | 3300046680 | Bacteria | 3346 |
| 494 | Ga0495647_0001263 | 3300046681 | Bacteria | 7804 |
| 495 | Ga0495647_0007767 | 3300046681 | Bacteria | 3602 |
| 496 | Ga0495647_0197285 | 3300046681 | Bacteria | 882 |
| 497 | Ga0495658_0000278 | 3300046683 | Bacteria | 29065 |
| 498 | Ga0495658_0002383 | 3300046683 | Bacteria | 9484 |
| 499 | Ga0495658_0088242 | 3300046683 | Bacteria | 1833 |
| 500 | Ga0495669_0007025 | 3300046684 | Bacteria | 4713 |
| 501 | Ga0495613_0006647 | 3300046689 | Bacteria | 8639 |
| 502 | Ga0495613_0020275 | 3300046689 | Bacteria | 4957 |
| 503 | Ga0495624_0000201 | 3300046690 | Bacteria | 45984 |
| 504 | Ga0495624_0041652 | 3300046690 | Bacteria | 2937 |
| 505 | Ga0495624_0205691 | 3300046690 | Bacteria | 1195 |
| 506 | Ga0495624_0336957 | 3300046690 | Bacteria | 908 |
| 507 | Ga0495589_0076065 | 3300046794 | Bacteria | 1637 |
| 508 | Ga0495600_0010238 | 3300046809 | Bacteria | 5813 |
| 509 | Ga0495581_0000828 | 3300047315 | Bacteria | 16501 |
| 510 | Ga0495581_0051878 | 3300047315 | Bacteria | 2369 |
| 511 | Ga0495581_0180056 | 3300047315 | Bacteria | 1236 |
| 512 | Ga0495581_0327165 | 3300047315 | Bacteria | 895 |
| 513 | Ga0495636_0120917 | 3300047318 | Bacteria | 1158 |
| 514 | Ga0495674_0023985 | 3300047319 | Bacteria | 5612 |
| 515 | Ga0495672_0019491 | 3300047320 | Bacteria | 4471 |
| 516 | Ga0495676_0082122 | 3300047321 | Bacteria | 2440 |
| 517 | Ga0495676_0204964 | 3300047321 | Bacteria | 1368 |
| 518 | Ga0495680_0005700 | 3300047322 | Bacteria | 11659 |
| 519 | Ga0495680_0051958 | 3300047322 | Bacteria | 3197 |
| 520 | Ga0495673_0025196 | 3300047469 | Bacteria | 2860 |
| 521 | Ga0495684_0013981 | 3300047471 | Bacteria | 6176 |
| 522 | Ga0495686_0135290 | 3300047472 | Bacteria | 1458 |
| 523 | Ga0495593_0000282 | 3300047673 | Bacteria | 27666 |
| 524 | Ga0495602_0022737 | 3300048088 | Bacteria | 6131 |
| 525 | Ga0495602_0278366 | 3300048088 | Bacteria | 1234 |
| 526 | Ga0495602_0441704 | 3300048088 | Bacteria | 920 |
| 527 | Ga0495614_0042323 | 3300048089 | Bacteria | 1953 |
| 528 | Ga0495615_0027994 | 3300048090 | Bacteria | 1327 |
| 529 | Ga0496100_0223771 | 3300048903 | Bacteria | 1382 |
| 530 | Ga0496100_0390056 | 3300048903 | Bacteria | 1059 |
| 531 | Ga0496101_0068749 | 3300048904 | Bacteria | 2590 |
| 532 | Ga0496101_0372150 | 3300048904 | Bacteria | 1123 |
| 533 | Ga0496101_0378472 | 3300048904 | Bacteria | 1114 |
| 534 | Ga0496102_0054754 | 3300048905 | Bacteria | 3638 |
| 535 | Ga0496102_0072210 | 3300048905 | Bacteria | 3171 |
| 536 | Ga0496102_0407936 | 3300048905 | Bacteria | 1277 |
| 537 | Ga0496102_0501114 | 3300048905 | Bacteria | 1136 |
| 538 | Ga0496103_0089263 | 3300048906 | Bacteria | 1944 |
| 539 | Ga0496104_0075695 | 3300048907 | Bacteria | 3205 |
| 540 | Ga0496104_0113103 | 3300048907 | Bacteria | 2603 |
| 541 | Ga0496104_0584086 | 3300048907 | Bacteria | 1028 |
| 542 | Ga0496105_0178130 | 3300048908 | Bacteria | 1741 |
| 543 | Ga0496105_0261442 | 3300048908 | Bacteria | 1399 |
| 544 | Ga0496106_0002133 | 3300048909 | Bacteria | 14779 |
| 545 | Ga0496106_0083214 | 3300048909 | Bacteria | 2461 |
| 546 | Ga0496106_0380461 | 3300048909 | Bacteria | 1134 |
| 547 | Ga0496106_0459947 | 3300048909 | Bacteria | 1022 |
| 548 | Ga0496106_0496353 | 3300048909 | Bacteria | 980 |
| 549 | Ga0496107_0074689 | 3300048910 | Bacteria | 2466 |
| 550 | Ga0496107_0188823 | 3300048910 | Bacteria | 1531 |
| 551 | Ga0496108_0120609 | 3300048911 | Bacteria | 2249 |
| 552 | Ga0496109_0023474 | 3300048912 | Bacteria | 5476 |
| 553 | Ga0496109_0161425 | 3300048912 | Bacteria | 2100 |
| 554 | Ga0496109_0294755 | 3300048912 | Bacteria | 1529 |
| 555 | Ga0496109_0455839 | 3300048912 | Bacteria | 1208 |
| 556 | Ga0496110_0092380 | 3300048913 | Bacteria | 2708 |
| 557 | Ga0496110_0143055 | 3300048913 | Bacteria | 2162 |
| 558 | Ga0496110_0192225 | 3300048913 | Bacteria | 1853 |
| 559 | Ga0496111_0048441 | 3300048914 | Bacteria | 3061 |
| 560 | Ga0496111_0092043 | 3300048914 | Bacteria | 2222 |
| 561 | Ga0496111_0240601 | 3300048914 | Bacteria | 1344 |
| 562 | Ga0496112_0000004 | 3300048915 | Bacteria | 553294 |
| 563 | Ga0496112_0037597 | 3300048915 | Bacteria | 4724 |
| 564 | Ga0496112_0091691 | 3300048915 | Bacteria | 3007 |
| 565 | Ga0496112_0100520 | 3300048915 | Bacteria | 2861 |
| 566 | Ga0496112_0158882 | 3300048915 | Bacteria | 2227 |
| 567 | Ga0496112_0291987 | 3300048915 | Bacteria | 1576 |
| 568 | Ga0496113_0149548 | 3300048916 | Bacteria | 1841 |
| 569 | Ga0496114_0147432 | 3300048917 | Bacteria | 2040 |
| 570 | Ga0496114_0344092 | 3300048917 | Bacteria | 1319 |
| 571 | Ga0496115_0008261 | 3300048918 | Bacteria | 7694 |
| 572 | Ga0496115_0017594 | 3300048918 | Bacteria | 5470 |
| 573 | Ga0496115_0088001 | 3300048918 | Bacteria | 2535 |
| 574 | Ga0496115_0098692 | 3300048918 | Bacteria | 2392 |
| 575 | Ga0496115_0160119 | 3300048918 | Bacteria | 1860 |
