F476878

General Info

Members Datasets Scaffolds Average Seq Length
713 280 1426 163

Family's Representative Sequence

Representative Sequence 3300005564|Ga0070664_102043531|Ga0070664_1020435311
Length 170
Sequence MTTMTLPYAEPLVPREPGERQIPEPPRRGEPGGPPCGICTMKATNAVWSDENWTLHPPVGGSLPGSVWLASRVHVDSFMDLPEDLAADFGRVAARVERAILSLDDVARVHLYRWGDGGAHFHVWFIPRPLGMIEASGMMLPLWEDVLPNRPDEELVAAATAIGAAMGARD

Samples

Sample ID Description Type Environment
1 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
82 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
83 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
149 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
150 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
151 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
152 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
153 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
154 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
155 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
156 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
157 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
158 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
159 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
160 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
161 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
162 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
163 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
164 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
165 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
166 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
167 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
168 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
169 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
170 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
173 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
174 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
177 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
178 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
179 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
180 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
181 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
182 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
183 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
184 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
185 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
186 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
187 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
188 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
189 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
190 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
191 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
192 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
193 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
194 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
195 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
196 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
197 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
198 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
199 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
200 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
201 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
202 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
203 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
204 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
205 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
206 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
207 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
208 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
209 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
210 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
211 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
212 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
213 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
214 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
215 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
216 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
217 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
218 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
219 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
220 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
221 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
222 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
223 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
224 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
225 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
226 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
227 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
228 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
229 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
230 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
231 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
232 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
233 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
234 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
235 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
236 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
237 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
238 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
239 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
240 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
241 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
242 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
243 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
244 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
245 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
246 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
247 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
248 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
249 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
250 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
251 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
252 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
253 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
254 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
255 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
256 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
257 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
258 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
259 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
260 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
261 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
262 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
263 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
264 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
265 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
266 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
267 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
268 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
269 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
270 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
271 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
272 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
