F476872

General Info

Members Datasets Scaffolds Average Seq Length
713 273 1426 162

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_11052219|Ga0070658_110522191
Length 172
Sequence VHAVPLELYRIDDRLIHGQVVVGWGRPLDIGFIVLVDDEVAASEWEQELYRMGVPPEMDVFFHGVDDAVQSYARYANDRRHGILLTGDIDTMARVVDGVRRSGAQPAISAVNLGGVHHRVGRAQRMRYVFLTPDEESALRALASRGVAVTAQDVPSARPIPLDELLAGRAPV

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
80 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
93 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
94 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
109 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
110 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
118 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
119 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
120 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
121 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
122 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
123 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
124 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
190 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
194 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
195 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
196 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
197 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
198 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
199 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
200 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
201 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
202 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
203 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
204 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
205 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
206 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
207 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
208 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
209 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
210 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
211 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
212 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
213 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
214 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
215 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
216 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
217 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
218 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
219 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
220 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
221 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
222 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
223 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
224 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
225 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
226 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
227 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
228 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
229 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
230 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
231 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
232 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
233 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
234 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
235 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
236 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
237 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
238 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
239 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
240 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
241 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
242 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
243 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
244 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
245 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
251 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
252 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
253 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
254 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
255 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
256 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
257 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
258 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
259 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
260 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
262 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
263 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
264 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
265 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
266 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
267 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
268 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
269 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
270 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
271 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
272 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
273 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.58
Metatranscriptomes 0.42
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.12
Rhizosphere 98.74
Stem 0
Stem Tuber 0
Unclassified 11.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_11052219 3300005327 Bacteria 708
2 MBSR1b_contig_10993752 2162886012 Unclassified 860
3 Ga0065712_10364293 3300005290 Bacteria 771
4 Ga0065712_10497503 3300005290 Unclassified 651
5 Ga0065715_10209553 3300005293 Unclassified 1321
6 Ga0065715_10351820 3300005293 Unclassified 950
7 Ga0070658_10609886 3300005327 Bacteria 946
8 Ga0070676_10004381 3300005328 Bacteria 7423
9 Ga0070676_10006960 3300005328 Bacteria 6053
10 Ga0070676_10071813 3300005328 Bacteria 2080
11 Ga0070683_100010082 3300005329 Bacteria 8105
12 Ga0070683_100030201 3300005329 Bacteria 4915
13 Ga0070683_100172042 3300005329 Bacteria 2056
14 Ga0070683_100250990 3300005329 Bacteria 1683
15 Ga0070690_100779376 3300005330 Bacteria 740
16 Ga0070670_100013576 3300005331 Bacteria 6981
17 Ga0070670_100133419 3300005331 Bacteria 2145
18 Ga0070670_100181230 3300005331 Bacteria 1829
19 Ga0070670_100827359 3300005331 Unclassified 837
20 Ga0070670_100951761 3300005331 Bacteria 780
21 Ga0070677_10545340 3300005333 Unclassified 635
22 Ga0068869_100024550 3300005334 Bacteria 4175
23 Ga0068869_100085778 3300005334 Bacteria 2359
24 Ga0070666_10144310 3300005335 Bacteria 1659
25 Ga0070680_100002238 3300005336 Bacteria 14277
26 Ga0070680_100079736 3300005336 Bacteria 2699