| 576 | Ga0496115_0435227 | 3300048918 | Bacteria | 1061 |
| 577 | Ga0496117_0058895 | 3300048920 | Bacteria | 2657 |
| 578 | Ga0496118_0011549 | 3300048921 | Bacteria | 8605 |
| 579 | Ga0496118_0076136 | 3300048921 | Bacteria | 2388 |
| 580 | Ga0496118_0225655 | 3300048921 | Bacteria | 1086 |
| 581 | Ga0496119_0074699 | 3300048922 | Bacteria | 1973 |
| 582 | Ga0496119_0209801 | 3300048922 | Bacteria | 1003 |
| 583 | Ga0496121_0002279 | 3300048924 | Bacteria | 29850 |
| 584 | Ga0496121_0002820 | 3300048924 | Bacteria | 25702 |
| 585 | Ga0496121_0183234 | 3300048924 | Bacteria | 1509 |
| 586 | Ga0496121_0219157 | 3300048924 | Bacteria | 1341 |
| 587 | Ga0496124_0000722 | 3300048927 | Bacteria | 54175 |
| 588 | Ga0496124_0108081 | 3300048927 | Bacteria | 2243 |
| 589 | Ga0496124_0147632 | 3300048927 | Bacteria | 1849 |
| 590 | Ga0496126_0006670 | 3300048929 | Bacteria | 12833 |
| 591 | Ga0496126_0010727 | 3300048929 | Bacteria | 9569 |
| 592 | Ga0496126_0067735 | 3300048929 | Bacteria | 3189 |
| 593 | Ga0496126_0090027 | 3300048929 | Bacteria | 2700 |
| 594 | Ga0496126_0375983 | 3300048929 | Bacteria | 1157 |
| 595 | Ga0495678_133134 | 3300049459 | Bacteria | 822 |
| 596 | Ga0501033_0101675 | 3300049570 | Bacteria | 2097 |
| 597 | Ga0501039_0364836 | 3300049575 | Bacteria | 1135 |
| 598 | Ga0501041_0269914 | 3300049577 | Bacteria | 1070 |
| 599 | Ga0501047_0281461 | 3300049581 | Bacteria | 1508 |
| 600 | Ga0501047_0420728 | 3300049581 | Bacteria | 1167 |
| 601 | Ga0501067_0000745 | 3300049583 | Bacteria | 17505 |
| 602 | Ga0501067_0302874 | 3300049583 | Bacteria | 890 |
| 603 | Ga0501072_0341753 | 3300049588 | Bacteria | 1189 |
| 604 | Ga0501073_0033428 | 3300049589 | Bacteria | 3662 |
| 605 | Ga0501076_0351223 | 3300049592 | Bacteria | 1211 |
| 606 | Ga0501077_0141945 | 3300049593 | Bacteria | 1523 |
| 607 | Ga0501083_0044572 | 3300049744 | Bacteria | 3002 |
| 608 | Ga0501083_0098316 | 3300049744 | Bacteria | 1930 |
| 609 | Ga0501044_0164966 | 3300049823 | Bacteria | 2190 |
| 610 | nmdc:mga03n38_1488_c1 | 3300050490 | Bacteria | 6754 |
| 611 | nmdc:mga00v17_13507_c1 | 3300050491 | Bacteria | 4537 |
| 612 | nmdc:mga00v17_146863_c1 | 3300050491 | Bacteria | 1514 |
| 613 | nmdc:mga0yw44_11625_c1 | 3300050492 | Bacteria | 4555 |
| 614 | nmdc:mga0yw44_14499_c1 | 3300050492 | Bacteria | 4188 |
| 615 | nmdc:mga0yw44_4769_c2 | 3300050492 | Bacteria | 5717 |
| 616 | nmdc:mga0yw44_91687_c1 | 3300050492 | Bacteria | 1922 |
| 617 | nmdc:mga06z11_83400_c1 | 3300050494 | Bacteria | 1720 |
| 618 | nmdc:mga06z11_89446_c1 | 3300050494 | Bacteria | 1669 |
| 619 | nmdc:mga07m45_10308_c1 | 3300050496 | Bacteria | 4876 |
| 620 | nmdc:mga07m45_13377_c1 | 3300050496 | Bacteria | 4354 |
| 621 | nmdc:mga07m45_143549_c1 | 3300050496 | Bacteria | 1383 |
| 622 | nmdc:mga05p37_354_c1 | 3300050507 | Bacteria | 49188 |
| 623 | nmdc:mga05p37_4031_c1 | 3300050507 | Bacteria | 17172 |
| 624 | nmdc:mga05p37_77938_c1 | 3300050507 | Bacteria | 4080 |
| 625 | nmdc:mga09592_21598_c1 | 3300050508 | Bacteria | 5306 |
| 626 | nmdc:mga09592_4746_c1 | 3300050508 | Bacteria | 11013 |
| 627 | nmdc:mga0qj67_303385_c1 | 3300050509 | Bacteria | 1293 |
| 628 | nmdc:mga0qj67_935_c1 | 3300050509 | Bacteria | 20095 |
| 629 | nmdc:mga06r32_147_c1 | 3300050510 | Bacteria | 53171 |
| 630 | nmdc:mga06r32_2724_c1 | 3300050510 | Bacteria | 15809 |
| 631 | nmdc:mga08y16_142808_c1 | 3300050511 | Bacteria | 2489 |
| 632 | nmdc:mga08y16_289_c1 | 3300050511 | Bacteria | 45654 |
| 633 | nmdc:mga08y16_843_c1 | 3300050511 | Bacteria | 22807 |
| 634 | nmdc:mga0n895_132405_c1 | 3300050512 | Bacteria | 2519 |
| 635 | nmdc:mga0n895_246098_c1 | 3300050512 | Bacteria | 1815 |
| 636 | nmdc:mga0n895_40050_c1 | 3300050512 | Bacteria | 4551 |
| 637 | nmdc:mga0n895_545_c1 | 3300050512 | Bacteria | 25797 |
| 638 | nmdc:mga0n895_58554_c1 | 3300050512 | Bacteria | 3798 |
| 639 | nmdc:mga0rr50_1502_c1 | 3300050513 | Bacteria | 12829 |
| 640 | nmdc:mga0rr50_71805_c1 | 3300050513 | Bacteria | 2642 |
| 641 | nmdc:mga0rr50_8013_c1 | 3300050513 | Bacteria | 6552 |
| 642 | nmdc:mga0a205_60_c1 | 3300050515 | Bacteria | 60202 |
| 643 | nmdc:mga0sz30_217798_c1 | 3300050516 | Bacteria | 849 |
| 644 | Ga0495601_0019340 | 3300053077 | Bacteria | 4153 |
| 645 | Ga0495601_0266609 | 3300053077 | Bacteria | 1117 |
| 646 | Ga0495612_0029163 | 3300053078 | Bacteria | 2222 |
| 647 | Ga0495595_0002637 | 3300053084 | Bacteria | 7039 |
| 648 | Ga0495619_0000996 | 3300053085 | Bacteria | 18589 |
| 649 | Ga0495619_0002254 | 3300053085 | Bacteria | 12749 |
| 650 | Ga0500578_0218453 | 3300053086 | Bacteria | 1160 |
| 651 | Ga0500644_0064795 | 3300053088 | Bacteria | 1299 |
| 652 | Ga0500647_0030293 | 3300053091 | Bacteria | 2570 |
| 653 | Ga0500641_0004635 | 3300053096 | Bacteria | 4860 |
| 654 | Ga0500554_000594 | 3300053102 | Bacteria | 7370 |
| 655 | Ga0500569_017447 | 3300053109 | Bacteria | 1836 |