273 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
274 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
275 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
276 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
277 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
278 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
279 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
280 2643221679 Angustibacter sp. Root456 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.32
Metatranscriptomes 1.54
Isolates 0.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.14
Nodule 0
Rhizoplane 10.66
Rhizosphere 87.24
Stem 0
Stem Tuber 0
Unclassified 1.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070664_102043531 3300005564 Bacteria 544
2 Ga0070658_10014512 3300005327 Bacteria 6323
3 Ga0070658_10093470 3300005327 Bacteria 2481
4 Ga0070676_10321515 3300005328 Bacteria 1055
5 Ga0070676_11129984 3300005328 Bacteria 593
6 Ga0070683_100006996 3300005329 Bacteria 9492
7 Ga0070683_100009673 3300005329 Bacteria 8253
8 Ga0070683_100045561 3300005329 Bacteria 4048
9 Ga0070683_100092201 3300005329 Bacteria 2845
10 Ga0070683_100092747 3300005329 Bacteria 2837
11 Ga0070680_100003945 3300005336 Bacteria 11097
12 Ga0070680_100010659 3300005336 Bacteria 7091
13 Ga0070680_100286268 3300005336 Bacteria 1397
14 Ga0070680_100389059 3300005336 Bacteria 1188
15 Ga0070680_100795896 3300005336 Bacteria 815
16 Ga0070680_101051182 3300005336 Bacteria 704
17 Ga0070682_100008440 3300005337 Bacteria 5814
18 Ga0070682_100106910 3300005337 Bacteria 1857
19 Ga0070682_100944854 3300005337 Bacteria 712
20 Ga0068868_100017078 3300005338 Bacteria 5399
21 Ga0068868_100121269 3300005338 Bacteria 2133
22 Ga0070660_100004001 3300005339 Bacteria 10172
23 Ga0070660_100004482 3300005339 Bacteria 9650
24 Ga0070660_100062970 3300005339 Bacteria 2883
25 Ga0070691_10154629 3300005341 Bacteria 1178
26 Ga0070691_10570766 3300005341 Bacteria 664
27 Ga0070661_100037032 3300005344 Bacteria 3548
28 Ga0070661_100215079 3300005344 Bacteria 1472
29 Ga0070661_100230218 3300005344 Bacteria 1424
30 Ga0070692_10495041 3300005345 Bacteria 791
31 Ga0070668_100965531 3300005347 Bacteria 764
32 Ga0070671_100288737 3300005355 Bacteria 1396
33 Ga0070674_101160106 3300005356 Bacteria 684
34 Ga0070673_100660117 3300005364 Bacteria 958
35 Ga0070673_101033814 3300005364 Bacteria 766
36 Ga0070673_101657349 3300005364 Bacteria 605
37 Ga0070659_100003970 3300005366 Bacteria 10532
38 Ga0070659_100091904 3300005366 Bacteria 2433
39 Ga0070709_10108130 3300005434 Bacteria 1865
40 Ga0070709_10164254 3300005434 Bacteria 1546
41 Ga0070709_10247131 3300005434 Bacteria 1284
42 Ga0070714_100088494 3300005435 Bacteria 2710
43 Ga0070714_100176807 3300005435 Bacteria 1940
44 Ga0070714_100398631 3300005435 Bacteria 1300
45 Ga0070714_100547519 3300005435 Bacteria 1107
46 Ga0070713_100099261 3300005436 Bacteria 2519
47 Ga0070713_100184748 3300005436 Bacteria 1875
48 Ga0070713_100408306 3300005436 Bacteria 1269
49 Ga0070713_100492218 3300005436 Bacteria 1156
50 Ga0070713_100788068 3300005436 Bacteria 911
51 Ga0070710_10033470 3300005437 Bacteria 2791
52 Ga0070710_10485766 3300005437 Bacteria 843
53 Ga0070701_10184685 3300005438 Bacteria 1223
54 Ga0070711_101737263 3300005439 Bacteria 547
55 Ga0070705_100366666 3300005440 Bacteria 1055
56 Ga0070694_100076176 3300005444 Bacteria 2322
57 Ga0070663_100016306 3300005455 Bacteria 4822
58 Ga0070663_100042339 3300005455 Bacteria 3199
59 Ga0070663_100148827 3300005455 Bacteria 1794
60 Ga0070678_100033770 3300005456 Bacteria 3556
61 Ga0070678_100119005 3300005456 Bacteria 2080
62 Ga0070678_101493313 3300005456 Bacteria 633
63 Ga0070662_100015266 3300005457 Bacteria 5142
64 Ga0070662_101415941 3300005457 Bacteria 599
65 Ga0070681_10006108 3300005458 Bacteria 11687
66 Ga0070681_10060200 3300005458 Bacteria 3775
67 Ga0070681_10188297 3300005458 Bacteria 1983
68 Ga0070681_10322240 3300005458 Bacteria 1455
69 Ga0070681_10498685 3300005458 Bacteria 1130
70 Ga0070681_10499402 3300005458 Bacteria 1129
71 Ga0070681_11304774 3300005458 Bacteria 649
72 Ga0070685_10548208 3300005466 Bacteria 825
73 Ga0070707_100363869 3300005468 Bacteria 1405
74 Ga0070698_100369580 3300005471 Bacteria 1366
75 Ga0070679_100012955 3300005530 Bacteria 7987
76 Ga0070679_100067988 3300005530 Bacteria 3554
77 Ga0070679_100077395 3300005530 Bacteria 3315
78 Ga0070679_100239922 3300005530 Bacteria 1770
79 Ga0070679_100293235 3300005530 Bacteria 1578
80 Ga0070684_100001069 3300005535 Bacteria 19609
81 Ga0070684_100038102 3300005535 Bacteria 4128
82 Ga0070684_100152054 3300005535 Bacteria 2097
83 Ga0070684_100159192 3300005535 Bacteria 2048
84 Ga0070684_100465010 3300005535 Bacteria 1170
85 Ga0070684_100757674 3300005535 Bacteria 906
86 Ga0068853_100072322 3300005539 Bacteria 3005
87 Ga0068853_100128426 3300005539 Bacteria 2267
88 Ga0068853_100262375 3300005539 Bacteria 1588
89 Ga0070672_100477663 3300005543 Bacteria 1076
90 Ga0070686_100031396 3300005544 Bacteria 3247
91 Ga0070686_100432224 3300005544 Bacteria 1008
92 Ga0070695_100290456 3300005545 Bacteria 1205
93 Ga0070696_100015499 3300005546 Bacteria 5120
94 Ga0070696_100312300 3300005546 Bacteria 1207
95 Ga0070693_100000663 3300005547 Bacteria 15238
96 Ga0070693_100045928 3300005547 Bacteria 2478
97 Ga0070704_100306479 3300005549 Bacteria 1325
98 Ga0070704_100444752 3300005549 Bacteria 1115
99 Ga0068855_100017357 3300005563 Bacteria 8660
100 Ga0068855_100043436 3300005563 Bacteria 5324
101 Ga0068855_100046329 3300005563 Bacteria 5141
102 Ga0068855_100047741 3300005563 Bacteria 5057
103 Ga0068855_100138986 3300005563 Bacteria 2770
104 Ga0068855_100170133 3300005563 Bacteria 2468
105 Ga0068855_100234007 3300005563 Bacteria 2055
106 Ga0068855_100256959 3300005563 Bacteria 1947
107 Ga0068855_100884270 3300005563 Bacteria 945
108 Ga0068855_101986103 3300005563 Bacteria 588
109 Ga0070664_100727173 3300005564 Bacteria 926
110 Ga0068857_100017763 3300005577 Bacteria 6235
111 Ga0068857_101623643 3300005577 Unclassified 631
112 Ga0068854_100635267 3300005578 Bacteria 915
113 Ga0068854_101250024 3300005578 Bacteria 667
114 Ga0068856_100008004 3300005614 Bacteria 10319
115 Ga0068856_100022318 3300005614 Bacteria 6151
116 Ga0068856_100175528 3300005614 Bacteria 2155
117 Ga0068856_100336184 3300005614 Bacteria 1528
118 Ga0068856_100435918 3300005614 Bacteria 1330
119 Ga0068856_101361568 3300005614 Bacteria 724
120 Ga0070702_100456576 3300005615 Bacteria 928
121 Ga0068852_100084669 3300005616 Bacteria 2822
122 Ga0068852_100113572 3300005616 Bacteria 2467
123 Ga0068864_101342918 3300005618 Bacteria 716
124 Ga0068866_10255668 3300005718 Bacteria 1074
125 Ga0068866_10985191 3300005718 Bacteria 598
126 Ga0068861_100045992 3300005719 Bacteria 3289
127 Ga0068861_100528485 3300005719 Bacteria 1071
128 Ga0068862_101623495 3300005844 Bacteria 654
129 Ga0081455_10004689 3300005937 Bacteria 15213
130 Ga0081455_10005621 3300005937 Bacteria 13698
131 Ga0081455_10018531 3300005937 Bacteria 6625
132 Ga0081540_1003817 3300005983 Bacteria 11789
133 Ga0081540_1019178 3300005983 Bacteria 4168
134 Ga0070717_10003529 3300006028 Bacteria 11212
135 Ga0070717_10070213 3300006028 Bacteria 2918
136 Ga0070717_10585305 3300006028 Unclassified 1012
137 Ga0075364_10295936 3300006051 Bacteria 1102
138 Ga0075432_10002751 3300006058 Bacteria 5888
139 Ga0075432_10021437 3300006058 Bacteria 2209
140 Ga0070715_10030750 3300006163 Bacteria 2173
141 Ga0070716_100033324 3300006173 Bacteria 2816
142 Ga0070712_100029483 3300006175 Bacteria 3678
143 Ga0070712_100071640 3300006175 Bacteria 2480
