F476923

General Info

Members Datasets Scaffolds Average Seq Length
714 382 1428 168

Family's Representative Sequence

Representative Sequence 3300005364|Ga0070673_100869056|Ga0070673_1008690561
Length 192
Sequence VKETRQNTEQEPGSDAIRTDQAPTKWDWQSAAGAISRNNHRNVLAGAVAGLGGALAIGAMEWFSVAAHYPLAVIPFATSIVLVIGSPEAEPAQPRALIGGHVVSALVGLAVLKLAGPHAWAAAAAVGLSIRAMYITGTFHPPAGINPLLVVSGNLPWTFLFVPVLAGAVLLTAFALLWHRWVRRQPWPRRWI

Samples

Sample ID Description Type Environment
1 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
68 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
69 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
70 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
74 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
75 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
76 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
88 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
113 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
171 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
172 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
173 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
174 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
175 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
176 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
177 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
178 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
179 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
180 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
181 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
182 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
183 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
184 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
185 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
186 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
187 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
188 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
189 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
190 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
191 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
192 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
193 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
194 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
195 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
196 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
197 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
198 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
199 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
200 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
201 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
202 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
203 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
205 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
206 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
207 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
208 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
209 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
210 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
211 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
212 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
213 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
214 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
215 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
216 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
217 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
218 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
219 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
220 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
221 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
222 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
223 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
224 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
225 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
226 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
227 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
228 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
229 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
230 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
231 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
232 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
233 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
234 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
235 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
236 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
237 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
238 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
239 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
240 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
241 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
242 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
243 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
244 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
245 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
246 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
247 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
248 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
249 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
250 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
251 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
252 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
253 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
254 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
255 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
256 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
257 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
258 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
259 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
260 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
261 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
262 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
263 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
264 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
265 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
266 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
267 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
268 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
269 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
270 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
271 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
272 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
273 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
274 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
275 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
276 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
277 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
278 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
279 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
280 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
281 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
282 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
283 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
284 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
285 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
286 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
287 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
288 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
289 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
290 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
291 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
292 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
293 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
294 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
295 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