| 656 | Ga0500595_003152 | 3300053119 | Bacteria | 7809 |
| 657 | Ga0500595_009148 | 3300053119 | Bacteria | 4012 |
| 658 | Ga0500655_025636 | 3300053133 | Bacteria | 1119 |
| 659 | Ga0500559_0089934 | 3300053136 | Bacteria | 1404 |
| 660 | Ga0500568_0071220 | 3300053139 | Bacteria | 1331 |
| 661 | Ga0500603_000431 | 3300053150 | Bacteria | 10890 |
| 662 | Ga0500616_0000034 | 3300053153 | Bacteria | 396651 |
| 663 | Ga0500616_0022170 | 3300053153 | Bacteria | 3550 |
| 664 | Ga0500638_134553 | 3300053162 | Bacteria | 1117 |
| 665 | Ga0500637_0005636 | 3300053178 | Bacteria | 6086 |
| 666 | Ga0500645_055605 | 3300053730 | Bacteria | 1149 |
| 667 | Ga0500596_010434 | 3300053735 | Bacteria | 1434 |
| 668 | Ga0501084_0099517 | 3300054114 | Bacteria | 2441 |
| 669 | Ga0501084_0156096 | 3300054114 | Bacteria | 1924 |
| 670 | Ga0501082_0066954 | 3300060353 | Bacteria | 3092 |
| 671 | 2509151459 | 2508501128 | Bacteria | 8613869 |
| 672 | 2513657031 | 2513237096 | Bacteria | 8722461 |
| 673 | 2513696747 | 2513237101 | Bacteria | 7952346 |
| 674 | 2513703410 | 2513237102 | Bacteria | 7703324 |
| 675 | 2513855472 | 2513237137 | Bacteria | 9558895 |
| 676 | 2513889987 | 2513237141 | Bacteria | 8496279 |
| 677 | 2513918771 | 2513237145 | Bacteria | 8979722 |
| 678 | 2517892020 | 2517572143 | Bacteria | 9484767 |
| 679 | 2524534095 | 2524023228 | Bacteria | 10118060 |
| 680 | 2671121942 | 2667528175 | Bacteria | 7532676 |
| 681 | 2723846585 | 2721755755 | Bacteria | 8322773 |
| 682 | 2728753039 | 2728368998 | Bacteria | 8720350 |
| 683 | 2793068905 | 2791355197 | Bacteria | 8420563 |
| 684 | 2793080591 | |||
| 685 | 2874605624 | 2874604998 | Bacteria | 7834745 |
| 686 | 2876814666 | 2876808645 | Bacteria | 8824342 |
| 687 | 2879115913 | 2879110137 | Bacteria | 8907982 |
| 688 | 2885375970 | 2885374607 | Bacteria | 8927485 |
| 689 | 2889039366 | 2889033259 | Bacteria | 9099371 |
| 690 | 2903751021 | 2903748898 | Bacteria | 9972761 |
| 691 | 2904694924 | 2904690495 | Bacteria | 9412302 |
| 692 | 2904702119 | |||
| 693 | 2906617148 | |||
| 694 | 2906639208 | 2906635258 | Bacteria | 8601019 |
| 695 | 2906662408 | 2906660503 | Bacteria | 8595048 |
| 696 | 2908742296 | 2908739725 | Bacteria | 8628932 |
| 697 | 2908759936 | 2908756301 | Bacteria | 8864324 |
| 698 | 2922365786 | 2922361189 | Bacteria | 7436256 |
| 699 | 2922391344 | 2922386360 | Bacteria | 7017218 |
| 700 | 2922430697 | |||
| 701 | 2935636398 | 2935630451 | Bacteria | 8169952 |
| 702 | 2941509892 | 2941507105 | Bacteria | 8166816 |
| 703 | 2941520864 | 2941515067 | Bacteria | 8166720 |
| 704 | 2941525291 | 2941523033 | Bacteria | 8169134 |
| 705 | 3005480600 | 3005474847 | Bacteria | 9259049 |
| 706 | 8006940171 | 8006933436 | Bacteria | 10410654 |
| 707 | 8006969710 | 8006964411 | Bacteria | 8966052 |
| 708 | 8006979952 | 8006973647 | Bacteria | 10679141 |
| 709 | 8006987847 | 8006984368 | Bacteria | 9651211 |
| 710 | 8007000835 | 8006994254 | Bacteria | 8309700 |
| 711 | 8019556149 | 8019555841 | Bacteria | 9642137 |
| 712 | 8019569158 | 8019565922 | Bacteria | 9639779 |
| 713 | 8056676968 | 8056673599 | Bacteria | 7871253 |
| 714 | 8056692201 | 8056689827 | Bacteria | 6712655 |
| 715 | Ga0070711_100274834 | |||
| 716 | JGI25153J46596_10002102 | |||
| 717 | JGI25404J52841_10002404 | |||
| 718 | JGI25404J52841_10002915 | |||
| 719 | JGI25405J52794_10008076 | |||
| 720 | Ga0070676_10291185 | |||
| 721 | Ga0070683_100110038 | |||
| 722 | Ga0070683_100198458 | |||
| 723 | Ga0070690_100063213 | |||
| 724 | Ga0070670_100121850 | |||
| 725 | Ga0068869_100145749 | |||
| 726 | Ga0068869_100300226 | |||
| 727 | Ga0068869_100326568 | |||
| 728 | Ga0070666_10229912 | |||
| 729 | Ga0070680_100183513 | |||
| 730 | Ga0070680_100419972 | |||
| 731 | Ga0070682_100339151 | |||
| 732 | Ga0068868_100046352 | |||
| 733 | Ga0068868_100279405 | |||
| 734 | Ga0068868_100358419 | |||
| 735 | Ga0070660_100499904 | |||
| 736 | Ga0070691_10114201 | |||
| 737 | Ga0070661_100100008 | |||
| 738 | Ga0070668_100080026 | |||
| 739 | Ga0070668_100175212 | |||
| 740 | Ga0070668_100191224 | |||
| 741 | Ga0070668_100206908 | |||
| 742 | Ga0070669_100510073 | |||
| 743 | Ga0070674_100090569 | |||
| 744 | Ga0070688_100303043 | |||
| 745 | Ga0070659_100138613 | |||
| 746 | Ga0070659_100276659 | |||
| 747 | Ga0070709_10000406 | |||
| 748 | Ga0070709_10002491 | |||
| 749 | Ga0070709_10274579 | |||
| 750 | Ga0070714_100007873 | |||
| 751 | Ga0070714_100009376 | |||
| 752 | Ga0070714_100036118 | |||
| 753 | Ga0070713_100010069 | |||
| 754 | Ga0070710_10002506 | |||
| 755 | Ga0070710_10004939 | |||
| 756 | Ga0070710_10181616 | |||
| 757 | Ga0070711_100006571 | |||
| 758 | Ga0070711_100011302 | |||
| 759 | Ga0070705_100204368 | |||
| 760 | Ga0070708_100268725 | |||
| 761 | Ga0070663_100056761 | |||
| 762 | Ga0070663_100088159 | |||
| 763 | Ga0070663_100387274 | |||