144 Ga0097621_100022976 3300006237 Bacteria 4848
145 Ga0097621_100119449 3300006237 Bacteria 2234
146 Ga0068871_100024401 3300006358 Bacteria 4689
147 Ga0075428_100057745 3300006844 Bacteria 4248
148 Ga0075431_100037465 3300006847 Bacteria 4995
149 Ga0075431_101623691 3300006847 Bacteria 604
150 Ga0075433_10053512 3300006852 Bacteria 3520
151 Ga0075433_10118240 3300006852 Bacteria 2352
152 Ga0075434_100029588 3300006871 Bacteria 5389
153 Ga0075434_100078020 3300006871 Bacteria 3307
154 Ga0075434_100139759 3300006871 Bacteria 2441
155 Ga0075434_100221866 3300006871 Bacteria 1910
156 Ga0075434_101034398 3300006871 Bacteria 835
157 Ga0068865_101173016 3300006881 Bacteria 679
158 Ga0075436_100015472 3300006914 Bacteria 5224
159 Ga0075436_100061303 3300006914 Bacteria 2598
160 Ga0075436_100264282 3300006914 Bacteria 1227
161 Ga0075435_100013309 3300007076 Bacteria 6115
162 Ga0075435_100041473 3300007076 Bacteria 3679
163 Ga0075435_100071489 3300007076 Bacteria 2833
164 Ga0075435_100712198 3300007076 Bacteria 873
165 Ga0075435_101304367 3300007076 Unclassified 636
166 Ga0105240_10053057 3300009093 Bacteria 5093
167 Ga0105240_10128606 3300009093 Bacteria 3041
168 Ga0105240_10132214 3300009093 Bacteria 2992
169 Ga0111539_10113435 3300009094 Bacteria 3179
170 Ga0111539_10150273 3300009094 Bacteria 2726
171 Ga0111539_10751950 3300009094 Bacteria 1135
172 Ga0111539_10899693 3300009094 Bacteria 1029
173 Ga0111539_11110629 3300009094 Bacteria 919
174 Ga0105245_10052545 3300009098 Bacteria 3654
175 Ga0105245_10077292 3300009098 Bacteria 3034
176 Ga0105245_10086271 3300009098 Bacteria 2879
177 Ga0105245_10129502 3300009098 Bacteria 2366
178 Ga0105245_10130399 3300009098 Bacteria 2357
179 Ga0105245_10842265 3300009098 Bacteria 957
180 Ga0105245_10998333 3300009098 Bacteria 881
181 Ga0105245_11053328 3300009098 Bacteria 859
182 Ga0105245_11726522 3300009098 Bacteria 678
183 Ga0114129_10393875 3300009147 Bacteria 1826
184 Ga0114129_10693616 3300009147 Bacteria 1309
185 Ga0114129_11252413 3300009147 Bacteria 921
186 Ga0105243_10105017 3300009148 Bacteria 2352
187 Ga0105243_10121474 3300009148 Bacteria 2203
188 Ga0105243_10862063 3300009148 Bacteria 898
189 Ga0105241_10345984 3300009174 Bacteria 1289
190 Ga0105241_10571659 3300009174 Bacteria 1018
191 Ga0105242_10011950 3300009176 Bacteria 6682
192 Ga0105248_10240018 3300009177 Bacteria 2040
193 Ga0105237_10134510 3300009545 Bacteria 2467
194 Ga0105237_10196844 3300009545 Bacteria 2015
195 Ga0105237_10370826 3300009545 Bacteria 1436
196 Ga0105238_10131668 3300009551 Bacteria 2479
197 Ga0105238_10523461 3300009551 Bacteria 1188
198 Ga0105238_11242268 3300009551 Bacteria 770
199 Ga0105249_10003836 3300009553 Bacteria 12972
200 Ga0105249_10282305 3300009553 Bacteria 1659
201 Ga0105249_11699973 3300009553 Unclassified 704
202 Ga0105239_10020582 3300010375 Bacteria 7279
203 Ga0105239_10062848 3300010375 Bacteria 4075
204 Ga0105239_10120284 3300010375 Bacteria 2916
205 Ga0105239_10572159 3300010375 Bacteria 1287
206 Ga0105239_10920051 3300010375 Bacteria 1004
207 Ga0105246_10977801 3300011119 Bacteria 765
208 Ga0105246_11028759 3300011119 Bacteria 747
209 Ga0105246_11372195 3300011119 Bacteria 658
210 Ga0157344_1008004 3300012476 Bacteria 717
211 Ga0157326_1024070 3300012513 Bacteria 770
212 Ga0157338_1007365 3300012515 Bacteria 1042
213 Ga0157373_10074926 3300013100 Bacteria 2388
214 Ga0157373_10098482 3300013100 Bacteria 2058
215 Ga0157373_10489664 3300013100 Bacteria 888
216 Ga0157373_11045858 3300013100 Bacteria 611
217 Ga0157370_10017006 3300013104 Bacteria 7349
218 Ga0157370_10042241 3300013104 Bacteria 4395
219 Ga0157370_10342609 3300013104 Bacteria 1378
220 Ga0157370_10366497 3300013104 Bacteria 1328
221 Ga0157369_10008579 3300013105 Bacteria 11720
222 Ga0157369_10023587 3300013105 Bacteria 6853
223 Ga0157369_10469577 3300013105 Bacteria 1302
224 Ga0157374_10023750 3300013296 Bacteria 5489
225 Ga0157374_10914494 3300013296 Bacteria 895
226 Ga0163162_10016329 3300013306 Bacteria 7257
227 Ga0163162_10067284 3300013306 Bacteria 3633
228 Ga0157372_10125387 3300013307 Bacteria 2952
229 Ga0157372_10154714 3300013307 Bacteria 2648
230 Ga0157372_10213232 3300013307 Bacteria 2238
231 Ga0157372_11282190 3300013307 Bacteria 846
232 Ga0157375_10505317 3300013308 Bacteria 1373
233 Ga0157375_10711262 3300013308 Bacteria 1158
234 Ga0157375_10948440 3300013308 Bacteria 1002
235 Ga0163163_10293682 3300014325 Bacteria 1678
236 Ga0163163_10840916 3300014325 Bacteria 981
237 Ga0182008_10037277 3300014497 Bacteria 2432
238 Ga0182008_10150935 3300014497 Bacteria 1166
239 Ga0157377_10129669 3300014745 Bacteria 1538
240 Ga0157377_10171890 3300014745 Bacteria 1356
241 Ga0157376_10032012 3300014969 Bacteria 4218
242 Ga0157376_10487049 3300014969 Bacteria 1210
243 Ga0157376_10887146 3300014969 Bacteria 909
244 Ga0157376_11269871 3300014969 Bacteria 766
245 Ga0182007_10030251 3300015262 Bacteria 1851
246 Ga0163161_10026845 3300017792 Bacteria 4082
247 Ga0163161_10145663 3300017792 Bacteria 1796
248 Ga0197907_10004119 3300020069 Bacteria 1683
249 Ga0197907_10785707 3300020069 Bacteria 1034
250 Ga0197907_11508900 3300020069 Bacteria 863
251 Ga0206356_10189796 3300020070 Bacteria 1332
252 Ga0206354_11013207 3300020081 Bacteria 3314
253 Ga0206353_10295879 3300020082 Bacteria 860
254 Ga0206353_11088500 3300020082 Bacteria 2236
255 Ga0206353_11656187 3300020082 Bacteria 1198
256 Ga0224712_10066300 3300022467 Bacteria 1453
257 Ga0224712_10088063 3300022467 Bacteria 1295
258 Ga0224712_10216377 3300022467 Bacteria 876
259 Ga0207692_10107946 3300025898 Bacteria 1539
260 Ga0207692_10222205 3300025898 Bacteria 1120
261 Ga0207642_10493794 3300025899 Bacteria 748
262 Ga0207685_10057805 3300025905 Bacteria 1523
263 Ga0207699_10100618 3300025906 Bacteria 1833
264 Ga0207699_10841276 3300025906 Bacteria 676
265 Ga0207705_10032309 3300025909 Bacteria 3739
266 Ga0207705_10433932 3300025909 Bacteria 1018
267 Ga0207705_10739657 3300025909 Bacteria 764
268 Ga0207654_10111270 3300025911 Bacteria 1705
269 Ga0207654_10708684 3300025911 Bacteria 723
270 Ga0207707_10006694 3300025912 Bacteria 10057
271 Ga0207707_10016804 3300025912 Bacteria 6375
272 Ga0207707_10017890 3300025912 Bacteria 6179
273 Ga0207707_10076686 3300025912 Bacteria 2917
274 Ga0207707_10099367 3300025912 Bacteria 2543
275 Ga0207707_10119248 3300025912 Bacteria 2306
276 Ga0207707_10956161 3300025912 Bacteria 705
277 Ga0207671_10281050 3300025914 Bacteria 1313
278 Ga0207671_10404210 3300025914 Bacteria 1086
279 Ga0207693_10018333 3300025915 Bacteria 5576
280 Ga0207693_10069596 3300025915 Bacteria 2754
281 Ga0207693_10292443 3300025915 Bacteria 1277
282 Ga0207693_10560085 3300025915 Bacteria 891
283 Ga0207663_10086418 3300025916 Bacteria 2068
284 Ga0207663_10122134 3300025916 Bacteria 1785
285 Ga0207663_10642241 3300025916 Bacteria 837
286 Ga0207660_10187641 3300025917 Bacteria 1608
287 Ga0207660_10230236 3300025917 Bacteria 1457
288 Ga0207660_10315973 3300025917 Bacteria 1246
289 Ga0207660_10555820 3300025917 Bacteria 934
290 Ga0207660_10847083 3300025917 Bacteria 746
291 Ga0207657_10000536 3300025919 Bacteria 40425
292 Ga0207657_10000610 3300025919 Bacteria 37898
293 Ga0207657_10002980 3300025919 Bacteria 18154
294 Ga0207649_10777610 3300025920 Bacteria 746
295 Ga0207652_10010087 3300025921 Bacteria 7610
296 Ga0207652_10013102 3300025921 Bacteria 6712
297 Ga0207652_10049790 3300025921 Bacteria 3587
298 Ga0207652_10158465 3300025921 Bacteria 2028
299 Ga0207652_10635270 3300025921 Bacteria 955
300 Ga0207681_11187847 3300025923 Bacteria 641
301 Ga0207694_10027861 3300025924 Bacteria 4304