296 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
297 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
298 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
299 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
300 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
301 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
302 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
303 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
304 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
305 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
306 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
309 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
310 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
311 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
312 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
313 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
314 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
315 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
316 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
317 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
318 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
319 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
320 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
321 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
322 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
323 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
324 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
325 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
326 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
327 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
328 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
329 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
330 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
331 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
332 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
333 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
334 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
335 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
336 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
337 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
338 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
339 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
340 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
341 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
342 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
343 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
344 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
345 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
346 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
347 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
348 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
349 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
350 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
351 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
352 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
353 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
354 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
355 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
356 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
357 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
358 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
359 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
360 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
361 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
362 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
363 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
364 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
365 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
366 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
367 2791355199
368 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
369 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
370 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
371 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
372 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
373 2904699407
374 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
375 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
376 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
377 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
378 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
379 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
380 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
381 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
382 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.75
Metatranscriptomes 0
Isolates 2.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.73
Nodule 1.82
Rhizoplane 6.72
Rhizosphere 69.75
Stem 0
Stem Tuber 0
Unclassified 1.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070673_100869056 3300005364 Bacteria 835
2 rootL2_10169653 3300003322 Bacteria 2875
3 rootL2_10247261 3300003322 Bacteria 1073
4 rootH1_10024351 3300003323 Bacteria 1073
5 rootH1_10137788 3300003323 Bacteria 3716
6 rootH1_10234860 3300003323 Bacteria 1121
7 JGI25404J52841_10024733 3300003659 Bacteria 1293
8 Ga0070658_10273432 3300005327 Bacteria 1437
9 Ga0070676_10067353 3300005328 Bacteria 2141
10 Ga0070683_100044662 3300005329 Bacteria 4087
11 Ga0070690_100220506 3300005330 Bacteria 1329
12 Ga0070670_100155387 3300005331 Bacteria 1981
13 Ga0068869_100051221 3300005334 Bacteria 2995
14 Ga0070666_10174508 3300005335 Bacteria 1506
15 Ga0070682_100059573 3300005337 Bacteria 2412
16 Ga0068868_100051213 3300005338 Bacteria 3246
17 Ga0068868_100219823 3300005338 Bacteria 1590
18 Ga0068868_100474742 3300005338 Bacteria 1091
19 Ga0070660_100855672 3300005339 Unclassified 766
20 Ga0070689_100159774 3300005340 Bacteria 1821
21 Ga0070691_10380656 3300005341 Bacteria 791
22 Ga0070668_100045521 3300005347 Bacteria 3366
23 Ga0070668_100048096 3300005347 Bacteria 3280
24 Ga0070668_100255265 3300005347 Bacteria 1456
25 Ga0070668_100729914 3300005347 Bacteria 875
26 Ga0070669_100257342 3300005353 Bacteria 1392
27 Ga0070669_100860864 3300005353 Bacteria 773
28 Ga0070675_100396475 3300005354 Bacteria 1231
29 Ga0070671_100037230 3300005355 Bacteria 4034
30 Ga0070671_100186694 3300005355 Bacteria 1756
31 Ga0070674_100681816 3300005356 Bacteria 877
32 Ga0070673_100959497 3300005364 Bacteria 795
33 Ga0070688_100195063 3300005365 Bacteria 1413
34 Ga0070659_100082725 3300005366 Bacteria 2565
35 Ga0070659_100170991 3300005366 Bacteria 1780
36 Ga0070659_100575187 3300005366 Bacteria 966
37 Ga0070667_100158507 3300005367 Bacteria 1992
38 Ga0070667_100273700 3300005367 Bacteria 1514
39 Ga0070709_10310099 3300005434 Bacteria 1155
40 Ga0070713_100002238 3300005436 Bacteria 12551
41 Ga0070713_100438222 3300005436 Bacteria 1225
42 Ga0070713_100510601 3300005436 Bacteria 1135
43 Ga0070710_10003163 3300005437 Bacteria 7808
44 Ga0070711_100024492 3300005439 Bacteria 3936
45 Ga0070711_100271834 3300005439 Bacteria 1337
46 Ga0070700_100351080 3300005441 Bacteria 1093
47 Ga0070700_100388786 3300005441 Bacteria 1045
48 Ga0070700_100916473 3300005441 Bacteria 715
49 Ga0070694_100284957 3300005444 Bacteria 1261
50 Ga0070708_100977893 3300005445 Bacteria 794
51 Ga0070663_100018219 3300005455 Bacteria 4598
52 Ga0070663_100033631 3300005455 Bacteria 3543
53 Ga0070663_100044026 3300005455 Bacteria 3144
54 Ga0070678_100038487 3300005456 Bacteria 3368
55 Ga0070678_100120269 3300005456 Bacteria 2070
56 Ga0070678_100160736 3300005456 Bacteria 1820
57 Ga0070678_100235760 3300005456 Bacteria 1527
58 Ga0070662_100514100 3300005457 Bacteria 1000
59 Ga0070662_101019848 3300005457 Bacteria 709
60 Ga0070681_10024819 3300005458 Bacteria 6030
61 Ga0068867_100191695 3300005459 Bacteria 1631
62 Ga0068867_100403946 3300005459 Bacteria 1153
63 Ga0070685_10301459 3300005466 Bacteria 1080
64 Ga0070685_10348994 3300005466 Bacteria 1011
65 Ga0070698_100109916 3300005471 Bacteria 2723