| 764 | Ga0070678_100245310 | |||
| 765 | Ga0070678_100589117 | |||
| 766 | Ga0070662_100195580 | |||
| 767 | Ga0068867_100024058 | |||
| 768 | Ga0070706_100570232 | |||
| 769 | Ga0070707_100294144 | |||
| 770 | Ga0070698_100105570 | |||
| 771 | Ga0070699_100087780 | |||
| 772 | Ga0070679_100134496 | |||
| 773 | Ga0070679_100251884 | |||
| 774 | Ga0070679_100891787 | |||
| 775 | Ga0070684_100001930 | |||
| 776 | Ga0070684_100139733 | |||
| 777 | Ga0070684_100533574 | |||
| 778 | Ga0070697_100170146 | |||
| 779 | Ga0068853_100000785 | |||
| 780 | Ga0068853_100059481 | |||
| 781 | Ga0070672_100057787 | |||
| 782 | Ga0070672_100535598 | |||
| 783 | Ga0070693_100254417 | |||
| 784 | Ga0070665_100058553 | |||
| 785 | Ga0070665_100450611 | |||
| 786 | Ga0070665_100581779 | |||
| 787 | Ga0070704_100165347 | |||
| 788 | Ga0070704_100276024 | |||
| 789 | Ga0068855_100186336 | |||
| 790 | Ga0068855_100451436 | |||
| 791 | Ga0068857_100098840 | |||
| 792 | Ga0068857_100424668 | |||
| 793 | Ga0068857_100761656 | |||
| 794 | Ga0068854_100013500 | |||
| 795 | Ga0068854_100188063 | |||
| 796 | Ga0068856_100001102 | |||
| 797 | Ga0068856_100006806 | |||
| 798 | Ga0068852_100138950 | |||
| 799 | Ga0068859_100199898 | |||
| 800 | Ga0068859_100425398 | |||
| 801 | Ga0068866_10074037 | |||
| 802 | Ga0068861_100048002 | |||
| 803 | Ga0068851_10002497 | |||
| 804 | Ga0068870_10207059 | |||
| 805 | Ga0068870_10215356 | |||
| 806 | Ga0068863_100106895 | |||
| 807 | Ga0068858_100450238 | |||
| 808 | Ga0068858_100464123 | |||
| 809 | Ga0068858_100464468 | |||
| 810 | Ga0068858_100493454 | |||
| 811 | Ga0068860_100000213 | |||
| 812 | Ga0068860_100092658 | |||
| 813 | Ga0068860_100134269 | |||
| 814 | Ga0068860_100455767 | |||
| 815 | Ga0068862_100181261 | |||
| 816 | Ga0068862_100400094 | |||
| 817 | Ga0068862_100538138 | |||
| 818 | Ga0081455_10007979 | |||
| 819 | Ga0081455_10008327 | |||
| 820 | Ga0081455_10106985 | |||
| 821 | Ga0081538_10007674 | |||
| 822 | Ga0081540_1007133 | |||
| 823 | Ga0081540_1007585 | |||
| 824 | Ga0081540_1008782 | |||
| 825 | Ga0081540_1009218 | |||
| 826 | Ga0081540_1015852 | |||
| 827 | Ga0081540_1061324 | |||
| 828 | Ga0081539_10000148 | |||
| 829 | Ga0081539_10018102 | |||
| 830 | Ga0081539_10212272 | |||
| 831 | Ga0070717_10018001 | |||
| 832 | Ga0070717_10535007 | |||
| 833 | Ga0075365_10013283 | |||
| 834 | Ga0075368_10122986 | |||
| 835 | Ga0075368_10129416 | |||
| 836 | Ga0075363_100015949 | |||
| 837 | Ga0075363_100472388 | |||
| 838 | Ga0075364_10020660 | |||
| 839 | Ga0075364_10051738 | |||
| 840 | Ga0070715_10000111 | |||
| 841 | Ga0070715_10128283 | |||
| 842 | Ga0070716_100019234 | |||
| 843 | Ga0070716_100030299 | |||
| 844 | Ga0070712_100050814 | |||
| 845 | Ga0070712_100083216 | |||
| 846 | Ga0070712_100097971 | |||
| 847 | Ga0075362_10290257 | |||
| 848 | Ga0075367_10031751 | |||
| 849 | Ga0075367_10035997 | |||
| 850 | Ga0075367_10057714 | |||
| 851 | Ga0075367_10108302 | |||
| 852 | Ga0075367_10134549 | |||
| 853 | Ga0075367_10401355 | |||
| 854 | Ga0075427_10000818 | |||
| 855 | Ga0075366_10049585 | |||
| 856 | Ga0075370_10016464 | |||
| 857 | Ga0075370_10017555 | |||
| 858 | Ga0075370_10103127 | |||
| 859 | Ga0075370_10162371 | |||
| 860 | Ga0075428_100000363 | |||
| 861 | Ga0075428_100045907 | |||
| 862 | Ga0075430_100000717 | |||
| 863 | Ga0075430_100024258 | |||
| 864 | Ga0075431_100000990 | |||
| 865 | Ga0075431_100036558 | |||
| 866 | Ga0075433_10000187 | |||
| 867 | Ga0075434_100002790 | |||
| 868 | Ga0075434_100150988 | |||
| 869 | Ga0075434_100158903 | |||
| 870 | Ga0075429_100000846 | |||
| 871 | Ga0075429_100013723 | |||
| 872 | Ga0097620_100199892 | |||
| 873 | Ga0097620_100425409 | |||
| 874 | Ga0099824_1004142 | |||
| 875 | Ga0099822_1000454 | |||
| 876 | Ga0075435_100064842 | |||
| 877 | Ga0075435_100169185 | |||
| 878 | Ga0075435_100215136 | |||
| 879 | Ga0075435_100457802 | |||
| 880 | Ga0099794_10016927 | |||
| 881 | Ga0099795_10052507 | |||
| 882 | Ga0099795_10137400 | |||
| 883 | Ga0105244_10207473 | |||
| 884 | Ga0105250_10015581 | |||
| 885 | Ga0105250_10116772 | |||
| 886 | Ga0105240_10006571 | |||
| 887 | Ga0105240_10040606 | |||
| 888 | Ga0105240_10308819 | |||
| 889 | Ga0111539_10000196 | |||
| 890 | Ga0111539_10001652 | |||
| 891 | Ga0111539_10042454 | |||
| 892 | Ga0105245_10111313 | |||
| 893 | Ga0105245_10121835 | |||
| 894 | Ga0105245_10124637 | |||
| 895 | Ga0114129_10001020 | |||
| 896 | Ga0114129_10002010 | |||
| 897 | Ga0114129_10307789 | |||
| 898 | Ga0105243_10227531 | |||
| 899 | Ga0105243_10323648 | |||
| 900 | Ga0105241_10001021 | |||
| 901 | Ga0105241_10405222 | |||
| 902 | Ga0105242_10549970 | |||
| 903 | Ga0105248_10285459 | |||
| 904 | Ga0105237_10038408 | |||
| 905 | Ga0105237_10103026 | |||
| 906 | Ga0105238_10002878 | |||
| 907 | Ga0105238_10038955 | |||
| 908 | Ga0105238_10059650 | |||