302 Ga0207694_10258762 3300025924 Bacteria 1425
303 Ga0207687_10066239 3300025927 Bacteria 2567
304 Ga0207687_10217537 3300025927 Bacteria 1502
305 Ga0207687_10243718 3300025927 Bacteria 1426
306 Ga0207687_10486752 3300025927 Bacteria 1028
307 Ga0207687_11380733 3300025927 Bacteria 605
308 Ga0207700_10586469 3300025928 Bacteria 991
309 Ga0207700_10634759 3300025928 Bacteria 952
310 Ga0207664_10014288 3300025929 Bacteria 5728
311 Ga0207664_10138888 3300025929 Bacteria 2053
312 Ga0207664_10168772 3300025929 Bacteria 1871
313 Ga0207664_10172958 3300025929 Bacteria 1850
314 Ga0207664_10210528 3300025929 Bacteria 1682
315 Ga0207664_10356324 3300025929 Bacteria 1295
316 Ga0207664_11329259 3300025929 Unclassified 639
317 Ga0207644_10231971 3300025931 Bacteria 1467
318 Ga0207690_10304035 3300025932 Bacteria 1249
319 Ga0207706_10012045 3300025933 Bacteria 7880
320 Ga0207706_10083447 3300025933 Bacteria 2809
321 Ga0207709_10036855 3300025935 Bacteria 2901
322 Ga0207704_10377410 3300025938 Bacteria 1112
323 Ga0207665_10175013 3300025939 Bacteria 1552
324 Ga0207665_10465252 3300025939 Bacteria 972
325 Ga0207691_10361764 3300025940 Bacteria 1240
326 Ga0207711_10803277 3300025941 Bacteria 876
327 Ga0207661_10058105 3300025944 Bacteria 3113
328 Ga0207661_10354414 3300025944 Bacteria 1324
329 Ga0207661_10378220 3300025944 Bacteria 1281
330 Ga0207661_10615042 3300025944 Bacteria 998
331 Ga0207679_10027368 3300025945 Bacteria 3942
332 Ga0207667_10026127 3300025949 Bacteria 6383
333 Ga0207667_10057447 3300025949 Bacteria 4084
334 Ga0207667_10104020 3300025949 Bacteria 2928
335 Ga0207667_10513680 3300025949 Bacteria 1214
336 Ga0207667_10615380 3300025949 Bacteria 1094
337 Ga0207667_10925880 3300025949 Bacteria 862
338 Ga0207712_11443837 3300025961 Bacteria 616
339 Ga0207712_11675441 3300025961 Bacteria 570
340 Ga0207668_10149107 3300025972 Bacteria 1808
341 Ga0207640_10329296 3300025981 Bacteria 1219
342 Ga0207640_10481851 3300025981 Bacteria 1029
343 Ga0207677_10026580 3300026023 Bacteria 3633
344 Ga0207677_10342507 3300026023 Bacteria 1249
345 Ga0207639_11259239 3300026041 Bacteria 694
346 Ga0207678_10024418 3300026067 Bacteria 5278
347 Ga0207678_10033138 3300026067 Bacteria 4502
348 Ga0207678_10042448 3300026067 Bacteria 3939
349 Ga0207678_10218147 3300026067 Bacteria 1632
350 Ga0207708_10798507 3300026075 Bacteria 812
351 Ga0207702_10012644 3300026078 Bacteria 7028
352 Ga0207702_10091285 3300026078 Bacteria 2667
353 Ga0207702_10927355 3300026078 Bacteria 863
354 Ga0207702_10931330 3300026078 Bacteria 861
355 Ga0207648_10609350 3300026089 Bacteria 1007
356 Ga0207648_10717498 3300026089 Bacteria 927
357 Ga0207674_10093129 3300026116 Bacteria 3002
358 Ga0207674_10313537 3300026116 Bacteria 1518
359 Ga0207675_100005805 3300026118 Bacteria 11799
360 Ga0207675_100486042 3300026118 Bacteria 1228
361 Ga0207683_10001893 3300026121 Bacteria 18520
362 Ga0207683_10044329 3300026121 Bacteria 3889
363 Ga0207683_10092801 3300026121 Bacteria 2690
364 Ga0207683_10399837 3300026121 Bacteria 1264
365 Ga0207683_11144824 3300026121 Bacteria 721
366 Ga0207698_10156452 3300026142 Bacteria 1987
367 Ga0207698_10317697 3300026142 Bacteria 1457
368 Ga0209966_1061735 3300027695 Bacteria 810
369 Ga0207428_10009525 3300027907 Bacteria 8702
370 Ga0207428_10307313 3300027907 Bacteria 1173
371 Ga0268265_10381623 3300028380 Bacteria 1297
372 Ga0265326_10053814 3300028558 Bacteria 1139
373 Ga0265334_10054032 3300028573 Bacteria 1532
374 Ga0265323_10078192 3300028653 Bacteria 1121
375 Ga0265336_10029553 3300028666 Bacteria 1709
376 Ga0265338_10002322 3300028800 Bacteria 28800
377 Ga0265313_10028151 3300031595 Bacteria 2926
378 Ga0307410_10982984 3300031852 Bacteria 727
379 Ga0307415_100058349 3300032126 Bacteria 2657
380 Ga0307415_101574307 3300032126 Bacteria 631
381 Ga0373950_0013811 3300034818 Bacteria 1352
382 Ga0373940_0025487 3300035088 Bacteria 1541
383 Ga0373944_0168594 3300035089 Bacteria 780
384 Ga0373951_0176502 3300035091 Bacteria 612
385 Ga0373952_0110306 3300035092 Bacteria 736
386 Ga0373932_0029836 3300035112 Bacteria 1508
387 Ga0373939_0007286 3300035114 Bacteria 2684
388 Ga0373941_0022249 3300035115 Bacteria 1797
389 Ga0373956_0158888 3300035119 Bacteria 1065
390 Ga0373956_0366665 3300035119 Bacteria 687
391 Ga0373960_0325165 3300035121 Bacteria 577
392 Ga0373946_0147483 3300035171 Bacteria 1095
393 Ga0373946_0461299 3300035171 Bacteria 648
394 Ga0373961_0012953 3300035241 Bacteria 2095
395 Ga0373961_0088394 3300035241 Bacteria 986
396 Ga0373962_0048759 3300035242 Bacteria 1215
397 Ga0373931_0013675 3300035691 Bacteria 3956
398 Ga0373931_0375272 3300035691 Bacteria 895
399 Ga0373931_0475871 3300035691 Bacteria 802
400 Ga0373937_0271033 3300036401 Bacteria 1602
401 Ga0373937_1289809 3300036401 Bacteria 678
402 Ga0373925_0285891 3300037068 Bacteria 1329
403 Ga0395899_0003940 3300037312 Bacteria 11695
404 Ga0395899_0038534 3300037312 Bacteria 3580
405 Ga0395899_0246552 3300037312 Bacteria 1227
406 Ga0395900_0008972 3300037418 Bacteria 10254
407 Ga0395900_0040440 3300037418 Bacteria 4805
408 Ga0395900_0267728 3300037418 Bacteria 1704
409 Ga0395898_0004794 3300037466 Bacteria 14720
410 Ga0395898_0076653 3300037466 Bacteria 3228
411 Ga0395898_0180202 3300037466 Bacteria 2019
412 Ga0395905_0003398 3300037471 Bacteria 17046
413 Ga0395905_0026516 3300037471 Bacteria 5463
414 Ga0395905_0034004 3300037471 Bacteria 4788
415 Ga0395905_0089789 3300037471 Bacteria 2880
416 Ga0395905_0419567 3300037471 Bacteria 1234
417 Ga0395901_0019511 3300038443 Bacteria 6931
418 Ga0395901_0035084 3300038443 Bacteria 5183
419 Ga0395901_0134171 3300038443 Bacteria 2602
420 Ga0395901_0217770 3300038443 Bacteria 1996
421 Ga0395901_0470486 3300038443 Bacteria 1283
422 Ga0395901_0510003 3300038443 Bacteria 1223
423 Ga0395901_0805306 3300038443 Bacteria 928
424 Ga0242419_012073 3300038698 Bacteria 672
425 Ga0242420_004197 3300038996 Bacteria 2169
426 Ga0436363_1214283 3300039450 Bacteria 619
427 Ga0451789_1287347 3300041443 Bacteria 3923
428 Ga0451793_0959961 3300041452 Bacteria 2921
429 Ga0451795_1695986 3300041456 Unclassified 990
430 Ga0451798_0172093 3300041458 Bacteria 2241
431 Ga0451800_0892233 3300041459 Bacteria 634
432 Ga0451800_1228523 3300041459 Bacteria 1623
433 Ga0451802_0009112 3300041460 Bacteria 1069
434 Ga0451804_0822424 3300041463 Bacteria 807
435 Ga0451807_0873034 3300041486 Bacteria 2076
436 Ga0451807_1243051 3300041486 Bacteria 1015
437 Ga0451837_0934382 3300041494 Bacteria 2401
438 Ga0451839_0435310 3300041496 Bacteria 3454
439 Ga0451845_0799562 3300041501 Bacteria 838
440 Ga0451849_0197034 3300041505 Bacteria 2219
441 Ga0451849_0210668 3300041505 Bacteria 1225
442 Ga0451849_0377839 3300041505 Bacteria 707
443 Ga0451851_0101238 3300041507 Bacteria 3295
444 Ga0451855_0329132 3300041511 Bacteria 4496
445 Ga0451853_1110351 3300041512 Bacteria 578
446 Ga0451853_1277952 3300041512 Unclassified 2963
447 Ga0451853_2257753 3300041512 Bacteria 1151
448 Ga0451853_3681501 3300041512 Bacteria 1984
449 Ga0439448_0002328 3300042005 Bacteria 5146
450 Ga0439448_0014217 3300042005 Bacteria 2400
451 Ga0439458_0023443 3300042157 Bacteria 1439
452 Ga0439464_0066703 3300042439 Bacteria 1060
453 Ga0439460_0224906 3300042461 Bacteria 644
454 Ga0466969_0003156 3300044656 Bacteria 8774
455 Ga0466969_0109420 3300044656 Bacteria 1295
456 Ga0466965_0023080 3300044683 Bacteria 3002
457 Ga0466965_0276138 3300044683 Bacteria 906
458 Ga0466961_0002499 3300044693 Bacteria 11403
459 Ga0466961_0035788 3300044693 Bacteria 3188
460 Ga0466961_0052351 3300044693 Bacteria 2605
461 Ga0466963_0000967 3300044694 Bacteria 14752