66 Ga0070679_100048564 3300005530 Bacteria 4227
67 Ga0070684_100219871 3300005535 Bacteria 1733
68 Ga0070697_100082648 3300005536 Bacteria 2648
69 Ga0068853_100103208 3300005539 Bacteria 2524
70 Ga0068853_100213211 3300005539 Bacteria 1761
71 Ga0068853_100260382 3300005539 Bacteria 1594
72 Ga0068853_100384687 3300005539 Bacteria 1311
73 Ga0070686_100800939 3300005544 Unclassified 759
74 Ga0070695_100133633 3300005545 Bacteria 1712
75 Ga0070696_100246371 3300005546 Bacteria 1350
76 Ga0070665_100063875 3300005548 Bacteria 3691
77 Ga0070665_100070022 3300005548 Bacteria 3514
78 Ga0070665_100077263 3300005548 Bacteria 3336
79 Ga0070665_100112548 3300005548 Bacteria 2724
80 Ga0070665_100163965 3300005548 Bacteria 2225
81 Ga0070665_100535965 3300005548 Bacteria 1182
82 Ga0070665_101216990 3300005548 Bacteria 764
83 Ga0068855_100022792 3300005563 Bacteria 7503
84 Ga0068855_100063925 3300005563 Bacteria 4293
85 Ga0070664_100111703 3300005564 Bacteria 2386
86 Ga0068857_100016281 3300005577 Bacteria 6514
87 Ga0068857_100019333 3300005577 Bacteria 5980
88 Ga0068857_100445022 3300005577 Bacteria 1211
89 Ga0068857_100528285 3300005577 Bacteria 1109
90 Ga0068854_100118837 3300005578 Bacteria 2003
91 Ga0068854_100480520 3300005578 Bacteria 1043
92 Ga0068856_100106558 3300005614 Bacteria 2798
93 Ga0068856_100145725 3300005614 Bacteria 2376
94 Ga0070702_100484753 3300005615 Bacteria 904
95 Ga0070702_100537933 3300005615 Unclassified 865
96 Ga0068852_100023684 3300005616 Bacteria 4947
97 Ga0068852_101479362 3300005616 Bacteria 701
98 Ga0068859_100159082 3300005617 Bacteria 2337
99 Ga0068864_100041936 3300005618 Bacteria 3915
100 Ga0068864_100113126 3300005618 Bacteria 2420
101 Ga0068866_10019402 3300005718 Bacteria 3094
102 Ga0068866_10593537 3300005718 Bacteria 747
103 Ga0068861_100017063 3300005719 Bacteria 5149
104 Ga0068861_100283941 3300005719 Bacteria 1426
105 Ga0068861_100324197 3300005719 Bacteria 1342
106 Ga0068861_100373477 3300005719 Bacteria 1257
107 Ga0068851_10041683 3300005834 Bacteria 2309
108 Ga0068851_10444372 3300005834 Bacteria 770
109 Ga0068863_100160980 3300005841 Bacteria 2150
110 Ga0068863_100304171 3300005841 Bacteria 1547
111 Ga0068860_100086217 3300005843 Bacteria 2988
112 Ga0068860_100119377 3300005843 Bacteria 2524
113 Ga0068862_100019033 3300005844 Bacteria 5726
114 Ga0068862_100056794 3300005844 Bacteria 3354
115 Ga0068862_100120465 3300005844 Bacteria 2312
116 Ga0068862_100163321 3300005844 Bacteria 1989
117 Ga0068862_100312573 3300005844 Bacteria 1448
118 Ga0068862_100375531 3300005844 Bacteria 1325
119 Ga0081455_10013068 3300005937 Bacteria 8229
120 Ga0081455_10051521 3300005937 Bacteria 3531
121 Ga0081455_10134789 3300005937 Bacteria 1926
122 Ga0081540_1000495 3300005983 Bacteria 38740
123 Ga0081540_1014887 3300005983 Bacteria 4949
124 Ga0081540_1016491 3300005983 Bacteria 4619
125 Ga0081540_1024584 3300005983 Bacteria 3493
126 Ga0081540_1030349 3300005983 Bacteria 2995
127 Ga0081540_1092725 3300005983 Bacteria 1325
128 Ga0081539_10001606 3300005985 Bacteria 37203
129 Ga0081539_10029737 3300005985 Bacteria 3406
130 Ga0081539_10064543 3300005985 Bacteria 1992
131 Ga0070717_10005166 3300006028 Bacteria 9518
132 Ga0075365_10034540 3300006038 Bacteria 3265
133 Ga0075365_10036336 3300006038 Bacteria 3191
134 Ga0075365_10317871 3300006038 Bacteria 1096
135 Ga0075368_10076454 3300006042 Bacteria 1359
136 Ga0075363_100000071 3300006048 Bacteria 21039
137 Ga0075363_100044065 3300006048 Bacteria 2362
138 Ga0075363_100080805 3300006048 Bacteria 1778
139 Ga0075363_100100998 3300006048 Bacteria 1596
140 Ga0075363_100226515 3300006048 Bacteria 1072
141 Ga0075364_10051559 3300006051 Bacteria 2688
142 Ga0075364_10326783 3300006051 Bacteria 1044
143 Ga0070715_10008503 3300006163 Bacteria 3580
144 Ga0070716_100001652 3300006173 Bacteria 10064
145 Ga0070716_100045008 3300006173 Bacteria 2475
146 Ga0070716_100792877 3300006173 Bacteria 733
147 Ga0070712_100003639 3300006175 Bacteria 9506
148 Ga0070712_100045347 3300006175 Bacteria 3035
149 Ga0070712_100322223 3300006175 Bacteria 1257
150 Ga0075362_10349762 3300006177 Bacteria 739
151 Ga0075367_10013236 3300006178 Bacteria 4429
152 Ga0075367_10234773 3300006178 Bacteria 1148
153 Ga0075367_10331413 3300006178 Bacteria 960
154 Ga0075369_10060933 3300006186 Bacteria 1647
155 Ga0075369_10155283 3300006186 Bacteria 1047
156 Ga0075366_10022174 3300006195 Bacteria 3693
157 Ga0075366_10108220 3300006195 Bacteria 1671
158 Ga0097621_100066614 3300006237 Bacteria 2966
159 Ga0075370_10012923 3300006353 Bacteria 4425
160 Ga0075370_10014414 3300006353 Bacteria 4216
161 Ga0075370_10137764 3300006353 Bacteria 1426
162 Ga0075370_10451528 3300006353 Bacteria 773
163 Ga0068871_100240583 3300006358 Bacteria 1573
164 Ga0075428_100048197 3300006844 Bacteria 4677
165 Ga0075431_100274108 3300006847 Bacteria 1709
166 Ga0075433_10949189 3300006852 Bacteria 750
167 Ga0075434_100087728 3300006871 Bacteria 3112
168 Ga0075429_100807155 3300006880 Bacteria 822
169 Ga0068865_100031110 3300006881 Bacteria 3556
170 Ga0068865_100075496 3300006881 Bacteria 2404
171 Ga0097620_100159083 3300006931 Bacteria 2337
172 Ga0099794_10049308 3300007265 Bacteria 2023
173 Ga0105250_10032716 3300009092 Bacteria 2088
174 Ga0105240_10030470 3300009093 Bacteria 7012
175 Ga0105240_10946820 3300009093 Bacteria 924
176 Ga0111539_10201448 3300009094 Bacteria 2321
177 Ga0105245_10007804 3300009098 Bacteria 9374
178 Ga0105245_10048656 3300009098 Bacteria 3793
179 Ga0105245_11177353 3300009098 Unclassified 814
180 Ga0105243_10253527 3300009148 Bacteria 1572
181 Ga0105243_10284921 3300009148 Bacteria 1490
182 Ga0105243_10699405 3300009148 Bacteria 988
183 Ga0105243_11139139 3300009148 Bacteria 790
184 Ga0105243_11139140 3300009148 Bacteria 790
185 Ga0105241_10287294 3300009174 Bacteria 1407
186 Ga0105241_10682836 3300009174 Bacteria 936
187 Ga0105242_10055909 3300009176 Bacteria 3229
188 Ga0105242_10721592 3300009176 Bacteria 978
189 Ga0105248_10408645 3300009177 Bacteria 1528
190 Ga0105248_11236394 3300009177 Bacteria 845
191 Ga0105237_10605170 3300009545 Bacteria 1103
192 Ga0105237_10931192 3300009545 Bacteria 876
193 Ga0105238_10027208 3300009551 Bacteria 5827
194 Ga0105238_10416596 3300009551 Bacteria 1337
195 Ga0105238_10444414 3300009551 Bacteria 1293
196 Ga0105238_11129631 3300009551 Bacteria 807
197 Ga0105249_10083221 3300009553 Bacteria 2978
198 Ga0105249_11430030 3300009553 Bacteria 763
199 Ga0105249_11903991 3300009553 Bacteria 667
200 Ga0105239_10036841 3300010375 Bacteria 5366
201 Ga0105239_10142886 3300010375 Bacteria 2668
202 Ga0105239_10173773 3300010375 Bacteria 2409
203 Ga0105239_10201869 3300010375 Bacteria 2228
204 Ga0105239_10393033 3300010375 Bacteria 1569
205 Ga0105239_10774959 3300010375 Bacteria 1098
206 Ga0105239_10797696 3300010375 Bacteria 1082
207 Ga0105246_10017872 3300011119 Bacteria 4511
208 Ga0105246_10212801 3300011119 Bacteria 1510
209 Ga0105246_10223706 3300011119 Bacteria 1477
210 Ga0105246_10238298 3300011119 Bacteria 1437
211 Ga0105246_10314401 3300011119 Bacteria 1270
212 Ga0157370_10025304 3300013104 Bacteria 5875
213 Ga0157374_10030992 3300013296 Bacteria 4856
214 Ga0157374_10047009 3300013296 Bacteria 3999
215 Ga0157378_10057691 3300013297 Bacteria 3461
216 Ga0157378_10109748 3300013297 Bacteria 2527
217 Ga0157378_10144683 3300013297 Bacteria 2210
218 Ga0157378_10183545 3300013297 Bacteria 1969
219 Ga0157378_10349071 3300013297 Unclassified 1445
220 Ga0163162_10053887 3300013306 Bacteria 4043
221 Ga0163162_10156892 3300013306 Bacteria 2396
222 Ga0163162_10238324 3300013306 Bacteria 1950
223 Ga0163162_10656208 3300013306 Bacteria 1173
224 Ga0163162_11783010 3300013306 Bacteria 703
225 Ga0157375_10013434 3300013308 Bacteria 7286
226 Ga0157375_10414038 3300013308 Bacteria 1514
227 Ga0157375_10773822 3300013308 Bacteria 1110
228 Ga0163163_10014617 3300014325 Bacteria 7221
229 Ga0163163_10029109 3300014325 Bacteria 5311
230 Ga0163163_10124624 3300014325 Bacteria 2613
231 Ga0163163_10270233 3300014325 Bacteria 1751
232 Ga0163163_10429119 3300014325 Bacteria 1381
233 Ga0163163_10702773 3300014325 Bacteria 1075
234 Ga0157380_10108238 3300014326 Bacteria 2330