| 909 | Ga0105238_10167306 | |||
| 910 | Ga0105238_10241439 | |||
| 911 | Ga0105238_10519561 | |||
| 912 | Ga0099796_10006120 | |||
| 913 | Ga0105239_10003672 | |||
| 914 | Ga0105239_10224443 | |||
| 915 | Ga0105239_10596463 | |||
| 916 | Ga0105239_10676404 | |||
| 917 | Ga0105246_10483171 | |||
| 918 | Ga0157314_1009402 | |||
| 919 | Ga0157374_10116372 | |||
| 920 | Ga0157378_10144692 | |||
| 921 | Ga0163162_11045964 | |||
| 922 | Ga0157375_10061161 | |||
| 923 | Ga0157375_10277678 | |||
| 924 | Ga0157375_10634475 | |||
| 925 | Ga0163163_11282949 | |||
| 926 | Ga0157380_10074167 | |||
| 927 | Ga0157380_10494127 | |||
| 928 | Ga0182008_10252312 | |||
| 929 | Ga0182008_10327202 | |||
| 930 | Ga0157376_10331706 | |||
| 931 | Ga0157376_10828448 | |||
| 932 | Ga0163161_10092436 | |||
| 933 | Ga0206354_10053259 | |||
| 934 | Ga0206353_10729413 | |||
| 935 | Ga0213876_10028716 | |||
| 936 | Ga0209233_1002800 | |||
| 937 | Ga0209758_1010993 | |||
| 938 | Ga0207697_10090772 | |||
| 939 | Ga0207653_10037968 | |||
| 940 | Ga0207692_10000175 | |||
| 941 | Ga0207692_10002381 | |||
| 942 | Ga0207642_10088031 | |||
| 943 | Ga0207642_10193658 | |||
| 944 | Ga0207688_10103008 | |||
| 945 | Ga0207647_10001081 | |||
| 946 | Ga0207685_10002732 | |||
| 947 | Ga0207699_10000618 | |||
| 948 | Ga0207699_10005953 | |||
| 949 | Ga0207699_10257558 | |||
| 950 | Ga0207645_10055827 | |||
| 951 | Ga0207643_10097437 | |||
| 952 | Ga0207654_10000163 | |||
| 953 | Ga0207707_10031530 | |||
| 954 | Ga0207707_10127394 | |||
| 955 | Ga0207695_10001547 | |||
| 956 | Ga0207695_10031001 | |||
| 957 | Ga0207695_10309411 | |||
| 958 | Ga0207671_10036003 | |||
| 959 | Ga0207693_10000445 | |||
| 960 | Ga0207693_10004737 | |||
| 961 | Ga0207693_10007171 | |||
| 962 | Ga0207693_10113958 | |||
| 963 | Ga0207663_10001290 | |||
| 964 | Ga0207663_10065287 | |||
| 965 | Ga0207663_10180997 | |||
| 966 | Ga0207663_10362525 | |||
| 967 | Ga0207663_10370972 | |||
| 968 | Ga0207660_10220763 | |||
| 969 | Ga0207660_10379578 | |||
| 970 | Ga0207662_10067356 | |||
| 971 | Ga0207657_10451863 | |||
| 972 | Ga0207649_10023691 | |||
| 973 | Ga0207652_10198389 | |||
| 974 | Ga0207652_10555607 | |||
| 975 | Ga0207646_10216411 | |||
| 976 | Ga0207681_10197054 | |||
| 977 | Ga0207694_10000050 | |||
| 978 | Ga0207694_10004359 | |||
| 979 | Ga0207694_10208745 | |||
| 980 | Ga0207694_10486822 | |||
| 981 | Ga0207650_10268591 | |||
| 982 | Ga0207659_10216431 | |||
| 983 | Ga0207687_10210476 | |||
| 984 | Ga0207687_10266734 | |||
| 985 | Ga0207687_10339080 | |||
| 986 | Ga0207700_10152008 | |||
| 987 | Ga0207700_10346755 | |||
| 988 | Ga0207664_10004578 | |||
| 989 | Ga0207664_10017510 | |||
| 990 | Ga0207664_10741897 | |||
| 991 | Ga0207690_10538377 | |||
| 992 | Ga0207690_10590114 | |||
| 993 | Ga0207709_10235960 | |||
| 994 | Ga0207709_10318126 | |||
| 995 | Ga0207669_10014799 | |||
| 996 | Ga0207665_10000651 | |||
| 997 | Ga0207665_10045418 | |||
| 998 | Ga0207665_10081699 | |||
| 999 | Ga0207691_10114053 | |||
| 1000 | Ga0207691_10336686 | |||
| 1001 | Ga0207661_10028889 | |||
| 1002 | Ga0207667_10012112 | |||
| 1003 | Ga0207667_10170755 | |||
| 1004 | Ga0207667_10426789 | |||
| 1005 | Ga0207667_10660358 | |||
| 1006 | Ga0207668_10014275 | |||
| 1007 | Ga0207668_10168660 | |||
| 1008 | Ga0207668_10367955 | |||
| 1009 | Ga0207668_10410886 | |||
| 1010 | Ga0207640_10019310 | |||
| 1011 | Ga0207640_10038923 | |||
| 1012 | Ga0207640_10218733 | |||
| 1013 | Ga0207658_10189208 | |||
| 1014 | Ga0207677_10047407 | |||
| 1015 | Ga0207703_10075656 | |||
| 1016 | Ga0207703_10282044 | |||
| 1017 | Ga0207703_10338383 | |||
| 1018 | Ga0207639_10003890 | |||
| 1019 | Ga0207639_10042094 | |||
| 1020 | Ga0207639_10094945 | |||
| 1021 | Ga0207678_10038284 | |||
| 1022 | Ga0207678_10258766 | |||
| 1023 | Ga0207678_10700670 | |||
| 1024 | Ga0207702_10000002 | |||
| 1025 | Ga0207702_10001047 | |||
| 1026 | Ga0207702_10009454 | |||
| 1027 | Ga0207641_10126230 | |||
| 1028 | Ga0207648_10078294 | |||
| 1029 | Ga0207674_10005123 | |||
| 1030 | Ga0207674_10011035 | |||
| 1031 | Ga0207674_10106906 | |||
| 1032 | Ga0207674_10191461 | |||
| 1033 | Ga0207675_100100807 | |||
| 1034 | Ga0207675_100247407 | |||
| 1035 | Ga0207675_100558089 | |||
| 1036 | Ga0207683_10041716 | |||
| 1037 | Ga0207683_10101864 | |||
| 1038 | Ga0207683_10556301 | |||
| 1039 | Ga0207698_10407137 | |||
| 1040 | Ga0209589_1000001 | |||
| 1041 | Ga0209489_100001 | |||
| 1042 | Ga0209700_100001 | |||
| 1043 | Ga0209179_1001163 | |||
| 1044 | Ga0207428_10000250 | |||
| 1045 | Ga0207428_10007766 | |||
| 1046 | Ga0207428_10081072 | |||
| 1047 | Ga0268266_10002184 | |||
| 1048 | Ga0268266_10053337 | |||
| 1049 | Ga0268266_10532083 | |||
| 1050 | Ga0268265_10032816 | |||
| 1051 | Ga0268265_10193939 | |||
| 1052 | Ga0268265_10353899 | |||
| 1053 | Ga0268264_10000065 | |||
| 1054 | Ga0268264_10305314 | |||