462 Ga0466963_0001916 3300044694 Bacteria 11392
463 Ga0466963_0002066 3300044694 Bacteria 11078
464 Ga0466963_0002914 3300044694 Bacteria 9662
465 Ga0466963_0007451 3300044694 Bacteria 6524
466 Ga0466963_0025454 3300044694 Bacteria 3774
467 Ga0466963_0074887 3300044694 Bacteria 2284
468 Ga0466963_0212899 3300044694 Unclassified 1352
469 Ga0466963_0711874 3300044694 Bacteria 708
470 Ga0466964_0007483 3300044706 Bacteria 4087
471 Ga0466964_0009665 3300044706 Bacteria 3634
472 Ga0466964_0011591 3300044706 Bacteria 3332
473 Ga0466964_0050313 3300044706 Bacteria 1708
474 Ga0466971_0001732 3300044719 Bacteria 9241
475 Ga0466971_0003722 3300044719 Bacteria 6526
476 Ga0466971_0076988 3300044719 Unclassified 1518
477 Ga0466968_0000973 3300044735 Bacteria 10068
478 Ga0466968_0014631 3300044735 Bacteria 3102
479 Ga0466968_0028688 3300044735 Bacteria 2296
480 Ga0466970_0003744 3300044765 Bacteria 7436
481 Ga0466970_0006853 3300044765 Bacteria 5704
482 Ga0466970_0170481 3300044765 Bacteria 1206
483 Ga0466970_0399732 3300044765 Bacteria 784
484 Ga0466957_0002205 3300044842 Bacteria 10443
485 Ga0466957_0003297 3300044842 Bacteria 8839
486 Ga0466957_0010927 3300044842 Bacteria 5221
487 Ga0466957_0014965 3300044842 Bacteria 4527
488 Ga0466957_0016000 3300044842 Bacteria 4383
489 Ga0466957_0101292 3300044842 Bacteria 1816
490 Ga0466957_0114586 3300044842 Bacteria 1713
491 Ga0466957_0133652 3300044842 Bacteria 1592
492 Ga0466957_0220612 3300044842 Bacteria 1252
493 Ga0466957_0443931 3300044842 Bacteria 893
494 Ga0466959_0004476 3300045049 Bacteria 9361
495 Ga0466959_0255879 3300045049 Bacteria 1207
496 Ga0466959_0289777 3300045049 Bacteria 1122
497 Ga0451576_0020418 3300045051 Bacteria 7216
498 Ga0466958_0000388 3300045836 Bacteria 17947
499 Ga0466958_0001895 3300045836 Bacteria 10231
500 Ga0466958_0034221 3300045836 Bacteria 3030
501 Ga0466958_0143428 3300045836 Bacteria 1504
502 Ga0466958_0490145 3300045836 Bacteria 797
503 Ga0466967_0000415 3300045976 Bacteria 20221
504 Ga0466967_0008881 3300045976 Bacteria 7411
505 Ga0466967_0012784 3300045976 Bacteria 6448
506 Ga0466967_0019191 3300045976 Bacteria 5491
507 Ga0466967_0021002 3300045976 Bacteria 5290
508 Ga0466967_0034225 3300045976 Bacteria 4310
509 Ga0466967_0048698 3300045976 Bacteria 3702
510 Ga0466967_0049779 3300045976 Bacteria 3666
511 Ga0466967_0053293 3300045976 Bacteria 3554
512 Ga0466967_0064662 3300045976 Bacteria 3253
513 Ga0466967_0068369 3300045976 Bacteria 3171
514 Ga0466967_0070623 3300045976 Bacteria 3124
515 Ga0466967_0125738 3300045976 Bacteria 2375
516 Ga0466967_0131121 3300045976 Bacteria 2327
517 Ga0466967_0152484 3300045976 Bacteria 2161
518 Ga0466967_0202873 3300045976 Bacteria 1879
519 Ga0466967_0249947 3300045976 Bacteria 1693
520 Ga0466967_0577361 3300045976 Bacteria 1108
521 Ga0495592_0167927 3300046454 Bacteria 1505
522 Ga0495592_0788318 3300046454 Bacteria 565
523 Ga0495603_0040943 3300046455 Bacteria 2772
524 Ga0495603_0080665 3300046455 Bacteria 1906
525 Ga0495603_0586837 3300046455 Bacteria 638
526 Ga0495629_0083583 3300046459 Bacteria 2228
527 Ga0495629_0297823 3300046459 Bacteria 1105
528 Ga0495629_0547325 3300046459 Bacteria 777
529 Ga0495641_0030700 3300046461 Bacteria 2574
530 Ga0495641_0054430 3300046461 Bacteria 1818
531 Ga0495651_0014314 3300046462 Bacteria 6131
532 Ga0495651_0114422 3300046462 Bacteria 1990
533 Ga0495651_0762207 3300046462 Bacteria 599
534 Ga0495653_0072957 3300046463 Bacteria 2562
535 Ga0495653_0103426 3300046463 Bacteria 2059
536 Ga0495653_0105682 3300046463 Bacteria 2032
537 Ga0495653_0146573 3300046463 Bacteria 1653
538 Ga0495639_0107200 3300046475 Bacteria 1323
539 Ga0495639_0314966 3300046475 Bacteria 782
540 Ga0495664_0078355 3300046477 Bacteria 1979
541 Ga0495664_0095266 3300046477 Bacteria 1792
542 Ga0495585_0409812 3300046492 Unclassified 652
543 Ga0495608_0055148 3300046511 Bacteria 2626
544 Ga0495608_0061415 3300046511 Bacteria 2471
545 Ga0495608_0076497 3300046511 Bacteria 2180
546 Ga0495618_0054489 3300046514 Unclassified 2531
547 Ga0495618_0081680 3300046514 Bacteria 2064
548 Ga0495628_0022244 3300046516 Bacteria 5210
549 Ga0495628_0037212 3300046516 Bacteria 3902
550 Ga0495630_0092134 3300046517 Bacteria 2291
551 Ga0495630_0285036 3300046517 Bacteria 1262
552 Ga0495666_0351465 3300046526 Bacteria 664
553 Ga0495652_0062473 3300046529 Bacteria 3140
554 Ga0495652_0274357 3300046529 Bacteria 1238
555 Ga0495652_0349530 3300046529 Bacteria 1060
556 Ga0495665_0100716 3300046531 Bacteria 1516
557 Ga0495665_0182359 3300046531 Bacteria 1091
558 Ga0495640_0006157 3300046533 Bacteria 9511
559 Ga0495640_0060870 3300046533 Bacteria 2567
560 Ga0495586_0372117 3300046535 Bacteria 821
561 Ga0495586_0411244 3300046535 Bacteria 779
562 Ga0495587_0031224 3300046536 Bacteria 3227
563 Ga0495587_0165093 3300046536 Bacteria 1259
564 Ga0495645_0134537 3300046543 Bacteria 1730
565 Ga0495667_0016094 3300046559 Bacteria 5055
566 Ga0495667_0499064 3300046559 Bacteria 762
567 Ga0495634_0086502 3300046642 Bacteria 2041
568 Ga0495634_0546602 3300046642 Bacteria 676
569 Ga0495635_0034738 3300046663 Bacteria 3497
570 Ga0495635_0123680 3300046663 Bacteria 1764
571 Ga0495635_0149942 3300046663 Bacteria 1587
572 Ga0495635_0179835 3300046663 Bacteria 1438
573 Ga0495635_0364284 3300046663 Bacteria 963
574 Ga0495588_0099654 3300046674 Bacteria 1526
575 Ga0495657_0064427 3300046675 Bacteria 2414
576 Ga0495657_0657432 3300046675 Bacteria 604
577 Ga0495599_0286906 3300046678 Bacteria 996
578 Ga0495646_0078719 3300046680 Bacteria 1926
579 Ga0495613_0011779 3300046689 Bacteria 6500
580 Ga0495613_0354413 3300046689 Bacteria 1007
581 Ga0495600_0014983 3300046809 Bacteria 4896
582 Ga0495600_0053197 3300046809 Bacteria 2644
583 Ga0495600_0183412 3300046809 Bacteria 1348
584 Ga0495581_0173254 3300047315 Bacteria 1262
585 Ga0495604_0073343 3300047317 Bacteria 2584
586 Ga0495604_0328935 3300047317 Bacteria 1020
587 Ga0495604_0481367 3300047317 Bacteria 807
588 Ga0495674_0021777 3300047319 Bacteria 5922
589 Ga0495674_0237776 3300047319 Bacteria 1502
590 Ga0495674_0335976 3300047319 Bacteria 1228
591 Ga0495674_0442308 3300047319 Unclassified 1045
592 Ga0495676_0037681 3300047321 Bacteria 4022
593 Ga0495676_0065277 3300047321 Bacteria 2826
594 Ga0495676_0373456 3300047321 Bacteria 950
595 Ga0495680_0005738 3300047322 Bacteria 11624
596 Ga0495680_0006633 3300047322 Bacteria 10715
597 Ga0495675_0412946 3300047444 Bacteria 785
598 Ga0495684_0011194 3300047471 Bacteria 6934
599 Ga0495684_0087522 3300047471 Bacteria 2361
600 Ga0495684_0348480 3300047471 Bacteria 1052
601 Ga0495602_0071950 3300048088 Bacteria 2951
602 Ga0495602_0646127 3300048088 Bacteria 723
603 Ga0495602_0838117 3300048088 Bacteria 615
604 Ga0496100_0000551 3300048903 Bacteria 17778
605 Ga0496100_0024122 3300048903 Bacteria 3705
606 Ga0496100_0045349 3300048903 Bacteria 2821
607 Ga0496100_0047004 3300048903 Bacteria 2779
608 Ga0496100_0312041 3300048903 Bacteria 1179
609 Ga0496100_0416857 3300048903 Bacteria 1025
610 Ga0496100_0465695 3300048903 Bacteria 970
611 Ga0496101_0002659 3300048904 Bacteria 10971
612 Ga0496101_0040840 3300048904 Bacteria 3305
613 Ga0496101_0060906 3300048904 Bacteria 2740
614 Ga0496101_0088798 3300048904 Bacteria 2296
615 Ga0496101_0091560 3300048904 Bacteria 2263
616 Ga0496101_0378160 3300048904 Bacteria 1114
617 Ga0496102_0004502 3300048905 Bacteria 11769
618 Ga0496102_0642074 3300048905 Bacteria 985
619 Ga0496103_0009721 3300048906 Bacteria 5693
620 Ga0496103_0167913 3300048906 Bacteria 1408
621 Ga0496103_0257029 3300048906 Bacteria 1124
622 Ga0496103_0433183 3300048906 Bacteria 844