235 Ga0157380_10972660 3300014326 Bacteria 880
236 Ga0157380_11470893 3300014326 Bacteria 734
237 Ga0182008_10113442 3300014497 Bacteria 1343
238 Ga0157379_10086927 3300014968 Bacteria 2803
239 Ga0157379_10191488 3300014968 Bacteria 1848
240 Ga0157376_10011422 3300014969 Bacteria 6546
241 Ga0157376_10141085 3300014969 Bacteria 2162
242 Ga0163161_10371523 3300017792 Bacteria 1141
243 Ga0163161_11607561 3300017792 Bacteria 573
244 Ga0209758_1006031 3300025297 Bacteria 8943
245 Ga0207697_10241506 3300025315 Bacteria 798
246 Ga0207692_10006099 3300025898 Bacteria 4877
247 Ga0207692_10007264 3300025898 Bacteria 4531
248 Ga0207692_10043717 3300025898 Bacteria 2231
249 Ga0207642_10011227 3300025899 Bacteria 3187
250 Ga0207710_10034230 3300025900 Bacteria 2231
251 Ga0207688_10064045 3300025901 Bacteria 2074
252 Ga0207688_10137375 3300025901 Bacteria 1436
253 Ga0207688_10423269 3300025901 Bacteria 828
254 Ga0207680_10656895 3300025903 Bacteria 751
255 Ga0207699_10022026 3300025906 Bacteria 3446
256 Ga0207645_10036141 3300025907 Bacteria 3172
257 Ga0207654_10036432 3300025911 Bacteria 2748
258 Ga0207654_10596064 3300025911 Bacteria 788
259 Ga0207693_10001910 3300025915 Bacteria 18229
260 Ga0207693_10002004 3300025915 Bacteria 17879
261 Ga0207663_10000684 3300025916 Bacteria 15034
262 Ga0207663_10023567 3300025916 Bacteria 3534
263 Ga0207663_10035505 3300025916 Bacteria 2991
264 Ga0207660_10051318 3300025917 Bacteria 2932
265 Ga0207660_10650447 3300025917 Bacteria 859
266 Ga0207657_10304172 3300025919 Bacteria 1263
267 Ga0207649_10122292 3300025920 Bacteria 1756
268 Ga0207681_10217806 3300025923 Bacteria 1475
269 Ga0207681_11163703 3300025923 Bacteria 648
270 Ga0207694_10065957 3300025924 Bacteria 2823
271 Ga0207694_10366339 3300025924 Bacteria 1195
272 Ga0207650_10341665 3300025925 Bacteria 1229
273 Ga0207659_10136238 3300025926 Bacteria 1901
274 Ga0207659_10838188 3300025926 Bacteria 790
275 Ga0207659_10971047 3300025926 Bacteria 731
276 Ga0207687_10032719 3300025927 Bacteria 3523
277 Ga0207687_10064239 3300025927 Bacteria 2602
278 Ga0207687_10930150 3300025927 Unclassified 744
279 Ga0207700_10085476 3300025928 Bacteria 2476
280 Ga0207700_11132018 3300025928 Bacteria 699
281 Ga0207664_10026333 3300025929 Bacteria 4395
282 Ga0207664_10031827 3300025929 Bacteria 4039
283 Ga0207644_10037782 3300025931 Bacteria 3399
284 Ga0207690_10303409 3300025932 Bacteria 1250
285 Ga0207690_10450529 3300025932 Bacteria 1034
286 Ga0207706_10087835 3300025933 Bacteria 2734
287 Ga0207706_10089346 3300025933 Bacteria 2709
288 Ga0207706_10142738 3300025933 Bacteria 2106
289 Ga0207706_10378725 3300025933 Bacteria 1228
290 Ga0207706_10857059 3300025933 Bacteria 769
291 Ga0207686_10024770 3300025934 Bacteria 3482
292 Ga0207709_10120822 3300025935 Bacteria 1768
293 Ga0207709_10679973 3300025935 Bacteria 822
294 Ga0207670_10271834 3300025936 Bacteria 1317
295 Ga0207669_10002487 3300025937 Bacteria 7864
296 Ga0207704_10060242 3300025938 Bacteria 2348
297 Ga0207665_10001660 3300025939 Bacteria 14973
298 Ga0207691_10022654 3300025940 Bacteria 5924
299 Ga0207691_10206345 3300025940 Bacteria 1709
300 Ga0207711_10044096 3300025941 Bacteria 3806
301 Ga0207711_10646054 3300025941 Bacteria 987
302 Ga0207689_10032905 3300025942 Bacteria 4310
303 Ga0207689_10040884 3300025942 Bacteria 3836
304 Ga0207689_10100589 3300025942 Bacteria 2375
305 Ga0207689_10255933 3300025942 Bacteria 1448
306 Ga0207661_10012159 3300025944 Bacteria 6250
307 Ga0207679_10733042 3300025945 Bacteria 898
308 Ga0207667_10196652 3300025949 Bacteria 2068
309 Ga0207667_10363309 3300025949 Bacteria 1476
310 Ga0207667_10753240 3300025949 Bacteria 973
311 Ga0207651_10247987 3300025960 Bacteria 1455
312 Ga0207712_10179683 3300025961 Bacteria 1661
313 Ga0207712_10916085 3300025961 Bacteria 775
314 Ga0207668_10010368 3300025972 Bacteria 5629
315 Ga0207668_10056713 3300025972 Bacteria 2729
316 Ga0207668_10087611 3300025972 Bacteria 2277
317 Ga0207668_10127725 3300025972 Bacteria 1936
318 Ga0207668_11132690 3300025972 Bacteria 702
319 Ga0207640_10114150 3300025981 Bacteria 1921
320 Ga0207658_10026675 3300025986 Bacteria 4052
321 Ga0207677_10037258 3300026023 Bacteria 3177
322 Ga0207677_10102628 3300026023 Bacteria 2109
323 Ga0207677_11619890 3300026023 Bacteria 599
324 Ga0207703_10050047 3300026035 Bacteria 3380
325 Ga0207703_10889003 3300026035 Bacteria 853
326 Ga0207639_10386275 3300026041 Bacteria 1258
327 Ga0207639_10661913 3300026041 Bacteria 967
328 Ga0207639_11236055 3300026041 Bacteria 701
329 Ga0207678_10010737 3300026067 Bacteria 8046
330 Ga0207678_10064793 3300026067 Bacteria 3140
331 Ga0207678_10095053 3300026067 Bacteria 2547
332 Ga0207708_10425087 3300026075 Bacteria 1102
333 Ga0207708_11424582 3300026075 Bacteria 608
334 Ga0207702_10357932 3300026078 Bacteria 1398
335 Ga0207702_10536179 3300026078 Bacteria 1144
336 Ga0207641_10052747 3300026088 Bacteria 3445
337 Ga0207641_11259748 3300026088 Bacteria 740
338 Ga0207648_10085079 3300026089 Bacteria 2759
339 Ga0207648_10438888 3300026089 Bacteria 1187
340 Ga0207676_10145295 3300026095 Bacteria 2036
341 Ga0207676_10933209 3300026095 Bacteria 853
342 Ga0207674_10026847 3300026116 Bacteria 6107
343 Ga0207674_10037938 3300026116 Bacteria 5005
344 Ga0207674_10366696 3300026116 Bacteria 1392
345 Ga0207675_100028553 3300026118 Bacteria 5195
346 Ga0207675_100254849 3300026118 Bacteria 1699
347 Ga0207675_100526959 3300026118 Bacteria 1178
348 Ga0207683_10021448 3300026121 Bacteria 5530
349 Ga0207683_10111555 3300026121 Bacteria 2449
350 Ga0207683_10212078 3300026121 Bacteria 1763
351 Ga0207683_10438006 3300026121 Bacteria 1205
352 Ga0207698_10854144 3300026142 Bacteria 915
353 Ga0268266_10002572 3300028379 Bacteria 19242
354 Ga0268266_10049186 3300028379 Bacteria 3614
355 Ga0268266_10050536 3300028379 Bacteria 3567
356 Ga0268266_10116954 3300028379 Bacteria 2369
357 Ga0268266_10189285 3300028379 Bacteria 1878
358 Ga0268266_10418526 3300028379 Bacteria 1269
359 Ga0268266_10742554 3300028379 Bacteria 947
360 Ga0268266_10747311 3300028379 Bacteria 944
361 Ga0268265_10055370 3300028380 Bacteria 3013
362 Ga0268265_10065320 3300028380 Bacteria 2807
363 Ga0268265_10069125 3300028380 Bacteria 2741
364 Ga0268265_10090392 3300028380 Bacteria 2445
365 Ga0268265_10148318 3300028380 Bacteria 1974
366 Ga0268265_10846802 3300028380 Bacteria 894
367 Ga0268264_10726808 3300028381 Bacteria 988
368 Ga0268264_10808712 3300028381 Bacteria 937
369 Ga0307517_10000542 3300028786 Bacteria 64617
370 Ga0307515_10303026 3300028794 Bacteria 1281
371 Ga0265338_10954900 3300028800 Unclassified 582
372 Ga0307511_10091936 3300030521 Bacteria 2050
373 Ga0265339_10016806 3300031249 Bacteria 4351
374 Ga0265339_10200379 3300031249 Unclassified 985
375 Ga0265331_10129160 3300031250 Bacteria 1154
376 Ga0307513_10552134 3300031456 Bacteria 864
377 Ga0307513_10558486 3300031456 Bacteria 857
378 Ga0307509_10084556 3300031507 Bacteria 3268
379 Ga0307509_10098855 3300031507 Bacteria 2961
380 Ga0307509_10219975 3300031507 Bacteria 1713
381 Ga0307408_100360902 3300031548 Bacteria 1236
382 Ga0265313_10024433 3300031595 Bacteria 3228
383 Ga0307508_10035979 3300031616 Bacteria 4459
384 Ga0307508_10209861 3300031616 Bacteria 1548
385 Ga0265314_10129189 3300031711 Bacteria 1579
386 Ga0265342_10440370 3300031712 Bacteria 670
387 Ga0307516_10025218 3300031730 Bacteria 6056
388 Ga0307516_10033586 3300031730 Bacteria 5163
389 Ga0307516_10049862 3300031730 Bacteria 4110
390 Ga0307516_10090414 3300031730 Bacteria 2890
391 Ga0307516_10425825 3300031730 Bacteria 985
392 Ga0307405_10266328 3300031731 Bacteria 1283
393 Ga0307405_11191183 3300031731 Bacteria 658
394 Ga0307413_11019934 3300031824 Bacteria 710
395 Ga0307406_10069814 3300031901 Bacteria 2298
396 Ga0307412_10420335 3300031911 Bacteria 1093
397 Ga0307412_10666529 3300031911 Bacteria 889
398 Ga0307416_100349843 3300032002 Bacteria 1495
399 Ga0307416_101095192 3300032002 Bacteria 901
400 Ga0307414_10062573 3300032004 Bacteria 2642
401 Ga0307411_10507948 3300032005 Bacteria 1020
402 Ga0307415_100059490 3300032126 Bacteria 2635
403 Ga0307415_100365330 3300032126 Bacteria 1220
404 Ga0307507_10022265 3300033179 Bacteria 7011
405 Ga0307510_10008250 3300033180 Bacteria 12411