27 Ga0070680_100091770 3300005336 Bacteria 2514
28 Ga0070680_100174837 3300005336 Bacteria 1808
29 Ga0070682_100009648 3300005337 Bacteria 5464
30 Ga0070682_100189927 3300005337 Unclassified 1441
31 Ga0068868_100016583 3300005338 Bacteria 5475
32 Ga0070660_100687271 3300005339 Bacteria 858
33 Ga0070660_100949621 3300005339 Bacteria 726
34 Ga0070660_101158613 3300005339 Bacteria 655
35 Ga0070689_100007804 3300005340 Bacteria 7498
36 Ga0070689_100238155 3300005340 Bacteria 1498
37 Ga0070691_10012993 3300005341 Bacteria 3813
38 Ga0070691_10066101 3300005341 Bacteria 1747
39 Ga0070691_10139886 3300005341 Bacteria 1232
40 Ga0070687_100189381 3300005343 Bacteria 1238
41 Ga0070661_100003761 3300005344 Bacteria 10462
42 Ga0070661_100010690 3300005344 Bacteria 6386
43 Ga0070661_100016018 3300005344 Bacteria 5291
44 Ga0070661_100053819 3300005344 Bacteria 2947
45 Ga0070661_100078323 3300005344 Bacteria 2438
46 Ga0070661_100254675 3300005344 Bacteria 1356
47 Ga0070661_100389761 3300005344 Bacteria 1100
48 Ga0070692_10011075 3300005345 Bacteria 4129
49 Ga0070692_10179528 3300005345 Bacteria 1226
50 Ga0070692_10462742 3300005345 Unclassified 814
51 Ga0070668_100002904 3300005347 Bacteria 12655
52 Ga0070668_100032312 3300005347 Bacteria 3983
53 Ga0070668_100168227 3300005347 Bacteria 1783
54 Ga0070668_100296061 3300005347 Bacteria 1356
55 Ga0070669_100019178 3300005353 Bacteria 4887
56 Ga0070669_100039291 3300005353 Bacteria 3438
57 Ga0070669_100118650 3300005353 Unclassified 2015
58 Ga0070669_100406803 3300005353 Bacteria 1114
59 Ga0070675_100001661 3300005354 Bacteria 16438
60 Ga0070675_100009557 3300005354 Bacteria 7544
61 Ga0070675_100239311 3300005354 Bacteria 1586
62 Ga0070675_100471902 3300005354 Bacteria 1127
63 Ga0070675_100623224 3300005354 Bacteria 979
64 Ga0070675_100636284 3300005354 Bacteria 969
65 Ga0070671_100037881 3300005355 Bacteria 4001
66 Ga0070671_100089506 3300005355 Bacteria 2577
67 Ga0070671_100090433 3300005355 Unclassified 2563
68 Ga0070671_100815621 3300005355 Bacteria 813
69 Ga0070671_100971412 3300005355 Unclassified 743
70 Ga0070674_100005762 3300005356 Bacteria 7189
71 Ga0070674_100020405 3300005356 Bacteria 4233
72 Ga0070674_100137619 3300005356 Bacteria 1829
73 Ga0070674_100442306 3300005356 Bacteria 1071
74 Ga0070673_100010604 3300005364 Bacteria 6245
75 Ga0070673_101445557 3300005364 Bacteria 648
76 Ga0070688_100049707 3300005365 Bacteria 2610
77 Ga0070659_100001454 3300005366 Bacteria 17048
78 Ga0070659_100035063 3300005366 Bacteria 3905
79 Ga0070659_100042934 3300005366 Bacteria 3535
80 Ga0070659_100288173 3300005366 Bacteria 1367
81 Ga0070659_100439073 3300005366 Bacteria 1106
82 Ga0070659_100566389 3300005366 Bacteria 974
83 Ga0070667_100014476 3300005367 Bacteria 6517
84 Ga0070667_100040587 3300005367 Bacteria 3902
85 Ga0070667_100742178 3300005367 Bacteria 910
86 Ga0070703_10001597 3300005406 Bacteria 6735
87 Ga0070703_10004801 3300005406 Bacteria 3780
88 Ga0070703_10027321 3300005406 Bacteria 1700
89 Ga0070709_10005390 3300005434 Bacteria 6927
90 Ga0070709_10071748 3300005434 Unclassified 2237
91 Ga0070709_10228111 3300005434 Bacteria 1331
92 Ga0070709_11068620 3300005434 Unclassified 644
93 Ga0070714_100026372 3300005435 Bacteria 4802
94 Ga0070714_100591277 3300005435 Unclassified 1065
95 Ga0070714_101079615 3300005435 Unclassified 782
96 Ga0070713_100759623 3300005436 Bacteria 928
97 Ga0070710_10097561 3300005437 Unclassified 1744