623 Ga0496103_0735296 3300048906 Bacteria 624
624 Ga0496104_0001012 3300048907 Bacteria 24085
625 Ga0496104_0001878 3300048907 Bacteria 18187
626 Ga0496104_0003998 3300048907 Bacteria 12770
627 Ga0496104_0155553 3300048907 Bacteria 2194
628 Ga0496104_0242588 3300048907 Bacteria 1714
629 Ga0496104_0440738 3300048907 Bacteria 1214
630 Ga0496104_0895628 3300048907 Bacteria 792
631 Ga0496105_0001258 3300048908 Bacteria 17706
632 Ga0496105_0001260 3300048908 Bacteria 17703
633 Ga0496105_0019078 3300048908 Bacteria 5527
634 Ga0496106_0000850 3300048909 Bacteria 22149
635 Ga0496106_1193166 3300048909 Unclassified 594
636 Ga0496107_0014755 3300048910 Bacteria 5471
637 Ga0496107_0028819 3300048910 Bacteria 3947
638 Ga0496107_0094439 3300048910 Bacteria 2188
639 Ga0496107_0155365 3300048910 Bacteria 1694
640 Ga0496107_0275793 3300048910 Bacteria 1251
641 Ga0496107_0465802 3300048910 Unclassified 938
642 Ga0496108_0224011 3300048911 Bacteria 1634
643 Ga0496108_0339842 3300048911 Bacteria 1310
644 Ga0496109_0003276 3300048912 Bacteria 13512
645 Ga0496109_0659703 3300048912 Bacteria 983
646 Ga0496110_0001668 3300048913 Bacteria 16283
647 Ga0496110_0226157 3300048913 Bacteria 1701
648 Ga0496110_0458211 3300048913 Bacteria 1162
649 Ga0496110_0465342 3300048913 Bacteria 1152
650 Ga0496110_1019295 3300048913 Bacteria 735
651 Ga0496110_1200642 3300048913 Bacteria 667
652 Ga0496111_0088837 3300048914 Bacteria 2263
653 Ga0496111_0105236 3300048914 Bacteria 2076
654 Ga0496111_0461399 3300048914 Bacteria 937
655 Ga0496112_0587349 3300048915 Bacteria 1046
656 Ga0496112_0676426 3300048915 Bacteria 961
657 Ga0496113_0120097 3300048916 Bacteria 2054
658 Ga0496114_0002677 3300048917 Bacteria 13602
659 Ga0496114_0013018 3300048917 Bacteria 6665
660 Ga0496114_0076504 3300048917 Bacteria 2820
661 Ga0496114_0365641 3300048917 Bacteria 1276
662 Ga0496114_0578149 3300048917 Bacteria 991
663 Ga0496114_1071310 3300048917 Bacteria 690
664 Ga0496114_1265006 3300048917 Bacteria 624
665 Ga0496115_0000914 3300048918 Bacteria 21435
666 Ga0496115_0052546 3300048918 Bacteria 3269
667 Ga0496115_0080400 3300048918 Bacteria 2654
668 Ga0496115_0134503 3300048918 Bacteria 2038
669 Ga0496115_0278741 3300048918 Bacteria 1373
670 Ga0501067_0033096 3300049583 Bacteria 2868
671 Ga0501067_0155461 3300049583 Bacteria 1274
672 Ga0501067_0216540 3300049583 Bacteria 1066
673 Ga0501069_0000709 3300049585 Bacteria 15565
674 Ga0501069_0002820 3300049585 Bacteria 8894
675 Ga0501069_0224544 3300049585 Bacteria 1092
676 Ga0501070_0406132 3300049586 Bacteria 1101
677 nmdc:mga05p37_333843_c1 3300050507 Bacteria 1790
678 nmdc:mga05p37_394784_c1 3300050507 Bacteria 1617
679 nmdc:mga05p37_849550_c1 3300050507 Bacteria 991
680 nmdc:mga06r32_9681_c1 3300050510 Bacteria 8706
681 nmdc:mga08y16_101094_c1 3300050511 Bacteria 3002
682 nmdc:mga08y16_1103198_c1 3300050511 Bacteria 768
683 nmdc:mga08y16_1171034_c1 3300050511 Bacteria 741
684 nmdc:mga08y16_48530_c1 3300050511 Bacteria 4444
685 nmdc:mga08y16_567250_c1 3300050511 Bacteria 1147
686 nmdc:mga0n895_39190_c1 3300050512 Bacteria 4596
687 nmdc:mga0n895_81283_c1 3300050512 Bacteria 3229
688 nmdc:mga0n895_87578_c1 3300050512 Bacteria 3112
689 nmdc:mga0rr50_240444_c1 3300050513 Bacteria 1501
690 nmdc:mga0rr50_28380_c1 3300050513 Bacteria 3934
691 nmdc:mga0rr50_30439_c1 3300050513 Bacteria 3821
692 nmdc:mga08x19_25094_c1 3300050514 Bacteria 3711
693 nmdc:mga08x19_281014_c1 3300050514 Bacteria 1153
694 nmdc:mga08x19_31230_c1 3300050514 Bacteria 3350
695 nmdc:mga08x19_869844_c1 3300050514 Bacteria 640
696 nmdc:mga0a205_241530_c1 3300050515 Bacteria 1687
697 nmdc:mga0a205_44360_c1 3300050515 Bacteria 4286
698 nmdc:mga0a205_66043_c1 3300050515 Bacteria 3496
699 nmdc:mga0a205_94856_c1 3300050515 Bacteria 2883
700 Ga0495601_0105137 3300053077 Bacteria 1825
701 Ga0495601_0107995 3300053077 Bacteria 1800
702 Ga0495595_0017394 3300053084 Bacteria 3093
703 Ga0495595_0030829 3300053084 Bacteria 2407
704 Ga0495595_0081895 3300053084 Bacteria 1538
705 Ga0495619_0002157 3300053085 Bacteria 13040
706 Ga0466962_0003041 3300061719 Bacteria 7999
707 Ga0466962_0012241 3300061719 Bacteria 4123
708 Ga0466962_0017152 3300061719 Bacteria 3489
709 Ga0466962_0307799 3300061719 Bacteria 784
710 Ga0466962_0341139 3300061719 Bacteria 745
711 Ga0530510_0025384 3300061734 Bacteria 4236
712 Ga0530510_0054449 3300061734 Bacteria 2891
713 2644444440 2643221679 Bacteria 3839507
714 Ga0070664_102043531
715 Ga0070658_10014512
716 Ga0070658_10093470
717 Ga0070676_10321515
718 Ga0070676_11129984
719 Ga0070683_100006996
720 Ga0070683_100009673
721 Ga0070683_100045561
722 Ga0070683_100092201
723 Ga0070683_100092747
724 Ga0070680_100003945
725 Ga0070680_100010659
726 Ga0070680_100286268
727 Ga0070680_100389059
728 Ga0070680_100795896
729 Ga0070680_101051182
730 Ga0070682_100008440
731 Ga0070682_100106910
732 Ga0070682_100944854
733 Ga0068868_100017078
734 Ga0068868_100121269
735 Ga0070660_100004001
736 Ga0070660_100004482
737 Ga0070660_100062970
738 Ga0070691_10154629
739 Ga0070691_10570766
740 Ga0070661_100037032
741 Ga0070661_100215079
742 Ga0070661_100230218
743 Ga0070692_10495041
744 Ga0070668_100965531
745 Ga0070671_100288737
746 Ga0070674_101160106
747 Ga0070673_100660117
748 Ga0070673_101033814
749 Ga0070673_101657349
750 Ga0070659_100003970
751 Ga0070659_100091904
752 Ga0070709_10108130
753 Ga0070709_10164254
754 Ga0070709_10247131
755 Ga0070714_100088494
756 Ga0070714_100176807
757 Ga0070714_100398631
758 Ga0070714_100547519
759 Ga0070713_100099261
760 Ga0070713_100184748
761 Ga0070713_100408306
762 Ga0070713_100492218
763 Ga0070713_100788068
764 Ga0070710_10033470
765 Ga0070710_10485766
766 Ga0070701_10184685
767 Ga0070711_101737263
768 Ga0070705_100366666
769 Ga0070694_100076176
770 Ga0070663_100016306
771 Ga0070663_100042339
772 Ga0070663_100148827
773 Ga0070678_100033770
774 Ga0070678_100119005
775 Ga0070678_101493313
776 Ga0070662_100015266
777 Ga0070662_101415941
778 Ga0070681_10006108
779 Ga0070681_10060200
780 Ga0070681_10188297
781 Ga0070681_10322240
782 Ga0070681_10498685
783 Ga0070681_10499402
784 Ga0070681_11304774
785 Ga0070685_10548208
786 Ga0070707_100363869
787 Ga0070698_100369580
788 Ga0070679_100012955
789 Ga0070679_100067988
790 Ga0070679_100077395
791 Ga0070679_100239922
792 Ga0070679_100293235
793 Ga0070684_100001069
794 Ga0070684_100038102
795 Ga0070684_100152054
796 Ga0070684_100159192
797 Ga0070684_100465010
798 Ga0070684_100757674
799 Ga0068853_100072322
800 Ga0068853_100128426
801 Ga0068853_100262375
802 Ga0070672_100477663
803 Ga0070686_100031396
804 Ga0070686_100432224
805 Ga0070695_100290456
806 Ga0070696_100015499
807 Ga0070696_100312300
808 Ga0070693_100000663
809 Ga0070693_100045928
810 Ga0070704_100306479
811 Ga0070704_100444752
812 Ga0068855_100017357
813 Ga0068855_100043436
814 Ga0068855_100046329
815 Ga0068855_100047741
816 Ga0068855_100138986
817 Ga0068855_100170133
818 Ga0068855_100234007
819 Ga0068855_100256959
820 Ga0068855_100884270
821 Ga0068855_101986103
822 Ga0070664_100727173
823 Ga0068857_100017763
824 Ga0068857_101623643
825 Ga0068854_100635267
826 Ga0068854_101250024
827 Ga0068856_100008004
828 Ga0068856_100022318
829 Ga0068856_100175528
830 Ga0068856_100336184
831 Ga0068856_100435918
832 Ga0068856_101361568
833 Ga0070702_100456576
834 Ga0068852_100084669
835 Ga0068852_100113572
836 Ga0068864_101342918
837 Ga0068866_10255668
838 Ga0068866_10985191
839 Ga0068861_100045992
840 Ga0068861_100528485
841 Ga0068862_101623495
842 Ga0081455_10004689
843 Ga0081455_10005621
844 Ga0081455_10018531
845 Ga0081540_1003817
846 Ga0081540_1019178
847 Ga0070717_10003529