| 1055 | Ga0268264_10344540 | |||
| 1056 | Ga0268264_10505813 | |||
| 1057 | Ga0265334_10047264 | |||
| 1058 | Ga0265338_10079216 | |||
| 1059 | Ga0265330_10012607 | |||
| 1060 | Ga0265330_10039625 | |||
| 1061 | Ga0265330_10043741 | |||
| 1062 | Ga0265332_10007077 | |||
| 1063 | Ga0265332_10010528 | |||
| 1064 | Ga0265320_10015104 | |||
| 1065 | Ga0265325_10004321 | |||
| 1066 | Ga0265325_10084307 | |||
| 1067 | Ga0265340_10017688 | |||
| 1068 | Ga0265339_10001858 | |||
| 1069 | Ga0265331_10135621 | |||
| 1070 | Ga0265316_10095721 | |||
| 1071 | Ga0265316_10351310 | |||
| 1072 | Ga0307513_10230752 | |||
| 1073 | Ga0307509_10091918 | |||
| 1074 | Ga0307508_10046054 | |||
| 1075 | Ga0307508_10208901 | |||
| 1076 | Ga0265314_10073740 | |||
| 1077 | Ga0265314_10117002 | |||
| 1078 | Ga0265342_10134800 | |||
| 1079 | Ga0265342_10136570 | |||
| 1080 | Ga0265342_10215670 | |||
| 1081 | Ga0307413_10039002 | |||
| 1082 | Ga0307413_10152641 | |||
| 1083 | Ga0307409_100517270 | |||
| 1084 | Ga0307416_100062417 | |||
| 1085 | Ga0307415_100300563 | |||
| 1086 | Ga0307415_100406734 | |||
| 1087 | Ga0307507_10031270 | |||
| 1088 | Ga0307510_10021118 | |||
| 1089 | Ga0307510_10034144 | |||
| 1090 | Ga0307510_10146621 | |||
| 1091 | Ga0315911_1000006 | |||
| 1092 | Ga0373930_0018279 | |||
| 1093 | Ga0373948_0001401 | |||
| 1094 | Ga0373950_0025845 | |||
| 1095 | Ga0373959_0021738 | |||
| 1096 | Ga0373938_0032377 | |||
| 1097 | Ga0373940_0006395 | |||
| 1098 | Ga0373944_0122140 | |||
| 1099 | Ga0373951_0014701 | |||
| 1100 | Ga0373923_0259686 | |||
| 1101 | Ga0373936_0047940 | |||
| 1102 | Ga0373941_0221643 | |||
| 1103 | Ga0373956_0007962 | |||
| 1104 | Ga0373957_0003656 | |||
| 1105 | Ga0373960_0074121 | |||
| 1106 | Ga0373960_0123414 | |||
| 1107 | Ga0373943_0051656 | |||
| 1108 | Ga0373943_0139852 | |||
| 1109 | Ga0373946_0285627 | |||
| 1110 | Ga0373955_0000848 | |||
| 1111 | Ga0373955_0027989 | |||
| 1112 | Ga0373942_0044569 | |||
| 1113 | Ga0373942_0141157 | |||
| 1114 | Ga0373962_0105207 | |||
| 1115 | Ga0373924_0063206 | |||
| 1116 | Ga0373931_0013805 | |||
| 1117 | Ga0373931_0073237 | |||
| 1118 | Ga0373935_0000186 | |||
| 1119 | Ga0373935_0008682 | |||
| 1120 | Ga0373935_0302433 | |||
| 1121 | Ga0373927_0001401 | |||
| 1122 | Ga0373927_0008512 | |||
| 1123 | Ga0373927_0015297 | |||
| 1124 | Ga0373927_0018326 | |||
| 1125 | Ga0373927_0036482 | |||
| 1126 | Ga0373927_0105884 | |||
| 1127 | Ga0373933_0006901 | |||
| 1128 | Ga0373947_0007200 | |||
| 1129 | Ga0373947_0007324 | |||
| 1130 | Ga0373947_0012405 | |||
| 1131 | Ga0373947_0069267 | |||
| 1132 | Ga0373947_0118761 | |||
| 1133 | Ga0373937_0027189 | |||
| 1134 | Ga0373937_0215379 | |||
| 1135 | Ga0373937_0377820 | |||
| 1136 | Ga0373925_0002553 | |||
| 1137 | Ga0373925_0044441 | |||
| 1138 | Ga0373925_0093474 | |||
| 1139 | Ga0395898_0287964 | |||
| 1140 | Ga0436365_0641618 | |||
| 1141 | Ga0436365_0919787 | |||
| 1142 | Ga0436363_0292837 | |||
| 1143 | Ga0436363_1472986 | |||
| 1144 | Ga0451797_1406699 | |||
| 1145 | Ga0451800_1037900 | |||
| 1146 | Ga0451807_1338646 | |||
| 1147 | Ga0451843_0944616 | |||
| 1148 | Ga0439446_0006873 | |||
| 1149 | Ga0466969_0075002 | |||
| 1150 | Ga0466970_0330990 | |||
| 1151 | Ga0466957_0074288 | |||
| 1152 | Ga0466967_0088384 | |||
| 1153 | Ga0495592_0001299 | |||
| 1154 | Ga0495603_0001707 | |||
| 1155 | Ga0495603_0019417 | |||
| 1156 | Ga0495603_0257106 | |||
| 1157 | Ga0495590_0075391 | |||
| 1158 | Ga0495591_066561 | |||
| 1159 | Ga0495629_0000606 | |||
| 1160 | Ga0495629_0005522 | |||
| 1161 | Ga0495641_0002686 | |||
| 1162 | Ga0495641_0010400 | |||
| 1163 | Ga0495651_0037223 | |||
| 1164 | Ga0495651_0058917 | |||
| 1165 | Ga0495650_0060382 | |||
| 1166 | Ga0495650_0116673 | |||
| 1167 | Ga0495580_0001307 | |||
| 1168 | Ga0495582_0001692 | |||
| 1169 | Ga0495582_0007172 | |||
| 1170 | Ga0495582_0016553 | |||
| 1171 | Ga0495582_0134775 | |||
| 1172 | Ga0495605_0071460 | |||
| 1173 | Ga0495639_0000136 | |||
| 1174 | Ga0495639_0057840 | |||
| 1175 | Ga0495662_0000392 | |||
| 1176 | Ga0495594_0000843 | |||
| 1177 | Ga0495594_0045176 | |||
| 1178 | Ga0495594_0112661 | |||
| 1179 | Ga0495606_0003785 | |||
| 1180 | Ga0495606_0221551 | |||
| 1181 | Ga0495608_0038614 | |||
| 1182 | Ga0495608_0396845 | |||
| 1183 | Ga0495618_0097869 | |||
| 1184 | Ga0495643_0072477 | |||
| 1185 | Ga0495644_0065738 | |||
| 1186 | Ga0495648_0002991 | |||
| 1187 | Ga0495648_0008609 | |||
| 1188 | Ga0495663_0073023 | |||
| 1189 | Ga0495666_0264652 | |||
| 1190 | Ga0495652_0026021 | |||
| 1191 | Ga0495665_0000026 | |||
| 1192 | Ga0495640_0012296 | |||
| 1193 | Ga0495587_0079142 | |||
| 1194 | Ga0495598_0009970 | |||
| 1195 | Ga0495598_0109106 | |||
| 1196 | Ga0495621_0052773 | |||
| 1197 | Ga0495645_0123626 | |||
| 1198 | Ga0495667_0099070 | |||
| 1199 | Ga0495667_0226820 | |||
| 1200 | Ga0495634_0000634 | |||