98 Ga0070701_10002895 3300005438 Bacteria 6686
99 Ga0070711_100000063 3300005439 Bacteria 63948
100 Ga0070711_100290162 3300005439 Bacteria 1297
101 Ga0070705_100003672 3300005440 Bacteria 7517
102 Ga0070700_100044616 3300005441 Bacteria 2732
103 Ga0070694_100002393 3300005444 Bacteria 11092
104 Ga0070694_100007139 3300005444 Bacteria 6802
105 Ga0070694_100008081 3300005444 Bacteria 6427
106 Ga0070694_100256372 3300005444 Bacteria 1325
107 Ga0070708_100017525 3300005445 Bacteria 5979
108 Ga0070708_100420600 3300005445 Bacteria 1260
109 Ga0070708_100488426 3300005445 Unclassified 1161
110 Ga0070708_100820955 3300005445 Unclassified 874
111 Ga0070663_100008355 3300005455 Bacteria 6361
112 Ga0070663_100021824 3300005455 Bacteria 4266
113 Ga0070663_100038762 3300005455 Bacteria 3326
114 Ga0070678_100051909 3300005456 Bacteria 2975
115 Ga0070678_100084745 3300005456 Bacteria 2413
116 Ga0070678_100438309 3300005456 Bacteria 1142
117 Ga0070662_100001961 3300005457 Bacteria 12640
118 Ga0070662_100004241 3300005457 Bacteria 9041
119 Ga0070662_100033697 3300005457 Bacteria 3608
120 Ga0070662_100183559 3300005457 Bacteria 1651
121 Ga0070662_100503131 3300005457 Bacteria 1011
122 Ga0070681_10001192 3300005458 Bacteria 22531
123 Ga0070681_10075802 3300005458 Bacteria 3323
124 Ga0070681_10108368 3300005458 Unclassified 2718
125 Ga0070681_10337260 3300005458 Bacteria 1417
126 Ga0070681_10379890 3300005458 Bacteria 1323
127 Ga0068867_100004107 3300005459 Bacteria 10230
128 Ga0068867_100049245 3300005459 Bacteria 3101
129 Ga0068867_100229002 3300005459 Bacteria 1501
130 Ga0070685_10016196 3300005466 Bacteria 3969
131 Ga0070706_100050479 3300005467 Bacteria 3839
132 Ga0070706_100120239 3300005467 Unclassified 2448
133 Ga0070706_100182537 3300005467 Bacteria 1959
134 Ga0070706_100861758 3300005467 Bacteria 837
135 Ga0070707_100168634 3300005468 Bacteria 2133
136 Ga0070707_100530297 3300005468 Bacteria 1139
137 Ga0070698_100000360 3300005471 Bacteria 47129
138 Ga0070698_100008598 3300005471 Bacteria 11006
139 Ga0070698_100026323 3300005471 Bacteria 6054
140 Ga0070698_100281283 3300005471 Bacteria 1595
141 Ga0070698_101062799 3300005471 Bacteria 757
142 Ga0070699_100006525 3300005518 Bacteria 10159
143 Ga0070699_100037597 3300005518 Bacteria 4191
144 Ga0070699_100076608 3300005518 Bacteria 2911
145 Ga0070699_100315359 3300005518 Bacteria 1404
146 Ga0070699_100937125 3300005518 Bacteria 793
147 Ga0070679_100027193 3300005530 Bacteria 5627
148 Ga0070679_100041610 3300005530 Bacteria 4573
149 Ga0070679_100078306 3300005530 Bacteria 3294
150 Ga0070679_100084719 3300005530 Bacteria 3157
151 Ga0070679_100251612 3300005530 Unclassified 1723
152 Ga0070684_100005054 3300005535 Bacteria 10070
153 Ga0070684_100022465 3300005535 Bacteria 5262
154 Ga0070684_100077151 3300005535 Bacteria 2942
155 Ga0070684_100655246 3300005535 Unclassified 977
156 Ga0070684_100987484 3300005535 Bacteria 790
157 Ga0070697_100008933 3300005536 Bacteria 7829
158 Ga0070697_100036985 3300005536 Bacteria 3943
159 Ga0070697_100076605 3300005536 Bacteria 2750
160 Ga0068853_100074201 3300005539 Bacteria 2968
161 Ga0068853_100076284 3300005539 Unclassified 2927
162 Ga0068853_100110232 3300005539 Bacteria 2444
163 Ga0068853_100148134 3300005539 Bacteria 2111
164 Ga0070672_100004646 3300005543 Bacteria 8998
165 Ga0070672_100052796 3300005543 Bacteria 3175
166 Ga0070672_100299179 3300005543 Bacteria 1363