848 Ga0070717_10070213
849 Ga0070717_10585305
850 Ga0075364_10295936
851 Ga0075432_10002751
852 Ga0075432_10021437
853 Ga0070715_10030750
854 Ga0070716_100033324
855 Ga0070712_100029483
856 Ga0070712_100071640
857 Ga0097621_100022976
858 Ga0097621_100119449
859 Ga0068871_100024401
860 Ga0075428_100057745
861 Ga0075431_100037465
862 Ga0075431_101623691
863 Ga0075433_10053512
864 Ga0075433_10118240
865 Ga0075434_100029588
866 Ga0075434_100078020
867 Ga0075434_100139759
868 Ga0075434_100221866
869 Ga0075434_101034398
870 Ga0068865_101173016
871 Ga0075436_100015472
872 Ga0075436_100061303
873 Ga0075436_100264282
874 Ga0075435_100013309
875 Ga0075435_100041473
876 Ga0075435_100071489
877 Ga0075435_100712198
878 Ga0075435_101304367
879 Ga0105240_10053057
880 Ga0105240_10128606
881 Ga0105240_10132214
882 Ga0111539_10113435
883 Ga0111539_10150273
884 Ga0111539_10751950
885 Ga0111539_10899693
886 Ga0111539_11110629
887 Ga0105245_10052545
888 Ga0105245_10077292
889 Ga0105245_10086271
890 Ga0105245_10129502
891 Ga0105245_10130399
892 Ga0105245_10842265
893 Ga0105245_10998333
894 Ga0105245_11053328
895 Ga0105245_11726522
896 Ga0114129_10393875
897 Ga0114129_10693616
898 Ga0114129_11252413
899 Ga0105243_10105017
900 Ga0105243_10121474
901 Ga0105243_10862063
902 Ga0105241_10345984
903 Ga0105241_10571659
904 Ga0105242_10011950
905 Ga0105248_10240018
906 Ga0105237_10134510
907 Ga0105237_10196844
908 Ga0105237_10370826
909 Ga0105238_10131668
910 Ga0105238_10523461
911 Ga0105238_11242268
912 Ga0105249_10003836
913 Ga0105249_10282305
914 Ga0105249_11699973
915 Ga0105239_10020582
916 Ga0105239_10062848
917 Ga0105239_10120284
918 Ga0105239_10572159
919 Ga0105239_10920051
920 Ga0105246_10977801
921 Ga0105246_11028759
922 Ga0105246_11372195
923 Ga0157344_1008004
924 Ga0157326_1024070
925 Ga0157338_1007365
926 Ga0157373_10074926
927 Ga0157373_10098482
928 Ga0157373_10489664
929 Ga0157373_11045858
930 Ga0157370_10017006
931 Ga0157370_10042241
932 Ga0157370_10342609
933 Ga0157370_10366497
934 Ga0157369_10008579
935 Ga0157369_10023587
936 Ga0157369_10469577
937 Ga0157374_10023750
938 Ga0157374_10914494
939 Ga0163162_10016329
940 Ga0163162_10067284
941 Ga0157372_10125387
942 Ga0157372_10154714
943 Ga0157372_10213232
944 Ga0157372_11282190
945 Ga0157375_10505317
946 Ga0157375_10711262
947 Ga0157375_10948440
948 Ga0163163_10293682
949 Ga0163163_10840916
950 Ga0182008_10037277
951 Ga0182008_10150935
952 Ga0157377_10129669
953 Ga0157377_10171890
954 Ga0157376_10032012
955 Ga0157376_10487049
956 Ga0157376_10887146
957 Ga0157376_11269871
958 Ga0182007_10030251
959 Ga0163161_10026845
960 Ga0163161_10145663
961 Ga0197907_10004119
962 Ga0197907_10785707
963 Ga0197907_11508900
964 Ga0206356_10189796
965 Ga0206354_11013207
966 Ga0206353_10295879
967 Ga0206353_11088500
968 Ga0206353_11656187
969 Ga0224712_10066300
970 Ga0224712_10088063
971 Ga0224712_10216377
972 Ga0207692_10107946
973 Ga0207692_10222205
974 Ga0207642_10493794
975 Ga0207685_10057805
976 Ga0207699_10100618
977 Ga0207699_10841276
978 Ga0207705_10032309
979 Ga0207705_10433932
980 Ga0207705_10739657
981 Ga0207654_10111270
982 Ga0207654_10708684
983 Ga0207707_10006694
984 Ga0207707_10016804
985 Ga0207707_10017890
986 Ga0207707_10076686
987 Ga0207707_10099367
988 Ga0207707_10119248
989 Ga0207707_10956161
990 Ga0207671_10281050
991 Ga0207671_10404210
992 Ga0207693_10018333
993 Ga0207693_10069596
994 Ga0207693_10292443
995 Ga0207693_10560085
996 Ga0207663_10086418
997 Ga0207663_10122134
998 Ga0207663_10642241
999 Ga0207660_10187641
1000 Ga0207660_10230236
1001 Ga0207660_10315973
1002 Ga0207660_10555820
1003 Ga0207660_10847083
1004 Ga0207657_10000536
1005 Ga0207657_10000610
1006 Ga0207657_10002980
1007 Ga0207649_10777610
1008 Ga0207652_10010087
1009 Ga0207652_10013102
1010 Ga0207652_10049790
1011 Ga0207652_10158465
1012 Ga0207652_10635270
1013 Ga0207681_11187847
1014 Ga0207694_10027861
1015 Ga0207694_10258762
1016 Ga0207687_10066239
1017 Ga0207687_10217537
1018 Ga0207687_10243718
1019 Ga0207687_10486752
1020 Ga0207687_11380733
1021 Ga0207700_10586469
1022 Ga0207700_10634759
1023 Ga0207664_10014288
1024 Ga0207664_10138888
1025 Ga0207664_10168772
1026 Ga0207664_10172958
1027 Ga0207664_10210528
1028 Ga0207664_10356324
1029 Ga0207664_11329259
1030 Ga0207644_10231971
1031 Ga0207690_10304035
1032 Ga0207706_10012045
1033 Ga0207706_10083447
1034 Ga0207709_10036855
1035 Ga0207704_10377410
1036 Ga0207665_10175013
1037 Ga0207665_10465252
1038 Ga0207691_10361764
1039 Ga0207711_10803277
1040 Ga0207661_10058105
1041 Ga0207661_10354414
1042 Ga0207661_10378220
1043 Ga0207661_10615042
1044 Ga0207679_10027368
1045 Ga0207667_10026127
1046 Ga0207667_10057447
1047 Ga0207667_10104020
1048 Ga0207667_10513680
1049 Ga0207667_10615380
1050 Ga0207667_10925880
1051 Ga0207712_11443837
1052 Ga0207712_11675441
1053 Ga0207668_10149107
1054 Ga0207640_10329296
1055 Ga0207640_10481851
1056 Ga0207677_10026580
1057 Ga0207677_10342507
1058 Ga0207639_11259239
1059 Ga0207678_10024418
1060 Ga0207678_10033138
1061 Ga0207678_10042448
1062 Ga0207678_10218147
1063 Ga0207708_10798507
1064 Ga0207702_10012644
1065 Ga0207702_10091285
1066 Ga0207702_10927355
1067 Ga0207702_10931330
1068 Ga0207648_10609350
1069 Ga0207648_10717498
1070 Ga0207674_10093129
1071 Ga0207674_10313537
1072 Ga0207675_100005805
1073 Ga0207675_100486042
1074 Ga0207683_10001893
1075 Ga0207683_10044329
1076 Ga0207683_10092801
1077 Ga0207683_10399837
1078 Ga0207683_11144824
1079 Ga0207698_10156452
1080 Ga0207698_10317697
1081 Ga0209966_1061735
1082 Ga0207428_10009525
1083 Ga0207428_10307313
1084 Ga0268265_10381623
1085 Ga0265326_10053814
1086 Ga0265334_10054032
1087 Ga0265323_10078192
1088 Ga0265336_10029553
1089 Ga0265338_10002322
1090 Ga0265313_10028151
1091 Ga0307410_10982984
1092 Ga0307415_100058349
1093 Ga0307415_101574307
1094 Ga0373950_0013811
1095 Ga0373940_0025487
1096 Ga0373944_0168594
1097 Ga0373951_0176502
1098 Ga0373952_0110306
1099 Ga0373932_0029836
1100 Ga0373939_0007286
1101 Ga0373941_0022249
1102 Ga0373956_0158888
1103 Ga0373956_0366665
1104 Ga0373960_0325165
1105 Ga0373946_0147483
1106 Ga0373946_0461299
1107 Ga0373961_0012953
1108 Ga0373961_0088394
1109 Ga0373962_0048759
1110 Ga0373931_0013675
1111 Ga0373931_0375272
1112 Ga0373931_0475871
1113 Ga0373937_0271033
1114 Ga0373937_1289809
1115 Ga0373925_0285891
1116 Ga0395899_0003940
1117 Ga0395899_0038534
1118 Ga0395899_0246552
1119 Ga0395900_0008972
1120 Ga0395900_0040440
1121 Ga0395900_0267728
1122 Ga0395898_0004794
1123 Ga0395898_0076653
1124 Ga0395898_0180202
1125 Ga0395905_0003398
1126 Ga0395905_0026516
1127 Ga0395905_0034004
1128 Ga0395905_0089789
1129 Ga0395905_0419567
1130 Ga0395901_0019511
1131 Ga0395901_0035084
1132 Ga0395901_0134171
1133 Ga0395901_0217770
1134 Ga0395901_0470486
1135 Ga0395901_0510003
1136 Ga0395901_0805306
1137 Ga0242419_012073
1138 Ga0242420_004197
1139 Ga0436363_1214283
1140 Ga0451789_1287347
1141 Ga0451793_0959961
1142 Ga0451795_1695986
1143 Ga0451798_0172093
1144 Ga0451800_0892233
1145 Ga0451800_1228523
1146 Ga0451802_0009112
1147 Ga0451804_0822424
1148 Ga0451807_0873034
1149 Ga0451807_1243051
1150 Ga0451837_0934382
1151 Ga0451839_0435310
1152 Ga0451845_0799562
1153 Ga0451849_0197034
1154 Ga0451849_0210668
1155 Ga0451849_0377839
1156 Ga0451851_0101238
1157 Ga0451855_0329132
1158 Ga0451853_1110351
1159 Ga0451853_1277952
1160 Ga0451853_2257753
1161 Ga0451853_3681501
1162 Ga0439448_0002328
1163 Ga0439448_0014217
1164 Ga0439458_0023443
1165 Ga0439464_0066703
1166 Ga0439460_0224906
1167 Ga0466969_0003156
1168 Ga0466969_0109420
1169 Ga0466965_0023080
1170 Ga0466965_0276138
1171 Ga0466961_0002499