| 1201 | Ga0495634_0279655 | |||
| 1202 | Ga0495625_0107333 | |||
| 1203 | Ga0495635_0000827 | |||
| 1204 | Ga0495588_0010887 | |||
| 1205 | Ga0495657_0027053 | |||
| 1206 | Ga0495657_0239914 | |||
| 1207 | Ga0495646_0030827 | |||
| 1208 | Ga0495647_0001263 | |||
| 1209 | Ga0495647_0007767 | |||
| 1210 | Ga0495647_0197285 | |||
| 1211 | Ga0495658_0000278 | |||
| 1212 | Ga0495658_0002383 | |||
| 1213 | Ga0495658_0088242 | |||
| 1214 | Ga0495669_0007025 | |||
| 1215 | Ga0495613_0006647 | |||
| 1216 | Ga0495613_0020275 | |||
| 1217 | Ga0495624_0000201 | |||
| 1218 | Ga0495624_0041652 | |||
| 1219 | Ga0495624_0205691 | |||
| 1220 | Ga0495624_0336957 | |||
| 1221 | Ga0495589_0076065 | |||
| 1222 | Ga0495600_0010238 | |||
| 1223 | Ga0495581_0000828 | |||
| 1224 | Ga0495581_0051878 | |||
| 1225 | Ga0495581_0180056 | |||
| 1226 | Ga0495581_0327165 | |||
| 1227 | Ga0495636_0120917 | |||
| 1228 | Ga0495674_0023985 | |||
| 1229 | Ga0495672_0019491 | |||
| 1230 | Ga0495676_0082122 | |||
| 1231 | Ga0495676_0204964 | |||
| 1232 | Ga0495680_0005700 | |||
| 1233 | Ga0495680_0051958 | |||
| 1234 | Ga0495673_0025196 | |||
| 1235 | Ga0495684_0013981 | |||
| 1236 | Ga0495686_0135290 | |||
| 1237 | Ga0495593_0000282 | |||
| 1238 | Ga0495602_0022737 | |||
| 1239 | Ga0495602_0278366 | |||
| 1240 | Ga0495602_0441704 | |||
| 1241 | Ga0495614_0042323 | |||
| 1242 | Ga0495615_0027994 | |||
| 1243 | Ga0496100_0223771 | |||
| 1244 | Ga0496100_0390056 | |||
| 1245 | Ga0496101_0068749 | |||
| 1246 | Ga0496101_0372150 | |||
| 1247 | Ga0496101_0378472 | |||
| 1248 | Ga0496102_0054754 | |||
| 1249 | Ga0496102_0072210 | |||
| 1250 | Ga0496102_0407936 | |||
| 1251 | Ga0496102_0501114 | |||
| 1252 | Ga0496103_0089263 | |||
| 1253 | Ga0496104_0075695 | |||
| 1254 | Ga0496104_0113103 | |||
| 1255 | Ga0496104_0584086 | |||
| 1256 | Ga0496105_0178130 | |||
| 1257 | Ga0496105_0261442 | |||
| 1258 | Ga0496106_0002133 | |||
| 1259 | Ga0496106_0083214 | |||
| 1260 | Ga0496106_0380461 | |||
| 1261 | Ga0496106_0459947 | |||
| 1262 | Ga0496106_0496353 | |||
| 1263 | Ga0496107_0074689 | |||
| 1264 | Ga0496107_0188823 | |||
| 1265 | Ga0496108_0120609 | |||
| 1266 | Ga0496109_0023474 | |||
| 1267 | Ga0496109_0161425 | |||
| 1268 | Ga0496109_0294755 | |||
| 1269 | Ga0496109_0455839 | |||
| 1270 | Ga0496110_0092380 | |||
| 1271 | Ga0496110_0143055 | |||
| 1272 | Ga0496110_0192225 | |||
| 1273 | Ga0496111_0048441 | |||
| 1274 | Ga0496111_0092043 | |||
| 1275 | Ga0496111_0240601 | |||
| 1276 | Ga0496112_0000004 | |||
| 1277 | Ga0496112_0037597 | |||
| 1278 | Ga0496112_0091691 | |||
| 1279 | Ga0496112_0100520 | |||
| 1280 | Ga0496112_0158882 | |||
| 1281 | Ga0496112_0291987 | |||
| 1282 | Ga0496113_0149548 | |||
| 1283 | Ga0496114_0147432 | |||
| 1284 | Ga0496114_0344092 | |||
| 1285 | Ga0496115_0008261 | |||
| 1286 | Ga0496115_0017594 | |||
| 1287 | Ga0496115_0088001 | |||
| 1288 | Ga0496115_0098692 | |||
| 1289 | Ga0496115_0160119 | |||
| 1290 | Ga0496115_0435227 | |||
| 1291 | Ga0496117_0058895 | |||
| 1292 | Ga0496118_0011549 | |||
| 1293 | Ga0496118_0076136 | |||
| 1294 | Ga0496118_0225655 | |||
| 1295 | Ga0496119_0074699 | |||
| 1296 | Ga0496119_0209801 | |||
| 1297 | Ga0496121_0002279 | |||
| 1298 | Ga0496121_0002820 | |||
| 1299 | Ga0496121_0183234 | |||
| 1300 | Ga0496121_0219157 | |||
| 1301 | Ga0496124_0000722 | |||
| 1302 | Ga0496124_0108081 | |||
| 1303 | Ga0496124_0147632 | |||
| 1304 | Ga0496126_0006670 | |||
| 1305 | Ga0496126_0010727 | |||
| 1306 | Ga0496126_0067735 | |||
| 1307 | Ga0496126_0090027 | |||
| 1308 | Ga0496126_0375983 | |||
| 1309 | Ga0495678_133134 | |||
| 1310 | Ga0501033_0101675 | |||
| 1311 | Ga0501039_0364836 | |||
| 1312 | Ga0501041_0269914 | |||
| 1313 | Ga0501047_0281461 | |||
| 1314 | Ga0501047_0420728 | |||
| 1315 | Ga0501067_0000745 | |||
| 1316 | Ga0501067_0302874 | |||
| 1317 | Ga0501072_0341753 | |||
| 1318 | Ga0501073_0033428 | |||
| 1319 | Ga0501076_0351223 | |||
| 1320 | Ga0501077_0141945 | |||
| 1321 | Ga0501083_0044572 | |||
| 1322 | Ga0501083_0098316 | |||
| 1323 | Ga0501044_0164966 | |||
| 1324 | nmdc:mga03n38_1488_c1 | |||
| 1325 | nmdc:mga00v17_13507_c1 | |||
| 1326 | nmdc:mga00v17_146863_c1 | |||
| 1327 | nmdc:mga0yw44_11625_c1 | |||
| 1328 | nmdc:mga0yw44_14499_c1 | |||
| 1329 | nmdc:mga0yw44_4769_c2 | |||
| 1330 | nmdc:mga0yw44_91687_c1 | |||
| 1331 | nmdc:mga06z11_83400_c1 | |||
| 1332 | nmdc:mga06z11_89446_c1 | |||
| 1333 | nmdc:mga07m45_10308_c1 | |||
| 1334 | nmdc:mga07m45_13377_c1 | |||
| 1335 | nmdc:mga07m45_143549_c1 | |||
| 1336 | nmdc:mga05p37_354_c1 | |||
| 1337 | nmdc:mga05p37_4031_c1 | |||
| 1338 | nmdc:mga05p37_77938_c1 | |||
| 1339 | nmdc:mga09592_21598_c1 | |||
| 1340 | nmdc:mga09592_4746_c1 | |||
| 1341 | nmdc:mga0qj67_303385_c1 | |||
| 1342 | nmdc:mga0qj67_935_c1 | |||
| 1343 | nmdc:mga06r32_147_c1 | |||
| 1344 | nmdc:mga06r32_2724_c1 | |||
| 1345 | nmdc:mga08y16_142808_c1 | |||