406 Ga0307510_10039796 3300033180 Bacteria 5172
407 Ga0307510_10060364 3300033180 Bacteria 3903
408 Ga0373923_0009987 3300035111 Bacteria 3439
409 Ga0373936_0244481 3300035113 Bacteria 800
410 Ga0373954_0038537 3300035118 Bacteria 2223
411 Ga0373956_0011156 3300035119 Bacteria 3700
412 Ga0373924_0039209 3300035410 Bacteria 1935
413 Ga0373935_0143536 3300035692 Bacteria 1614
414 Ga0373935_0957601 3300035692 Bacteria 635
415 Ga0373927_0012327 3300035695 Bacteria 5689
416 Ga0373927_0030944 3300035695 Bacteria 3491
417 Ga0373933_0000063 3300035724 Bacteria 64367
418 Ga0373933_0189498 3300035724 Bacteria 1313
419 Ga0373947_0154582 3300035725 Bacteria 1480
420 Ga0373937_0028713 3300036401 Bacteria 5035
421 Ga0373925_0132700 3300037068 Bacteria 1943
422 Ga0395898_0081536 3300037466 Bacteria 3119
423 Ga0395905_0379974 3300037471 Bacteria 1306
424 Ga0395905_0660937 3300037471 Bacteria 947
425 Ga0439465_0040772 3300041413 Bacteria 1501
426 Ga0451791_0367300 3300041451 Bacteria 813
427 Ga0451807_0158606 3300041486 Bacteria 1560
428 Ga0451849_1471128 3300041505 Bacteria 678
429 Ga0451853_0386236 3300041512 Bacteria 774
430 Ga0451853_3441740 3300041512 Bacteria 1248
431 Ga0451853_3669807 3300041512 Bacteria 595
432 Ga0439431_0106470 3300041997 Bacteria 774
433 Ga0466963_0081940 3300044694 Bacteria 2186
434 Ga0466967_0051236 3300045976 Bacteria 3617
435 Ga0495617_011407 3300046452 Bacteria 3031
436 Ga0495592_0014335 3300046454 Bacteria 6019
437 Ga0495603_0012869 3300046455 Bacteria 5059
438 Ga0495603_0069273 3300046455 Bacteria 2075
439 Ga0495629_0002515 3300046459 Bacteria 14070
440 Ga0495629_0061664 3300046459 Bacteria 2621
441 Ga0495629_0145273 3300046459 Bacteria 1650
442 Ga0495638_0104983 3300046460 Bacteria 1684
443 Ga0495638_0322458 3300046460 Bacteria 825
444 Ga0495641_0033174 3300046461 Bacteria 2453
445 Ga0495651_0004462 3300046462 Bacteria 10717
446 Ga0495651_0081967 3300046462 Bacteria 2434
447 Ga0495653_0003036 3300046463 Bacteria 13460
448 Ga0495582_0108066 3300046473 Bacteria 1562
449 Ga0495605_0038482 3300046474 Bacteria 2399
450 Ga0495639_0009803 3300046475 Bacteria 4112
451 Ga0495639_0045469 3300046475 Bacteria 1986
452 Ga0495585_0072551 3300046492 Bacteria 1875
453 Ga0495594_0065639 3300046499 Bacteria 2013
454 Ga0495594_0392528 3300046499 Bacteria 790
455 Ga0495594_0439242 3300046499 Bacteria 742
456 Ga0495596_0025730 3300046500 Bacteria 2377
457 Ga0495583_0047643 3300046506 Bacteria 1970
458 Ga0495608_0160742 3300046511 Bacteria 1428
459 Ga0495616_0054129 3300046513 Bacteria 1991
460 Ga0495620_0047817 3300046515 Bacteria 1839
461 Ga0495628_0027640 3300046516 Bacteria 4613
462 Ga0495631_0141293 3300046518 Bacteria 1034
463 Ga0495632_0209977 3300046519 Bacteria 883
464 Ga0495632_0269388 3300046519 Bacteria 760
465 Ga0495644_0020334 3300046523 Bacteria 2534
466 Ga0495644_0021643 3300046523 Bacteria 2452
467 Ga0495644_0170333 3300046523 Bacteria 836
468 Ga0495648_0039107 3300046524 Bacteria 3023
469 Ga0495648_0259950 3300046524 Bacteria 833
470 Ga0495642_0195995 3300046528 Bacteria 880
471 Ga0495652_0197282 3300046529 Bacteria 1531
472 Ga0495654_0026992 3300046530 Bacteria 2947
473 Ga0495640_0047969 3300046533 Bacteria 2954
474 Ga0495640_0778979 3300046533 Bacteria 571
475 Ga0495587_0032213 3300046536 Bacteria 3169
476 Ga0495598_0416198 3300046537 Bacteria 527
477 Ga0495621_0070993 3300046539 Bacteria 1283
478 Ga0495597_0164644 3300046542 Bacteria 903
479 Ga0495645_0106144 3300046543 Bacteria 1992
480 Ga0495622_0019739 3300046557 Bacteria 3138
481 Ga0495633_0132334 3300046558 Bacteria 1154
482 Ga0495667_0062749 3300046559 Bacteria 2434
483 Ga0495656_0055732 3300046615 Bacteria 1706
484 Ga0495656_0059855 3300046615 Bacteria 1658
485 Ga0495656_0140602 3300046615 Bacteria 1157
486 Ga0495668_0076572 3300046616 Bacteria 1836
487 Ga0495625_0186313 3300046660 Bacteria 1377
488 Ga0495635_0004510 3300046663 Bacteria 9646
489 Ga0495588_0014838 3300046674 Bacteria 3738
490 Ga0495657_0069495 3300046675 Bacteria 2304
491 Ga0495657_0082207 3300046675 Bacteria 2082
492 Ga0495599_0011097 3300046678 Bacteria 5528
493 Ga0495623_0022627 3300046679 Bacteria 4057
494 Ga0495623_0069398 3300046679 Bacteria 2197
495 Ga0495646_0035804 3300046680 Bacteria 3077
496 Ga0495647_0102996 3300046681 Bacteria 1184
497 Ga0495658_0915135 3300046683 Bacteria 561
498 Ga0495669_0003294 3300046684 Bacteria 6651
499 Ga0495669_0020244 3300046684 Bacteria 2877
500 Ga0495669_0142534 3300046684 Bacteria 1132
501 Ga0495613_0085664 3300046689 Bacteria 2286
502 Ga0495613_0103513 3300046689 Bacteria 2055
503 Ga0495671_0197308 3300046692 Bacteria 976
504 Ga0495649_0156355 3300046694 Bacteria 1196
505 Ga0495589_0145032 3300046794 Bacteria 1135
506 Ga0495600_0031228 3300046809 Bacteria 3450
507 Ga0495600_0074366 3300046809 Bacteria 2218
508 Ga0495581_0103002 3300047315 Bacteria 1658
509 Ga0495581_0276903 3300047315 Bacteria 981
510 Ga0495604_0023084 3300047317 Bacteria 4964
511 Ga0495604_0040796 3300047317 Bacteria 3642
512 Ga0495674_0295732 3300047319 Bacteria 1323
513 Ga0495674_0344918 3300047319 Bacteria 1210
514 Ga0495674_0377356 3300047319 Bacteria 1148
515 Ga0495674_0466578 3300047319 Bacteria 1013
516 Ga0495672_0008799 3300047320 Bacteria 7394
517 Ga0495672_0122873 3300047320 Bacteria 1377
518 Ga0495672_0271491 3300047320 Bacteria 814
519 Ga0495676_0679538 3300047321 Bacteria 667
520 Ga0495680_0012935 3300047322 Bacteria 7311
521 Ga0495675_0024272 3300047444 Bacteria 3865
522 Ga0495679_035686 3300047446 Bacteria 1574
523 Ga0495673_0046821 3300047469 Bacteria 1914
524 Ga0495684_0050155 3300047471 Bacteria 3187
525 Ga0495686_0084457 3300047472 Bacteria 1935
526 Ga0495686_0152027 3300047472 Bacteria 1358
527 Ga0495686_0292845 3300047472 Bacteria 901
528 Ga0495593_0027926 3300047673 Bacteria 3102
529 Ga0495593_0116575 3300047673 Bacteria 1361
530 Ga0495615_0069295 3300048090 Bacteria 947
531 Ga0495626_0139984 3300048091 Bacteria 1027
532 Ga0496100_0003171 3300048903 Bacteria 8532
533 Ga0496100_0076791 3300048903 Bacteria 2244
534 Ga0496100_0087923 3300048903 Bacteria 2114
535 Ga0496100_0224034 3300048903 Bacteria 1381
536 Ga0496101_0010287 3300048904 Bacteria 6177
537 Ga0496101_0085794 3300048904 Bacteria 2334
538 Ga0496101_0312091 3300048904 Bacteria 1233
539 Ga0496101_0587075 3300048904 Bacteria 881
540 Ga0496101_1168423 3300048904 Unclassified 603
541 Ga0496102_0009548 3300048905 Bacteria 8344
542 Ga0496102_0110548 3300048905 Bacteria 2562
543 Ga0496102_0704576 3300048905 Bacteria 933
544 Ga0496102_0709109 3300048905 Bacteria 929
545 Ga0496102_0990433 3300048905 Bacteria 761
546 Ga0496103_0228037 3300048906 Bacteria 1198
547 Ga0496104_0105133 3300048907 Bacteria 2705
548 Ga0496104_1135541 3300048907 Bacteria 685
549 Ga0496105_0038779 3300048908 Bacteria 3925
550 Ga0496105_0091716 3300048908 Bacteria 2509
551 Ga0496106_0102357 3300048909 Bacteria 2222
552 Ga0496106_0153140 3300048909 Bacteria 1819
553 Ga0496106_0212430 3300048909 Bacteria 1542
554 Ga0496106_0269158 3300048909 Bacteria 1364
555 Ga0496106_0423896 3300048909 Bacteria 1069
556 Ga0496107_0405704 3300048910 Bacteria 1013
557 Ga0496107_0930113 3300048910 Bacteria 633
558 Ga0496108_0026062 3300048911 Bacteria 4822
559 Ga0496108_0029728 3300048911 Bacteria 4527
560 Ga0496108_0069527 3300048911 Bacteria 2971
561 Ga0496109_0066579 3300048912 Bacteria 3299
562 Ga0496110_0033536 3300048913 Bacteria 4441
563 Ga0496110_0187981 3300048913 Bacteria 1876
564 Ga0496110_0625352 3300048913 Bacteria 976
565 Ga0496111_0331458 3300048914 Bacteria 1127
566 Ga0496112_0019420 3300048915 Bacteria 6415
567 Ga0496112_0022339 3300048915 Bacteria 6028
568 Ga0496113_0008046 3300048916 Bacteria 6842
569 Ga0496113_0298564 3300048916 Bacteria 1290
570 Ga0496114_0024551 3300048917 Bacteria 4922
571 Ga0496114_0154347 3300048917 Bacteria 1993
572 Ga0496114_0172268 3300048917 Bacteria 1887
573 Ga0496114_0576911 3300048917 Bacteria 993
574 Ga0496115_0000756 3300048918 Bacteria 23793
575 Ga0496115_0053194 3300048918 Bacteria 3249
576 Ga0496115_0168556 3300048918 Bacteria 1811
577 Ga0496115_0578714 3300048918 Bacteria 895
578 Ga0496118_0212832 3300048921 Bacteria 1133
579 Ga0496119_0038328 3300048922 Bacteria 3099