167 Ga0070672_100311852 3300005543 Bacteria 1336
168 Ga0070686_100606734 3300005544 Bacteria 863
169 Ga0070695_100003953 3300005545 Bacteria 8653
170 Ga0070695_100015448 3300005545 Bacteria 4611
171 Ga0070695_100019954 3300005545 Bacteria 4087
172 Ga0070695_100049942 3300005545 Bacteria 2679
173 Ga0070696_100001802 3300005546 Bacteria 14057
174 Ga0070696_100008309 3300005546 Bacteria 6947
175 Ga0070696_100066123 3300005546 Bacteria 2535
176 Ga0070693_100805183 3300005547 Bacteria 697
177 Ga0070665_100024001 3300005548 Bacteria 6140
178 Ga0070665_100092682 3300005548 Bacteria 3026
179 Ga0070704_100001020 3300005549 Bacteria 14389
180 Ga0070704_100015227 3300005549 Bacteria 4825
181 Ga0070704_100172429 3300005549 Unclassified 1722
182 Ga0068855_100007100 3300005563 Bacteria 13590
183 Ga0068855_100026559 3300005563 Bacteria 6927
184 Ga0068855_100096498 3300005563 Bacteria 3406
185 Ga0068855_100368317 3300005563 Unclassified 1580
186 Ga0070664_100010557 3300005564 Bacteria 7487
187 Ga0070664_100036381 3300005564 Bacteria 4136
188 Ga0070664_100054904 3300005564 Bacteria 3381
189 Ga0070664_100069771 3300005564 Bacteria 3008
190 Ga0070664_100091040 3300005564 Bacteria 2640
191 Ga0070664_100123800 3300005564 Bacteria 2266
192 Ga0070664_100552393 3300005564 Bacteria 1065
193 Ga0068857_100009475 3300005577 Bacteria 8456
194 Ga0068857_100014570 3300005577 Bacteria 6858
195 Ga0068857_100106433 3300005577 Bacteria 2519
196 Ga0068857_100232104 3300005577 Bacteria 1688
197 Ga0068854_100004244 3300005578 Bacteria 9025
198 Ga0068854_100014364 3300005578 Bacteria 5220
199 Ga0068854_100116344 3300005578 Bacteria 2023
200 Ga0068854_100128337 3300005578 Bacteria 1934
201 Ga0068854_100609111 3300005578 Bacteria 933
202 Ga0068856_100018036 3300005614 Bacteria 6844
203 Ga0068856_100357154 3300005614 Unclassified 1480
204 Ga0068856_100372825 3300005614 Unclassified 1446
205 Ga0068856_101689425 3300005614 Unclassified 646
206 Ga0070702_100010141 3300005615 Bacteria 4631
207 Ga0070702_100690862 3300005615 Unclassified 776
208 Ga0068852_100037150 3300005616 Bacteria 4081
209 Ga0068852_100097864 3300005616 Bacteria 2640
210 Ga0068852_100178469 3300005616 Bacteria 1995
211 Ga0068852_100839864 3300005616 Bacteria 934
212 Ga0068859_100060965 3300005617 Bacteria 3801
213 Ga0068859_100738437 3300005617 Unclassified 1074
214 Ga0068859_100926599 3300005617 Unclassified 955
215 Ga0068864_100058006 3300005618 Bacteria 3345
216 Ga0068864_100180131 3300005618 Bacteria 1932
217 Ga0068864_100379458 3300005618 Bacteria 1339
218 Ga0068866_10000396 3300005718 Bacteria 20284
219 Ga0068866_10975832 3300005718 Unclassified 600
220 Ga0068861_100018071 3300005719 Bacteria 5014
221 Ga0068861_100084742 3300005719 Bacteria 2488
222 Ga0068861_100184342 3300005719 Bacteria 1740
223 Ga0068861_100591974 3300005719 Bacteria 1017
224 Ga0068861_101060091 3300005719 Unclassified 777
225 Ga0068851_10067247 3300005834 Bacteria 1848
226 Ga0068851_10814078 3300005834 Unclassified 581
227 Ga0068870_10002264 3300005840 Bacteria 7991
228 Ga0068870_10081092 3300005840 Bacteria 1794
229 Ga0068863_100083253 3300005841 Bacteria 3031
230 Ga0068858_100027910 3300005842 Bacteria 5244
231 Ga0068858_100079511 3300005842 Bacteria 3047
232 Ga0068860_100008276 3300005843 Bacteria 10352
233 Ga0068860_100151798 3300005843 Bacteria 2231
234 Ga0068862_100000563 3300005844 Bacteria 38630
235 Ga0068862_100016777 3300005844 Bacteria 6097
236 Ga0068862_100370082 3300005844 Bacteria 1334