| 1346 | nmdc:mga08y16_289_c1 | |||
| 1347 | nmdc:mga08y16_843_c1 | |||
| 1348 | nmdc:mga0n895_132405_c1 | |||
| 1349 | nmdc:mga0n895_246098_c1 | |||
| 1350 | nmdc:mga0n895_40050_c1 | |||
| 1351 | nmdc:mga0n895_545_c1 | |||
| 1352 | nmdc:mga0n895_58554_c1 | |||
| 1353 | nmdc:mga0rr50_1502_c1 | |||
| 1354 | nmdc:mga0rr50_71805_c1 | |||
| 1355 | nmdc:mga0rr50_8013_c1 | |||
| 1356 | nmdc:mga0a205_60_c1 | |||
| 1357 | nmdc:mga0sz30_217798_c1 | |||
| 1358 | Ga0495601_0019340 | |||
| 1359 | Ga0495601_0266609 | |||
| 1360 | Ga0495612_0029163 | |||
| 1361 | Ga0495595_0002637 | |||
| 1362 | Ga0495619_0000996 | |||
| 1363 | Ga0495619_0002254 | |||
| 1364 | Ga0500578_0218453 | |||
| 1365 | Ga0500644_0064795 | |||
| 1366 | Ga0500647_0030293 | |||
| 1367 | Ga0500641_0004635 | |||
| 1368 | Ga0500554_000594 | |||
| 1369 | Ga0500569_017447 | |||
| 1370 | Ga0500595_003152 | |||
| 1371 | Ga0500595_009148 | |||
| 1372 | Ga0500655_025636 | |||
| 1373 | Ga0500559_0089934 | |||
| 1374 | Ga0500568_0071220 | |||
| 1375 | Ga0500603_000431 | |||
| 1376 | Ga0500616_0000034 | |||
| 1377 | Ga0500616_0022170 | |||
| 1378 | Ga0500638_134553 | |||
| 1379 | Ga0500637_0005636 | |||
| 1380 | Ga0500645_055605 | |||
| 1381 | Ga0500596_010434 | |||
| 1382 | Ga0501084_0099517 | |||
| 1383 | Ga0501084_0156096 | |||
| 1384 | Ga0501082_0066954 | |||
| 1385 | 2509151459 | |||
| 1386 | 2513657031 | |||
| 1387 | 2513696747 | |||
| 1388 | 2513703410 | |||
| 1389 | 2513855472 | |||
| 1390 | 2513889987 | |||
| 1391 | 2513918771 | |||
| 1392 | 2517892020 | |||
| 1393 | 2524534095 | |||
| 1394 | 2671121942 | |||
| 1395 | 2723846585 | |||
| 1396 | 2728753039 | |||
| 1397 | 2793068905 | |||
| 1398 | 2793080591 | |||
| 1399 | 2874605624 | |||
| 1400 | 2876814666 | |||
| 1401 | 2879115913 | |||
| 1402 | 2885375970 | |||
| 1403 | 2889039366 | |||
| 1404 | 2903751021 | |||
| 1405 | 2904694924 | |||
| 1406 | 2904702119 | |||
| 1407 | 2906617148 | |||
| 1408 | 2906639208 | |||
| 1409 | 2906662408 | |||
| 1410 | 2908742296 | |||
| 1411 | 2908759936 | |||
| 1412 | 2922365786 | |||
| 1413 | 2922391344 | |||
| 1414 | 2922430697 | |||
| 1415 | 2935636398 | |||
| 1416 | 2941509892 | |||
| 1417 | 2941520864 | |||
| 1418 | 2941525291 | |||
| 1419 | 3005480600 | |||
| 1420 | 8006940171 | |||
| 1421 | 8006969710 | |||
| 1422 | 8006979952 | |||
| 1423 | 8006987847 | |||
| 1424 | 8007000835 | |||
| 1425 | 8019556149 | |||
| 1426 | 8019569158 | |||
| 1427 | 8056676968 | |||
| 1428 | 8056692201 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5a65-assembly2.cif.gz_B | crystal structure of mouse thiamine triphosphatase in complex with thiamine diphosphate, orthophosphate and magnesium ions. | 0.5813 | 140 | 199 |
| 4zdg-assembly1.cif.gz_B | structure of the adenovirus 14p1 knob domain | 0.4573 | 121 | 161 |
| 2bhz-assembly1.cif.gz_A | crystal structure of deinococcus radiodurans maltooligosyltrehalose trehalohydrolase in complex with maltose | 0.411 | 141 | 193 |
| 6ik4-assembly1.cif.gz_A | a novel m23 metalloprotease pseudoalterin from deep-sea | 0.4106 | 64 | 230 |
| 6ik4-assembly1.cif.gz_A | a novel m23 metalloprotease pseudoalterin from deep-sea | 0.3973 | 64 | 230 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WHQ5_55_228_2.70.70.10 | Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) | 0.9423 | 48 | 218 | 2.70.70.10 |
| af_P9WHQ5_55_228_2.70.70.10 | Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) | 0.9214 | 48 | 218 | 2.70.70.10 |
| af_Q58227_16_200_2.70.70.10 | Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) | 0.8869 | 48 | 218 | 2.70.70.10 |
| af_Q9UTB5_356_515_2.70.70.10 | Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) | 0.8247 | 97 | 215 | 2.70.70.10 |
| af_P0A8K1_63_285_2.70.70.10 | Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) | 0.8238 | 61 | 218 | 2.70.70.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-Q2NBU9-F1-model_v4 | Phosphatidylserine decarboxylase proenzyme (EC 4.1.1.65) [Cleaved into: Phosphatidylserine decarboxylase alpha chain; Phosphatidylserine decarboxylase beta chain] | 0.9446 | 12 | 221 |
GO:0004609
GO:0005886 GO:0006646 |
| AF-A0A848SXX3-F1-model_v4 | Phosphatidylserine decarboxylase proenzyme (EC 4.1.1.65) [Cleaved into: Phosphatidylserine decarboxylase alpha chain; Phosphatidylserine decarboxylase beta chain] | 0.9436 | 12 | 221 |
GO:0004609
GO:0005886 GO:0006646 |
| AF-A0A845S2C7-F1-model_v4 | Phosphatidylserine decarboxylase (EC 4.1.1.65) | 0.9423 | 42 | 220 |
GO:0004609
GO:0005886 GO:0008654 |
| AF-A0A662RX69-F1-model_v4 | Phosphatidylserine decarboxylase family protein | 0.9423 | 67 | 218 |
GO:0004609
GO:0005886 GO:0008654 |
| AF-S9TJ73-F1-model_v4 | Phosphatidylserine decarboxylase proenzyme (EC 4.1.1.65) [Cleaved into: Phosphatidylserine decarboxylase alpha chain; Phosphatidylserine decarboxylase beta chain] | 0.9419 | 14 | 224 |
GO:0004609
GO:0005886 GO:0006646 |