580 Ga0496119_0095104 3300048922 Bacteria 1684
581 Ga0496120_0122613 3300048923 Bacteria 1342
582 Ga0496121_0001173 3300048924 Bacteria 45935
583 Ga0496121_0020630 3300048924 Bacteria 6507
584 Ga0496121_0032422 3300048924 Bacteria 4748
585 Ga0496121_0081798 3300048924 Bacteria 2555
586 Ga0496121_0084143 3300048924 Bacteria 2509
587 Ga0496121_0100532 3300048924 Bacteria 2232
588 Ga0496121_0139556 3300048924 Bacteria 1800
589 Ga0496121_0158917 3300048924 Bacteria 1655
590 Ga0496121_0189945 3300048924 Bacteria 1474
591 Ga0496121_0341155 3300048924 Bacteria 1001
592 Ga0496124_0340719 3300048927 Bacteria 1065
593 Ga0496125_0001026 3300048928 Bacteria 43365
594 Ga0496125_0068882 3300048928 Bacteria 2780
595 Ga0496125_0132944 3300048928 Bacteria 1747
596 Ga0496126_0019791 3300048929 Bacteria 6622
597 Ga0496126_0049718 3300048929 Bacteria 3826
598 Ga0496126_0160219 3300048929 Bacteria 1923
599 Ga0496126_0366713 3300048929 Bacteria 1175
600 Ga0496126_0523565 3300048929 Bacteria 944
601 Ga0496126_0625454 3300048929 Bacteria 845
602 Ga0495678_131104 3300049459 Bacteria 831
603 Ga0495682_0057897 3300049460 Bacteria 1402
604 Ga0501040_0570516 3300049576 Bacteria 817
605 Ga0501041_0244784 3300049577 Bacteria 1127
606 Ga0501048_0617788 3300049582 Bacteria 778
607 Ga0501071_0293111 3300049587 Bacteria 1232
608 Ga0501072_0799056 3300049588 Bacteria 739
609 Ga0501076_0628107 3300049592 Bacteria 886
610 Ga0501079_0677602 3300049741 Bacteria 812
611 Ga0501083_0030536 3300049744 Bacteria 3702
612 nmdc:mga03683_108429_c1 3300050489 Bacteria 1225
613 nmdc:mga03n38_106685_c1 3300050490 Bacteria 1358
614 nmdc:mga03n38_1224_c1 3300050490 Bacteria 7213
615 nmdc:mga03n38_27256_c1 3300050490 Bacteria 2368
616 nmdc:mga03n38_309755_c1 3300050490 Bacteria 850
617 nmdc:mga00v17_10799_c1 3300050491 Bacteria 5003
618 nmdc:mga00v17_42244_c1 3300050491 Bacteria 2741
619 nmdc:mga0yw44_12680_c1 3300050492 Bacteria 4404
620 nmdc:mga0yw44_16350_c1 3300050492 Bacteria 4005
621 nmdc:mga0yw44_43679_c1 3300050492 Bacteria 2677
622 nmdc:mga0yw44_7350_c1 3300050492 Bacteria 5412
623 nmdc:mga0k408_10422_c1 3300050493 Bacteria 5025
624 nmdc:mga0k408_148051_c1 3300050493 Bacteria 1398
625 nmdc:mga0k408_16587_c1 3300050493 Bacteria 4089
626 nmdc:mga0k408_556744_c1 3300050493 Bacteria 678
627 nmdc:mga06z11_282792_c1 3300050494 Bacteria 983
628 nmdc:mga07m45_343939_c1 3300050496 Bacteria 867
629 nmdc:mga07m45_570401_c1 3300050496 Bacteria 654
630 nmdc:mga07m45_64919_c1 3300050496 Bacteria 2072
631 nmdc:mga07m45_9760_c1 3300050496 Bacteria 4992
632 nmdc:mga05p37_743581_c1 3300050507 Bacteria 1082
633 nmdc:mga09592_702675_c1 3300050508 Bacteria 860
634 nmdc:mga08y16_156738_c1 3300050511 Bacteria 2366
635 nmdc:mga0rr50_1002480_c1 3300050513 Bacteria 711
636 Ga0495601_0250197 3300053077 Bacteria 1157
637 Ga0500635_0022566 3300053080 Bacteria 1953
638 Ga0500635_0028208 3300053080 Bacteria 1791
639 Ga0495655_0232267 3300053083 Bacteria 614
640 Ga0495595_0003126 3300053084 Bacteria 6562
641 Ga0495619_0005038 3300053085 Bacteria 8390
642 Ga0500578_0320297 3300053086 Bacteria 914
643 Ga0500578_0362684 3300053086 Bacteria 844
644 Ga0500646_0230086 3300053090 Bacteria 646
645 Ga0500651_0004278 3300053093 Bacteria 7975
646 Ga0500566_0001254 3300053094 Bacteria 14821
647 Ga0500566_0067346 3300053094 Bacteria 2016
648 Ga0500554_001743 3300053102 Bacteria 4188
649 Ga0500562_028799 3300053108 Bacteria 1460
650 Ga0500594_0043270 3300053118 Bacteria 1241
651 Ga0500595_000055 3300053119 Bacteria 84205
652 Ga0500595_000398 3300053119 Bacteria 27905
653 Ga0500595_003593 3300053119 Bacteria 7195
654 Ga0500595_004060 3300053119 Bacteria 6658
655 Ga0500595_004292 3300053119 Bacteria 6424
656 Ga0500595_024284 3300053119 Bacteria 2117
657 Ga0500618_059240 3300053125 Bacteria 862
658 Ga0500642_0001656 3300053130 Bacteria 6443
659 Ga0500652_034920 3300053131 Bacteria 1994
660 Ga0500655_081625 3300053133 Bacteria 666
661 Ga0500559_0098200 3300053136 Bacteria 1347
662 Ga0500559_0158006 3300053136 Bacteria 1065
663 Ga0500568_0001579 3300053139 Bacteria 14407
664 Ga0500573_0354165 3300053140 Bacteria 712
665 Ga0500577_0000727 3300053142 Bacteria 8418
666 Ga0500577_0011123 3300053142 Bacteria 2674
667 Ga0500588_0005097 3300053146 Bacteria 2896
668 Ga0500589_039501 3300053147 Bacteria 2203
669 Ga0500589_231501 3300053147 Bacteria 689
670 Ga0500590_290123 3300053148 Bacteria 622
671 Ga0500603_002682 3300053150 Bacteria 3875
672 Ga0500603_107098 3300053150 Bacteria 836
673 Ga0500616_0000001 3300053153 Bacteria 1986011
674 Ga0500616_0000046 3300053153 Bacteria 333409
675 Ga0500622_0013418 3300053156 Bacteria 4420
676 Ga0500622_0037021 3300053156 Bacteria 2550
677 Ga0500627_0253920 3300053158 Bacteria 777
678 Ga0500634_0047755 3300053161 Bacteria 2311
679 Ga0500638_000184 3300053162 Bacteria 12736
680 Ga0500638_091957 3300053162 Bacteria 1427
681 Ga0500638_237714 3300053162 Bacteria 743
682 Ga0500639_088310 3300053163 Bacteria 1549
683 Ga0500636_0225352 3300053177 Bacteria 973
684 Ga0500636_0310773 3300053177 Bacteria 771
685 Ga0500636_0463674 3300053177 Bacteria 569
686 Ga0500637_0000118 3300053178 Bacteria 28882
687 Ga0500637_0002045 3300053178 Bacteria 8813
688 Ga0500637_0100805 3300053178 Bacteria 1674
689 Ga0500645_000458 3300053730 Bacteria 27970
690 Ga0500609_011291 3300053731 Bacteria 1206
691 Ga0500601_018202 3300053737 Bacteria 807
692 Ga0500587_031646 3300053739 Bacteria 729
693 Ga0501084_0297926 3300054114 Bacteria 1362
694 Ga0501084_0407055 3300054114 Bacteria 1150
695 Ga0500661_000044 3300055283 Bacteria 19202
696 Ga0501082_0879075 3300060353 Unclassified 784
697 2513698841 2513237101 Bacteria 7952346
698 2723842673 2721755755 Bacteria 8322773
699 2793080454
700 2874606651 2874604998 Bacteria 7834745
701 2879112013 2879110137 Bacteria 8907982
702 2889034029 2889033259 Bacteria 9099371
703 2893069982 2893066018 Bacteria 6158120
704 2903757450 2903748898 Bacteria 9972761
705 2904710751
706 2908757726 2908756301 Bacteria 8864324
707 2922367431 2922361189 Bacteria 7436256
708 2922389872 2922386360 Bacteria 7017218
709 8006937597 8006933436 Bacteria 10410654
710 8006965980 8006964411 Bacteria 8966052
711 8006977627 8006973647 Bacteria 10679141
712 8006998248 8006994254 Bacteria 8309700
713 8056677872 8056673599 Bacteria 7871253
714 8056695377 8056689827 Bacteria 6712655
715 Ga0070673_100869056
716 rootL2_10169653
717 rootL2_10247261
718 rootH1_10024351
719 rootH1_10137788
720 rootH1_10234860
721 JGI25404J52841_10024733
722 Ga0070658_10273432
723 Ga0070676_10067353
724 Ga0070683_100044662
725 Ga0070690_100220506
726 Ga0070670_100155387
727 Ga0068869_100051221
728 Ga0070666_10174508
729 Ga0070682_100059573
730 Ga0068868_100051213
731 Ga0068868_100219823
732 Ga0068868_100474742
733 Ga0070660_100855672
734 Ga0070689_100159774
735 Ga0070691_10380656
736 Ga0070668_100045521
737 Ga0070668_100048096
738 Ga0070668_100255265
739 Ga0070668_100729914
740 Ga0070669_100257342
741 Ga0070669_100860864
742 Ga0070675_100396475
743 Ga0070671_100037230
744 Ga0070671_100186694
745 Ga0070674_100681816
746 Ga0070673_100959497
747 Ga0070688_100195063
748 Ga0070659_100082725
749 Ga0070659_100170991
750 Ga0070659_100575187
751 Ga0070667_100158507
752 Ga0070667_100273700
753 Ga0070709_10310099
754 Ga0070713_100002238
755 Ga0070713_100438222
756 Ga0070713_100510601
757 Ga0070710_10003163
758 Ga0070711_100024492
759 Ga0070711_100271834
760 Ga0070700_100351080
761 Ga0070700_100388786
762 Ga0070700_100916473
763 Ga0070694_100284957
764 Ga0070708_100977893
765 Ga0070663_100018219
766 Ga0070663_100033631
767 Ga0070663_100044026
768 Ga0070678_100038487
769 Ga0070678_100120269
770 Ga0070678_100160736
771 Ga0070678_100235760
772 Ga0070662_100514100
773 Ga0070662_101019848
774 Ga0070681_10024819
775 Ga0068867_100191695
776 Ga0068867_100403946
777 Ga0070685_10301459
778 Ga0070685_10348994
779 Ga0070698_100109916
780 Ga0070679_100048564
781 Ga0070684_100219871
782 Ga0070697_100082648
783 Ga0068853_100103208
784 Ga0068853_100213211
785 Ga0068853_100260382
786 Ga0068853_100384687
787 Ga0070686_100800939
788 Ga0070695_100133633
789 Ga0070696_100246371
790 Ga0070665_100063875
791 Ga0070665_100070022