237 Ga0070716_100013974 3300006173 Bacteria 4105
238 Ga0070716_100032045 3300006173 Bacteria 2864
239 Ga0070712_100198323 3300006175 Bacteria 1575
240 Ga0097621_100028696 3300006237 Bacteria 4388
241 Ga0068871_100385989 3300006358 Bacteria 1245
242 Ga0068871_100427264 3300006358 Bacteria 1184
243 Ga0075428_100116530 3300006844 Bacteria 2910
244 Ga0075428_100173298 3300006844 Bacteria 2338
245 Ga0075428_100659367 3300006844 Bacteria 1116
246 Ga0075428_101382877 3300006844 Bacteria 739
247 Ga0075430_100002009 3300006846 Bacteria 16757
248 Ga0075430_100013112 3300006846 Bacteria 7063
249 Ga0075430_100055453 3300006846 Bacteria 3332
250 Ga0075430_100103903 3300006846 Bacteria 2372
251 Ga0075430_100156810 3300006846 Bacteria 1895
252 Ga0075431_100005920 3300006847 Bacteria 12096
253 Ga0075431_100065851 3300006847 Bacteria 3740
254 Ga0075431_100191633 3300006847 Bacteria 2094
255 Ga0075431_100201027 3300006847 Bacteria 2039
256 Ga0075431_100296399 3300006847 Unclassified 1634
257 Ga0075431_100599435 3300006847 Bacteria 1086
258 Ga0075431_101240064 3300006847 Unclassified 708
259 Ga0075433_10000099 3300006852 Bacteria 41634
260 Ga0075433_10012493 3300006852 Bacteria 6864
261 Ga0075434_100004057 3300006871 Bacteria 13132
262 Ga0075434_100055851 3300006871 Bacteria 3924
263 Ga0075434_100067408 3300006871 Bacteria 3565
264 Ga0075434_100115447 3300006871 Unclassified 2697
265 Ga0075429_100025615 3300006880 Bacteria 5120
266 Ga0075429_100031901 3300006880 Bacteria 4580
267 Ga0075429_100042420 3300006880 Bacteria 3960
268 Ga0075429_100067388 3300006880 Bacteria 3115
269 Ga0075429_101170217 3300006880 Unclassified 671
270 Ga0068865_100023492 3300006881 Bacteria 4037
271 Ga0068865_100026342 3300006881 Bacteria 3833
272 Ga0068865_100745438 3300006881 Bacteria 841
273 Ga0075436_100001526 3300006914 Bacteria 15807
274 Ga0075436_100002529 3300006914 Bacteria 12588
275 Ga0075436_100019281 3300006914 Unclassified 4674
276 Ga0075436_100029983 3300006914 Bacteria 3742
277 Ga0097620_100060955 3300006931 Bacteria 3801
278 Ga0097620_100738467 3300006931 Unclassified 1074
279 Ga0097620_100926522 3300006931 Unclassified 955
280 Ga0075435_100038305 3300007076 Unclassified 3822
281 Ga0099794_10115068 3300007265 Bacteria 1350
282 Ga0099794_10246125 3300007265 Unclassified 921
283 Ga0099795_10183975 3300007788 Unclassified 874
284 Ga0105240_10032537 3300009093 Bacteria 6752
285 Ga0105240_10066320 3300009093 Bacteria 4479
286 Ga0105240_10094276 3300009093 Bacteria 3652
287 Ga0105240_10112844 3300009093 Bacteria 3285
288 Ga0105240_10286846 3300009093 Bacteria 1889
289 Ga0105240_11946990 3300009093 Unclassified 611
290 Ga0111539_10118385 3300009094 Bacteria 3105
291 Ga0111539_10416235 3300009094 Bacteria 1565
292 Ga0111539_10848109 3300009094 Bacteria 1063
293 Ga0105245_10024871 3300009098 Bacteria 5263
294 Ga0105245_10043029 3300009098 Bacteria 4029
295 Ga0114129_10003237 3300009147 Bacteria 22855
296 Ga0114129_10018210 3300009147 Bacteria 10000
297 Ga0114129_10041097 3300009147 Bacteria 6518
298 Ga0114129_10659840 3300009147 Unclassified 1349
299 Ga0114129_10777313 3300009147 Bacteria 1224
300 Ga0105243_10059148 3300009148 Bacteria 3057
301 Ga0105243_10133900 3300009148 Bacteria 2106
302 Ga0105241_10004794 3300009174 Bacteria 9959
303 Ga0105241_10358318 3300009174 Bacteria 1269
304 Ga0105242_10004473 3300009176 Bacteria 10869
305 Ga0105242_10336368 3300009176 Bacteria 1390