1172 Ga0466961_0035788
1173 Ga0466961_0052351
1174 Ga0466963_0000967
1175 Ga0466963_0001916
1176 Ga0466963_0002066
1177 Ga0466963_0002914
1178 Ga0466963_0007451
1179 Ga0466963_0025454
1180 Ga0466963_0074887
1181 Ga0466963_0212899
1182 Ga0466963_0711874
1183 Ga0466964_0007483
1184 Ga0466964_0009665
1185 Ga0466964_0011591
1186 Ga0466964_0050313
1187 Ga0466971_0001732
1188 Ga0466971_0003722
1189 Ga0466971_0076988
1190 Ga0466968_0000973
1191 Ga0466968_0014631
1192 Ga0466968_0028688
1193 Ga0466970_0003744
1194 Ga0466970_0006853
1195 Ga0466970_0170481
1196 Ga0466970_0399732
1197 Ga0466957_0002205
1198 Ga0466957_0003297
1199 Ga0466957_0010927
1200 Ga0466957_0014965
1201 Ga0466957_0016000
1202 Ga0466957_0101292
1203 Ga0466957_0114586
1204 Ga0466957_0133652
1205 Ga0466957_0220612
1206 Ga0466957_0443931
1207 Ga0466959_0004476
1208 Ga0466959_0255879
1209 Ga0466959_0289777
1210 Ga0451576_0020418
1211 Ga0466958_0000388
1212 Ga0466958_0001895
1213 Ga0466958_0034221
1214 Ga0466958_0143428
1215 Ga0466958_0490145
1216 Ga0466967_0000415
1217 Ga0466967_0008881
1218 Ga0466967_0012784
1219 Ga0466967_0019191
1220 Ga0466967_0021002
1221 Ga0466967_0034225
1222 Ga0466967_0048698
1223 Ga0466967_0049779
1224 Ga0466967_0053293
1225 Ga0466967_0064662
1226 Ga0466967_0068369
1227 Ga0466967_0070623
1228 Ga0466967_0125738
1229 Ga0466967_0131121
1230 Ga0466967_0152484
1231 Ga0466967_0202873
1232 Ga0466967_0249947
1233 Ga0466967_0577361
1234 Ga0495592_0167927
1235 Ga0495592_0788318
1236 Ga0495603_0040943
1237 Ga0495603_0080665
1238 Ga0495603_0586837
1239 Ga0495629_0083583
1240 Ga0495629_0297823
1241 Ga0495629_0547325
1242 Ga0495641_0030700
1243 Ga0495641_0054430
1244 Ga0495651_0014314
1245 Ga0495651_0114422
1246 Ga0495651_0762207
1247 Ga0495653_0072957
1248 Ga0495653_0103426
1249 Ga0495653_0105682
1250 Ga0495653_0146573
1251 Ga0495639_0107200
1252 Ga0495639_0314966
1253 Ga0495664_0078355
1254 Ga0495664_0095266
1255 Ga0495585_0409812
1256 Ga0495608_0055148
1257 Ga0495608_0061415
1258 Ga0495608_0076497
1259 Ga0495618_0054489
1260 Ga0495618_0081680
1261 Ga0495628_0022244
1262 Ga0495628_0037212
1263 Ga0495630_0092134
1264 Ga0495630_0285036
1265 Ga0495666_0351465
1266 Ga0495652_0062473
1267 Ga0495652_0274357
1268 Ga0495652_0349530
1269 Ga0495665_0100716
1270 Ga0495665_0182359
1271 Ga0495640_0006157
1272 Ga0495640_0060870
1273 Ga0495586_0372117
1274 Ga0495586_0411244
1275 Ga0495587_0031224
1276 Ga0495587_0165093
1277 Ga0495645_0134537
1278 Ga0495667_0016094
1279 Ga0495667_0499064
1280 Ga0495634_0086502
1281 Ga0495634_0546602
1282 Ga0495635_0034738
1283 Ga0495635_0123680
1284 Ga0495635_0149942
1285 Ga0495635_0179835
1286 Ga0495635_0364284
1287 Ga0495588_0099654
1288 Ga0495657_0064427
1289 Ga0495657_0657432
1290 Ga0495599_0286906
1291 Ga0495646_0078719
1292 Ga0495613_0011779
1293 Ga0495613_0354413
1294 Ga0495600_0014983
1295 Ga0495600_0053197
1296 Ga0495600_0183412
1297 Ga0495581_0173254
1298 Ga0495604_0073343
1299 Ga0495604_0328935
1300 Ga0495604_0481367
1301 Ga0495674_0021777
1302 Ga0495674_0237776
1303 Ga0495674_0335976
1304 Ga0495674_0442308
1305 Ga0495676_0037681
1306 Ga0495676_0065277
1307 Ga0495676_0373456
1308 Ga0495680_0005738
1309 Ga0495680_0006633
1310 Ga0495675_0412946
1311 Ga0495684_0011194
1312 Ga0495684_0087522
1313 Ga0495684_0348480
1314 Ga0495602_0071950
1315 Ga0495602_0646127
1316 Ga0495602_0838117
1317 Ga0496100_0000551
1318 Ga0496100_0024122
1319 Ga0496100_0045349
1320 Ga0496100_0047004
1321 Ga0496100_0312041
1322 Ga0496100_0416857
1323 Ga0496100_0465695
1324 Ga0496101_0002659
1325 Ga0496101_0040840
1326 Ga0496101_0060906
1327 Ga0496101_0088798
1328 Ga0496101_0091560
1329 Ga0496101_0378160
1330 Ga0496102_0004502
1331 Ga0496102_0642074
1332 Ga0496103_0009721
1333 Ga0496103_0167913
1334 Ga0496103_0257029
1335 Ga0496103_0433183
1336 Ga0496103_0735296
1337 Ga0496104_0001012
1338 Ga0496104_0001878
1339 Ga0496104_0003998
1340 Ga0496104_0155553
1341 Ga0496104_0242588
1342 Ga0496104_0440738
1343 Ga0496104_0895628
1344 Ga0496105_0001258
1345 Ga0496105_0001260
1346 Ga0496105_0019078
1347 Ga0496106_0000850
1348 Ga0496106_1193166
1349 Ga0496107_0014755
1350 Ga0496107_0028819
1351 Ga0496107_0094439
1352 Ga0496107_0155365
1353 Ga0496107_0275793
1354 Ga0496107_0465802
1355 Ga0496108_0224011
1356 Ga0496108_0339842
1357 Ga0496109_0003276
1358 Ga0496109_0659703
1359 Ga0496110_0001668
1360 Ga0496110_0226157
1361 Ga0496110_0458211
1362 Ga0496110_0465342
1363 Ga0496110_1019295
1364 Ga0496110_1200642
1365 Ga0496111_0088837
1366 Ga0496111_0105236
1367 Ga0496111_0461399
1368 Ga0496112_0587349
1369 Ga0496112_0676426
1370 Ga0496113_0120097
1371 Ga0496114_0002677
1372 Ga0496114_0013018
1373 Ga0496114_0076504
1374 Ga0496114_0365641
1375 Ga0496114_0578149
1376 Ga0496114_1071310
1377 Ga0496114_1265006
1378 Ga0496115_0000914
1379 Ga0496115_0052546
1380 Ga0496115_0080400
1381 Ga0496115_0134503
1382 Ga0496115_0278741
1383 Ga0501067_0033096
1384 Ga0501067_0155461
1385 Ga0501067_0216540
1386 Ga0501069_0000709
1387 Ga0501069_0002820
1388 Ga0501069_0224544
1389 Ga0501070_0406132
1390 nmdc:mga05p37_333843_c1
1391 nmdc:mga05p37_394784_c1
1392 nmdc:mga05p37_849550_c1
1393 nmdc:mga06r32_9681_c1
1394 nmdc:mga08y16_101094_c1
1395 nmdc:mga08y16_1103198_c1
1396 nmdc:mga08y16_1171034_c1
1397 nmdc:mga08y16_48530_c1
1398 nmdc:mga08y16_567250_c1
1399 nmdc:mga0n895_39190_c1
1400 nmdc:mga0n895_81283_c1
1401 nmdc:mga0n895_87578_c1
1402 nmdc:mga0rr50_240444_c1
1403 nmdc:mga0rr50_28380_c1
1404 nmdc:mga0rr50_30439_c1
1405 nmdc:mga08x19_25094_c1
1406 nmdc:mga08x19_281014_c1
1407 nmdc:mga08x19_31230_c1
1408 nmdc:mga08x19_869844_c1
1409 nmdc:mga0a205_241530_c1
1410 nmdc:mga0a205_44360_c1
1411 nmdc:mga0a205_66043_c1
1412 nmdc:mga0a205_94856_c1
1413 Ga0495601_0105137
1414 Ga0495601_0107995
1415 Ga0495595_0017394
1416 Ga0495595_0030829
1417 Ga0495595_0081895
1418 Ga0495619_0002157
1419 Ga0466962_0003041
1420 Ga0466962_0012241
1421 Ga0466962_0017152
1422 Ga0466962_0307799
1423 Ga0466962_0341139
1424 Ga0530510_0025384
1425 Ga0530510_0054449
1426 2644444440

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5cs2-assembly1.cif.gz_A-2 crystal structure of plasmodium falciparum diadenosine triphosphate hydrolase in complex with cyclomarin a 0.7586 43 161
6id1-assembly1.cif.gz_U cryo-em structure of a human intron lariat spliceosome after prp43 loaded (ils2 complex) at 2.9 angstrom resolution 0.7578 43 126
3imi-assembly2.cif.gz_C 2.01 angstrom resolution crystal structure of a hit family protein from bacillus anthracis str. 'ames ancestor' 0.7504 33 133
1fit-assembly1.cif.gz_A fhit (fragile histidine triad protein) 0.7491 43 162
1ems-assembly1.cif.gz_A crystal structure of the c. elegans nitfhit protein 0.7479 43 163
ID Description Score Start End Superfamily
af_P49775_3_108_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8542 43 126 3.30.428.10
af_A0A140LH01_2_105_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8408 45 127 3.30.428.10
af_Q54NJ5_358_522_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8341 43 126 3.30.428.10
af_Q9VXT5_460_584_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8303 43 126 3.30.428.10
af_Q2TBE0_669_803_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8234 43 126 3.30.428.10
ID Description Score Start End GO Terms
AF-A0A0J8V6C9-F1-model_v4 HIT domain-containing protein 0.8845 41 127 GO:0003824
AF-A0A7C9L123-F1-model_v4 GNAT family N-acetyltransferase 0.8787 33 125 GO:0004343
AF-A0A658AHK3-F1-model_v4 deleted 0.8686 31 125
AF-A0A176U8N0-F1-model_v4 Histidine triad domain protein 0.8666 33 128 GO:0003824
AF-A0A0Q9RH92-F1-model_v4 HIT domain-containing protein 0.8655 45 162

Map