792 Ga0070665_100077263
793 Ga0070665_100112548
794 Ga0070665_100163965
795 Ga0070665_100535965
796 Ga0070665_101216990
797 Ga0068855_100022792
798 Ga0068855_100063925
799 Ga0070664_100111703
800 Ga0068857_100016281
801 Ga0068857_100019333
802 Ga0068857_100445022
803 Ga0068857_100528285
804 Ga0068854_100118837
805 Ga0068854_100480520
806 Ga0068856_100106558
807 Ga0068856_100145725
808 Ga0070702_100484753
809 Ga0070702_100537933
810 Ga0068852_100023684
811 Ga0068852_101479362
812 Ga0068859_100159082
813 Ga0068864_100041936
814 Ga0068864_100113126
815 Ga0068866_10019402
816 Ga0068866_10593537
817 Ga0068861_100017063
818 Ga0068861_100283941
819 Ga0068861_100324197
820 Ga0068861_100373477
821 Ga0068851_10041683
822 Ga0068851_10444372
823 Ga0068863_100160980
824 Ga0068863_100304171
825 Ga0068860_100086217
826 Ga0068860_100119377
827 Ga0068862_100019033
828 Ga0068862_100056794
829 Ga0068862_100120465
830 Ga0068862_100163321
831 Ga0068862_100312573
832 Ga0068862_100375531
833 Ga0081455_10013068
834 Ga0081455_10051521
835 Ga0081455_10134789
836 Ga0081540_1000495
837 Ga0081540_1014887
838 Ga0081540_1016491
839 Ga0081540_1024584
840 Ga0081540_1030349
841 Ga0081540_1092725
842 Ga0081539_10001606
843 Ga0081539_10029737
844 Ga0081539_10064543
845 Ga0070717_10005166
846 Ga0075365_10034540
847 Ga0075365_10036336
848 Ga0075365_10317871
849 Ga0075368_10076454
850 Ga0075363_100000071
851 Ga0075363_100044065
852 Ga0075363_100080805
853 Ga0075363_100100998
854 Ga0075363_100226515
855 Ga0075364_10051559
856 Ga0075364_10326783
857 Ga0070715_10008503
858 Ga0070716_100001652
859 Ga0070716_100045008
860 Ga0070716_100792877
861 Ga0070712_100003639
862 Ga0070712_100045347
863 Ga0070712_100322223
864 Ga0075362_10349762
865 Ga0075367_10013236
866 Ga0075367_10234773
867 Ga0075367_10331413
868 Ga0075369_10060933
869 Ga0075369_10155283
870 Ga0075366_10022174
871 Ga0075366_10108220
872 Ga0097621_100066614
873 Ga0075370_10012923
874 Ga0075370_10014414
875 Ga0075370_10137764
876 Ga0075370_10451528
877 Ga0068871_100240583
878 Ga0075428_100048197
879 Ga0075431_100274108
880 Ga0075433_10949189
881 Ga0075434_100087728
882 Ga0075429_100807155
883 Ga0068865_100031110
884 Ga0068865_100075496
885 Ga0097620_100159083
886 Ga0099794_10049308
887 Ga0105250_10032716
888 Ga0105240_10030470
889 Ga0105240_10946820
890 Ga0111539_10201448
891 Ga0105245_10007804
892 Ga0105245_10048656
893 Ga0105245_11177353
894 Ga0105243_10253527
895 Ga0105243_10284921
896 Ga0105243_10699405
897 Ga0105243_11139139
898 Ga0105243_11139140
899 Ga0105241_10287294
900 Ga0105241_10682836
901 Ga0105242_10055909
902 Ga0105242_10721592
903 Ga0105248_10408645
904 Ga0105248_11236394
905 Ga0105237_10605170
906 Ga0105237_10931192
907 Ga0105238_10027208
908 Ga0105238_10416596
909 Ga0105238_10444414
910 Ga0105238_11129631
911 Ga0105249_10083221
912 Ga0105249_11430030
913 Ga0105249_11903991
914 Ga0105239_10036841
915 Ga0105239_10142886
916 Ga0105239_10173773
917 Ga0105239_10201869
918 Ga0105239_10393033
919 Ga0105239_10774959
920 Ga0105239_10797696
921 Ga0105246_10017872
922 Ga0105246_10212801
923 Ga0105246_10223706
924 Ga0105246_10238298
925 Ga0105246_10314401
926 Ga0157370_10025304
927 Ga0157374_10030992
928 Ga0157374_10047009
929 Ga0157378_10057691
930 Ga0157378_10109748
931 Ga0157378_10144683
932 Ga0157378_10183545
933 Ga0157378_10349071
934 Ga0163162_10053887
935 Ga0163162_10156892
936 Ga0163162_10238324
937 Ga0163162_10656208
938 Ga0163162_11783010
939 Ga0157375_10013434
940 Ga0157375_10414038
941 Ga0157375_10773822
942 Ga0163163_10014617
943 Ga0163163_10029109
944 Ga0163163_10124624
945 Ga0163163_10270233
946 Ga0163163_10429119
947 Ga0163163_10702773
948 Ga0157380_10108238
949 Ga0157380_10972660
950 Ga0157380_11470893
951 Ga0182008_10113442
952 Ga0157379_10086927
953 Ga0157379_10191488
954 Ga0157376_10011422
955 Ga0157376_10141085
956 Ga0163161_10371523
957 Ga0163161_11607561
958 Ga0209758_1006031
959 Ga0207697_10241506
960 Ga0207692_10006099
961 Ga0207692_10007264
962 Ga0207692_10043717
963 Ga0207642_10011227
964 Ga0207710_10034230
965 Ga0207688_10064045
966 Ga0207688_10137375
967 Ga0207688_10423269
968 Ga0207680_10656895
969 Ga0207699_10022026
970 Ga0207645_10036141
971 Ga0207654_10036432
972 Ga0207654_10596064
973 Ga0207693_10001910
974 Ga0207693_10002004
975 Ga0207663_10000684
976 Ga0207663_10023567
977 Ga0207663_10035505
978 Ga0207660_10051318
979 Ga0207660_10650447
980 Ga0207657_10304172
981 Ga0207649_10122292
982 Ga0207681_10217806
983 Ga0207681_11163703
984 Ga0207694_10065957
985 Ga0207694_10366339
986 Ga0207650_10341665
987 Ga0207659_10136238
988 Ga0207659_10838188
989 Ga0207659_10971047
990 Ga0207687_10032719
991 Ga0207687_10064239
992 Ga0207687_10930150
993 Ga0207700_10085476
994 Ga0207700_11132018
995 Ga0207664_10026333
996 Ga0207664_10031827
997 Ga0207644_10037782
998 Ga0207690_10303409
999 Ga0207690_10450529
1000 Ga0207706_10087835
1001 Ga0207706_10089346
1002 Ga0207706_10142738
1003 Ga0207706_10378725
1004 Ga0207706_10857059
1005 Ga0207686_10024770
1006 Ga0207709_10120822
1007 Ga0207709_10679973
1008 Ga0207670_10271834
1009 Ga0207669_10002487
1010 Ga0207704_10060242
1011 Ga0207665_10001660
1012 Ga0207691_10022654
1013 Ga0207691_10206345
1014 Ga0207711_10044096
1015 Ga0207711_10646054
1016 Ga0207689_10032905
1017 Ga0207689_10040884
1018 Ga0207689_10100589
1019 Ga0207689_10255933
1020 Ga0207661_10012159
1021 Ga0207679_10733042
1022 Ga0207667_10196652
1023 Ga0207667_10363309
1024 Ga0207667_10753240
1025 Ga0207651_10247987
1026 Ga0207712_10179683
1027 Ga0207712_10916085
1028 Ga0207668_10010368
1029 Ga0207668_10056713
1030 Ga0207668_10087611
1031 Ga0207668_10127725
1032 Ga0207668_11132690
1033 Ga0207640_10114150
1034 Ga0207658_10026675
1035 Ga0207677_10037258
1036 Ga0207677_10102628
1037 Ga0207677_11619890
1038 Ga0207703_10050047
1039 Ga0207703_10889003
1040 Ga0207639_10386275
1041 Ga0207639_10661913
1042 Ga0207639_11236055
1043 Ga0207678_10010737
1044 Ga0207678_10064793
1045 Ga0207678_10095053
1046 Ga0207708_10425087
1047 Ga0207708_11424582
1048 Ga0207702_10357932
1049 Ga0207702_10536179
1050 Ga0207641_10052747
1051 Ga0207641_11259748
1052 Ga0207648_10085079
1053 Ga0207648_10438888
1054 Ga0207676_10145295
1055 Ga0207676_10933209
1056 Ga0207674_10026847
1057 Ga0207674_10037938
1058 Ga0207674_10366696
1059 Ga0207675_100028553
1060 Ga0207675_100254849
1061 Ga0207675_100526959
1062 Ga0207683_10021448
1063 Ga0207683_10111555
1064 Ga0207683_10212078
1065 Ga0207683_10438006
1066 Ga0207698_10854144
1067 Ga0268266_10002572
1068 Ga0268266_10049186
1069 Ga0268266_10050536
1070 Ga0268266_10116954
1071 Ga0268266_10189285
1072 Ga0268266_10418526
1073 Ga0268266_10742554
1074 Ga0268266_10747311
1075 Ga0268265_10055370
1076 Ga0268265_10065320
1077 Ga0268265_10069125
1078 Ga0268265_10090392
1079 Ga0268265_10148318
1080 Ga0268265_10846802
1081 Ga0268264_10726808
1082 Ga0268264_10808712
1083 Ga0307517_10000542
1084 Ga0307515_10303026
1085 Ga0265338_10954900
1086 Ga0307511_10091936
1087 Ga0265339_10016806
1088 Ga0265339_10200379
1089 Ga0265331_10129160
1090 Ga0307513_10552134
1091 Ga0307513_10558486
1092 Ga0307509_10084556
1093 Ga0307509_10098855
1094 Ga0307509_10219975
1095 Ga0307408_100360902
1096 Ga0265313_10024433
1097 Ga0307508_10035979
1098 Ga0307508_10209861
1099 Ga0265314_10129189
1100 Ga0265342_10440370
1101 Ga0307516_10025218
1102 Ga0307516_10033586
1103 Ga0307516_10049862
1104 Ga0307516_10090414
1105 Ga0307516_10425825
1106 Ga0307405_10266328
1107 Ga0307405_11191183
1108 Ga0307413_11019934
1109 Ga0307406_10069814
1110 Ga0307412_10420335
1111 Ga0307412_10666529
1112 Ga0307416_100349843
1113 Ga0307416_101095192
1114 Ga0307414_10062573
1115 Ga0307411_10507948
1116 Ga0307415_100059490
1117 Ga0307415_100365330
1118 Ga0307507_10022265
1119 Ga0307510_10008250
1120 Ga0307510_10039796
1121 Ga0307510_10060364
1122 Ga0373923_0009987
1123 Ga0373936_0244481
1124 Ga0373954_0038537
1125 Ga0373956_0011156
1126 Ga0373924_0039209
1127 Ga0373935_0143536
1128 Ga0373935_0957601
1129 Ga0373927_0012327
1130 Ga0373927_0030944
1131 Ga0373933_0000063
1132 Ga0373933_0189498
1133 Ga0373947_0154582
1134 Ga0373937_0028713
1135 Ga0373925_0132700
1136 Ga0395898_0081536
1137 Ga0395905_0379974
1138 Ga0395905_0660937