306 Ga0105248_10018883 3300009177 Bacteria 7623
307 Ga0105248_10071679 3300009177 Bacteria 3893
308 Ga0105248_10111900 3300009177 Bacteria 3080
309 Ga0105248_10112466 3300009177 Bacteria 3071
310 Ga0105248_10385902 3300009177 Bacteria 1577
311 Ga0105238_10004021 3300009551 Bacteria 14586
312 Ga0105238_10132832 3300009551 Bacteria 2467
313 Ga0105238_10363823 3300009551 Bacteria 1436
314 Ga0105238_10546187 3300009551 Bacteria 1163
315 Ga0105249_10000133 3300009553 Bacteria 98005
316 Ga0105249_10000662 3300009553 Bacteria 31249
317 Ga0105249_10005645 3300009553 Bacteria 10826
318 Ga0105249_10088499 3300009553 Bacteria 2892
319 Ga0105249_10468457 3300009553 Bacteria 1301
320 Ga0099796_10039542 3300010159 Bacteria 1588
321 Ga0105239_10042819 3300010375 Bacteria 4961
322 Ga0105239_10217802 3300010375 Bacteria 2141
323 Ga0105246_10025469 3300011119 Bacteria 3856
324 Ga0105246_10814217 3300011119 Bacteria 830
325 Ga0157373_10028435 3300013100 Bacteria 4033
326 Ga0157373_10180273 3300013100 Bacteria 1487
327 Ga0157371_10033766 3300013102 Bacteria 3674
328 Ga0157371_10035423 3300013102 Bacteria 3576
329 Ga0157370_10008158 3300013104 Bacteria 11325
330 Ga0157370_10093519 3300013104 Bacteria 2821
331 Ga0157370_10590075 3300013104 Bacteria 1017
332 Ga0157370_10725383 3300013104 Unclassified 906
333 Ga0157369_10015385 3300013105 Bacteria 8626
334 Ga0157369_10055735 3300013105 Bacteria 4267
335 Ga0157369_10280233 3300013105 Bacteria 1736
336 Ga0157369_10608877 3300013105 Bacteria 1127
337 Ga0157369_11261387 3300013105 Unclassified 754
338 Ga0157369_12107500 3300013105 Unclassified 572
339 Ga0157378_10086675 3300013297 Bacteria 2839
340 Ga0157378_10339310 3300013297 Bacteria 1465
341 Ga0157378_10741816 3300013297 Bacteria 1004
342 Ga0157378_11881729 3300013297 Bacteria 647
343 Ga0163162_10021469 3300013306 Bacteria 6359
344 Ga0163162_10158516 3300013306 Bacteria 2384
345 Ga0163162_10473896 3300013306 Unclassified 1383
346 Ga0157372_10025436 3300013307 Bacteria 6436
347 Ga0157372_10085398 3300013307 Bacteria 3579
348 Ga0157372_10093733 3300013307 Bacteria 3418
349 Ga0157372_10109041 3300013307 Bacteria 3170
350 Ga0157372_10130190 3300013307 Bacteria 2894
351 Ga0157372_10331811 3300013307 Bacteria 1771
352 Ga0157372_10695250 3300013307 Bacteria 1183
353 Ga0157372_10805232 3300013307 Bacteria 1092
354 Ga0157372_12725546 3300013307 Bacteria 567
355 Ga0157375_10006374 3300013308 Bacteria 10286
356 Ga0157375_10114734 3300013308 Bacteria 2796
357 Ga0157375_10162959 3300013308 Bacteria 2373
358 Ga0157375_12713322 3300013308 Bacteria 592
359 Ga0163163_10038847 3300014325 Bacteria 4641
360 Ga0163163_10546882 3300014325 Bacteria 1220
361 Ga0157380_10001269 3300014326 Bacteria 16396
362 Ga0157380_11043390 3300014326 Bacteria 853
363 Ga0182008_10001887 3300014497 Bacteria 13616
364 Ga0157377_10003414 3300014745 Bacteria 7188
365 Ga0157379_10009985 3300014968 Bacteria 8273
366 Ga0157379_10052555 3300014968 Bacteria 3640
367 Ga0157376_10119725 3300014969 Bacteria 2331
368 Ga0157376_11766215 3300014969 Unclassified 654
369 Ga0182007_10050398 3300015262 Bacteria 1374
370 Ga0163161_10027024 3300017792 Bacteria 4069
371 Ga0197907_10333950 3300020069 Bacteria 840
372 Ga0206356_10916087 3300020070 Bacteria 2841
373 Ga0206353_10474079 3300020082 Bacteria 1170
374 Ga0207697_10033385 3300025315 Bacteria 2106
375 Ga0207656_10038320 3300025321 Bacteria 2022
376 Ga0207653_10001011 3300025885 Bacteria 9280
377 Ga0207653_10016603 3300025885 Bacteria 2313