1139 Ga0439465_0040772
1140 Ga0451791_0367300
1141 Ga0451807_0158606
1142 Ga0451849_1471128
1143 Ga0451853_0386236
1144 Ga0451853_3441740
1145 Ga0451853_3669807
1146 Ga0439431_0106470
1147 Ga0466963_0081940
1148 Ga0466967_0051236
1149 Ga0495617_011407
1150 Ga0495592_0014335
1151 Ga0495603_0012869
1152 Ga0495603_0069273
1153 Ga0495629_0002515
1154 Ga0495629_0061664
1155 Ga0495629_0145273
1156 Ga0495638_0104983
1157 Ga0495638_0322458
1158 Ga0495641_0033174
1159 Ga0495651_0004462
1160 Ga0495651_0081967
1161 Ga0495653_0003036
1162 Ga0495582_0108066
1163 Ga0495605_0038482
1164 Ga0495639_0009803
1165 Ga0495639_0045469
1166 Ga0495585_0072551
1167 Ga0495594_0065639
1168 Ga0495594_0392528
1169 Ga0495594_0439242
1170 Ga0495596_0025730
1171 Ga0495583_0047643
1172 Ga0495608_0160742
1173 Ga0495616_0054129
1174 Ga0495620_0047817
1175 Ga0495628_0027640
1176 Ga0495631_0141293
1177 Ga0495632_0209977
1178 Ga0495632_0269388
1179 Ga0495644_0020334
1180 Ga0495644_0021643
1181 Ga0495644_0170333
1182 Ga0495648_0039107
1183 Ga0495648_0259950
1184 Ga0495642_0195995
1185 Ga0495652_0197282
1186 Ga0495654_0026992
1187 Ga0495640_0047969
1188 Ga0495640_0778979
1189 Ga0495587_0032213
1190 Ga0495598_0416198
1191 Ga0495621_0070993
1192 Ga0495597_0164644
1193 Ga0495645_0106144
1194 Ga0495622_0019739
1195 Ga0495633_0132334
1196 Ga0495667_0062749
1197 Ga0495656_0055732
1198 Ga0495656_0059855
1199 Ga0495656_0140602
1200 Ga0495668_0076572
1201 Ga0495625_0186313
1202 Ga0495635_0004510
1203 Ga0495588_0014838
1204 Ga0495657_0069495
1205 Ga0495657_0082207
1206 Ga0495599_0011097
1207 Ga0495623_0022627
1208 Ga0495623_0069398
1209 Ga0495646_0035804
1210 Ga0495647_0102996
1211 Ga0495658_0915135
1212 Ga0495669_0003294
1213 Ga0495669_0020244
1214 Ga0495669_0142534
1215 Ga0495613_0085664
1216 Ga0495613_0103513
1217 Ga0495671_0197308
1218 Ga0495649_0156355
1219 Ga0495589_0145032
1220 Ga0495600_0031228
1221 Ga0495600_0074366
1222 Ga0495581_0103002
1223 Ga0495581_0276903
1224 Ga0495604_0023084
1225 Ga0495604_0040796
1226 Ga0495674_0295732
1227 Ga0495674_0344918
1228 Ga0495674_0377356
1229 Ga0495674_0466578
1230 Ga0495672_0008799
1231 Ga0495672_0122873
1232 Ga0495672_0271491
1233 Ga0495676_0679538
1234 Ga0495680_0012935
1235 Ga0495675_0024272
1236 Ga0495679_035686
1237 Ga0495673_0046821
1238 Ga0495684_0050155
1239 Ga0495686_0084457
1240 Ga0495686_0152027
1241 Ga0495686_0292845
1242 Ga0495593_0027926
1243 Ga0495593_0116575
1244 Ga0495615_0069295
1245 Ga0495626_0139984
1246 Ga0496100_0003171
1247 Ga0496100_0076791
1248 Ga0496100_0087923
1249 Ga0496100_0224034
1250 Ga0496101_0010287
1251 Ga0496101_0085794
1252 Ga0496101_0312091
1253 Ga0496101_0587075
1254 Ga0496101_1168423
1255 Ga0496102_0009548
1256 Ga0496102_0110548
1257 Ga0496102_0704576
1258 Ga0496102_0709109
1259 Ga0496102_0990433
1260 Ga0496103_0228037
1261 Ga0496104_0105133
1262 Ga0496104_1135541
1263 Ga0496105_0038779
1264 Ga0496105_0091716
1265 Ga0496106_0102357
1266 Ga0496106_0153140
1267 Ga0496106_0212430
1268 Ga0496106_0269158
1269 Ga0496106_0423896
1270 Ga0496107_0405704
1271 Ga0496107_0930113
1272 Ga0496108_0026062
1273 Ga0496108_0029728
1274 Ga0496108_0069527
1275 Ga0496109_0066579
1276 Ga0496110_0033536
1277 Ga0496110_0187981
1278 Ga0496110_0625352
1279 Ga0496111_0331458
1280 Ga0496112_0019420
1281 Ga0496112_0022339
1282 Ga0496113_0008046
1283 Ga0496113_0298564
1284 Ga0496114_0024551
1285 Ga0496114_0154347
1286 Ga0496114_0172268
1287 Ga0496114_0576911
1288 Ga0496115_0000756
1289 Ga0496115_0053194
1290 Ga0496115_0168556
1291 Ga0496115_0578714
1292 Ga0496118_0212832
1293 Ga0496119_0038328
1294 Ga0496119_0095104
1295 Ga0496120_0122613
1296 Ga0496121_0001173
1297 Ga0496121_0020630
1298 Ga0496121_0032422
1299 Ga0496121_0081798
1300 Ga0496121_0084143
1301 Ga0496121_0100532
1302 Ga0496121_0139556
1303 Ga0496121_0158917
1304 Ga0496121_0189945
1305 Ga0496121_0341155
1306 Ga0496124_0340719
1307 Ga0496125_0001026
1308 Ga0496125_0068882
1309 Ga0496125_0132944
1310 Ga0496126_0019791
1311 Ga0496126_0049718
1312 Ga0496126_0160219
1313 Ga0496126_0366713
1314 Ga0496126_0523565
1315 Ga0496126_0625454
1316 Ga0495678_131104
1317 Ga0495682_0057897
1318 Ga0501040_0570516
1319 Ga0501041_0244784
1320 Ga0501048_0617788
1321 Ga0501071_0293111
1322 Ga0501072_0799056
1323 Ga0501076_0628107
1324 Ga0501079_0677602
1325 Ga0501083_0030536
1326 nmdc:mga03683_108429_c1
1327 nmdc:mga03n38_106685_c1
1328 nmdc:mga03n38_1224_c1
1329 nmdc:mga03n38_27256_c1
1330 nmdc:mga03n38_309755_c1
1331 nmdc:mga00v17_10799_c1
1332 nmdc:mga00v17_42244_c1
1333 nmdc:mga0yw44_12680_c1
1334 nmdc:mga0yw44_16350_c1
1335 nmdc:mga0yw44_43679_c1
1336 nmdc:mga0yw44_7350_c1
1337 nmdc:mga0k408_10422_c1
1338 nmdc:mga0k408_148051_c1
1339 nmdc:mga0k408_16587_c1
1340 nmdc:mga0k408_556744_c1
1341 nmdc:mga06z11_282792_c1
1342 nmdc:mga07m45_343939_c1
1343 nmdc:mga07m45_570401_c1
1344 nmdc:mga07m45_64919_c1
1345 nmdc:mga07m45_9760_c1
1346 nmdc:mga05p37_743581_c1
1347 nmdc:mga09592_702675_c1
1348 nmdc:mga08y16_156738_c1
1349 nmdc:mga0rr50_1002480_c1
1350 Ga0495601_0250197
1351 Ga0500635_0022566
1352 Ga0500635_0028208
1353 Ga0495655_0232267
1354 Ga0495595_0003126
1355 Ga0495619_0005038
1356 Ga0500578_0320297
1357 Ga0500578_0362684
1358 Ga0500646_0230086
1359 Ga0500651_0004278
1360 Ga0500566_0001254
1361 Ga0500566_0067346
1362 Ga0500554_001743
1363 Ga0500562_028799
1364 Ga0500594_0043270
1365 Ga0500595_000055
1366 Ga0500595_000398
1367 Ga0500595_003593
1368 Ga0500595_004060
1369 Ga0500595_004292
1370 Ga0500595_024284
1371 Ga0500618_059240
1372 Ga0500642_0001656
1373 Ga0500652_034920
1374 Ga0500655_081625
1375 Ga0500559_0098200
1376 Ga0500559_0158006
1377 Ga0500568_0001579
1378 Ga0500573_0354165
1379 Ga0500577_0000727
1380 Ga0500577_0011123
1381 Ga0500588_0005097
1382 Ga0500589_039501
1383 Ga0500589_231501
1384 Ga0500590_290123
1385 Ga0500603_002682
1386 Ga0500603_107098
1387 Ga0500616_0000001
1388 Ga0500616_0000046
1389 Ga0500622_0013418
1390 Ga0500622_0037021
1391 Ga0500627_0253920
1392 Ga0500634_0047755
1393 Ga0500638_000184
1394 Ga0500638_091957
1395 Ga0500638_237714
1396 Ga0500639_088310
1397 Ga0500636_0225352
1398 Ga0500636_0310773
1399 Ga0500636_0463674
1400 Ga0500637_0000118
1401 Ga0500637_0002045
1402 Ga0500637_0100805
1403 Ga0500645_000458
1404 Ga0500609_011291
1405 Ga0500601_018202
1406 Ga0500587_031646
1407 Ga0501084_0297926
1408 Ga0501084_0407055
1409 Ga0500661_000044
1410 Ga0501082_0879075
1411 2513698841
1412 2723842673
1413 2793080454
1414 2874606651
1415 2879112013
1416 2889034029
1417 2893069982
1418 2903757450
1419 2904710751
1420 2908757726
1421 2922367431
1422 2922389872
1423 8006937597
1424 8006965980
1425 8006977627
1426 8006998248
1427 8056677872
1428 8056695377

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04982

HPP

HPP family

36

188

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7w6k-assembly1.cif.gz_B cryo-em structure of gmalmt12/quac1 anion channel 0.5084 13 152
7w6k-assembly1.cif.gz_B cryo-em structure of gmalmt12/quac1 anion channel 0.4433 13 152
8hki-assembly1.cif.gz_A human tric open state 0.442 32 164
8hki-assembly1.cif.gz_A human tric open state 0.3643 32 164
7nvo-assembly1.cif.gz_a human tric complex in open state with nanobody bound 0.3619 32 162
ID Description Score Start End Superfamily
af_Q55EF8_157_281_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.9093 53 166 1.10.1760.20
af_C6T3E6_115_232_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.9074 53 163 1.10.1760.20
af_A0A1D6KZL7_129_238_1.20.144.10 Mainly Alpha;Up-down Bundle;Vanadium-containing Chloroperoxidase; domain 1;Phosphatidic acid phosphatase type 2/haloperoxidase 0.9061 53 153 1.20.144.10
af_A0A1D8PQJ0_78_202_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.8981 53 166 1.10.1760.20
af_C6T3E6_115_232_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.8496 53 163 1.10.1760.20
ID Description Score Start End GO Terms
AF-W3RP25-F1-model_v4 HPP family protein 0.9923 52 170 GO:0016020
AF-W3RP25-F1-model_v4 HPP family protein 0.976 52 170 GO:0016020
AF-A0A2P2D904-F1-model_v4 HPP family protein 0.9672 61 170 GO:0016020
AF-A0A4V3JPU9-F1-model_v4 HPP family protein 0.9671 53 170 GO:0016020
AF-C2VPV5-F1-model_v4 deleted 0.9653 52 170

Map