378 Ga0207653_10020714 3300025885 Unclassified 2083
379 Ga0207653_10069394 3300025885 Bacteria 1202
380 Ga0207642_10001106 3300025899 Bacteria 8349
381 Ga0207642_10329279 3300025899 Bacteria 894
382 Ga0207642_10341429 3300025899 Bacteria 880
383 Ga0207642_10515181 3300025899 Bacteria 734
384 Ga0207688_10046677 3300025901 Bacteria 2419
385 Ga0207680_10244077 3300025903 Bacteria 1238
386 Ga0207647_10040350 3300025904 Bacteria 2940
387 Ga0207699_10007630 3300025906 Bacteria 5297
388 Ga0207699_10051807 3300025906 Bacteria 2426
389 Ga0207699_10209867 3300025906 Bacteria 1324
390 Ga0207645_10006068 3300025907 Bacteria 8689
391 Ga0207645_10007630 3300025907 Bacteria 7622
392 Ga0207643_10035329 3300025908 Bacteria 2802
393 Ga0207643_10052872 3300025908 Bacteria 2307
394 Ga0207643_10075973 3300025908 Bacteria 1940
395 Ga0207705_10212956 3300025909 Bacteria 1466
396 Ga0207684_10003109 3300025910 Bacteria 16376
397 Ga0207684_10006288 3300025910 Bacteria 10833
398 Ga0207684_10621598 3300025910 Bacteria 922
399 Ga0207707_10003275 3300025912 Bacteria 14385
400 Ga0207707_10031715 3300025912 Bacteria 4625
401 Ga0207707_10055419 3300025912 Bacteria 3448
402 Ga0207707_10084141 3300025912 Unclassified 2778
403 Ga0207695_10036015 3300025913 Bacteria 5355
404 Ga0207695_10054884 3300025913 Bacteria 4157
405 Ga0207695_10142662 3300025913 Bacteria 2342
406 Ga0207695_10802493 3300025913 Bacteria 821
407 Ga0207693_10492649 3300025915 Bacteria 957
408 Ga0207663_10000066 3300025916 Bacteria 51628
409 Ga0207663_10219106 3300025916 Bacteria 1384
410 Ga0207660_10074666 3300025917 Bacteria 2475
411 Ga0207660_10083319 3300025917 Bacteria 2355
412 Ga0207660_10105973 3300025917 Bacteria 2107
413 Ga0207662_10001456 3300025918 Bacteria 11485
414 Ga0207662_10190889 3300025918 Bacteria 1322
415 Ga0207657_10105584 3300025919 Bacteria 2331
416 Ga0207649_10004268 3300025920 Bacteria 7780
417 Ga0207649_10020418 3300025920 Bacteria 3799
418 Ga0207649_10085541 3300025920 Bacteria 2052
419 Ga0207649_10123001 3300025920 Unclassified 1752
420 Ga0207649_10236975 3300025920 Bacteria 1308
421 Ga0207649_10374740 3300025920 Bacteria 1059
422 Ga0207652_10050915 3300025921 Unclassified 3549
423 Ga0207652_10192663 3300025921 Unclassified 1834
424 Ga0207652_10336273 3300025921 Bacteria 1363
425 Ga0207646_10001173 3300025922 Bacteria 33196
426 Ga0207646_10001261 3300025922 Bacteria 31711
427 Ga0207646_10001743 3300025922 Bacteria 26459
428 Ga0207646_10002799 3300025922 Bacteria 20310
429 Ga0207646_10003468 3300025922 Bacteria 17812
430 Ga0207646_10005458 3300025922 Bacteria 13366
431 Ga0207646_10127632 3300025922 Unclassified 2287
432 Ga0207681_10042969 3300025923 Bacteria 3022
433 Ga0207681_10119367 3300025923 Bacteria 1931
434 Ga0207681_10194051 3300025923 Bacteria 1555
435 Ga0207681_10228343 3300025923 Unclassified 1444
436 Ga0207694_10493582 3300025924 Bacteria 1025
437 Ga0207694_10504630 3300025924 Bacteria 1013
438 Ga0207650_10028340 3300025925 Bacteria 4015
439 Ga0207650_10132643 3300025925 Bacteria 1951
440 Ga0207650_10913610 3300025925 Bacteria 746
441 Ga0207650_11359144 3300025925 Unclassified 604
442 Ga0207659_10020893 3300025926 Bacteria 4336
443 Ga0207659_10026481 3300025926 Bacteria 3912
444 Ga0207659_10034004 3300025926 Bacteria 3512
445 Ga0207687_10024522 3300025927 Bacteria 4030
446 Ga0207687_10061042 3300025927 Bacteria 2661
447 Ga0207700_10034195 3300025928 Bacteria 3646
448 Ga0207664_10026031 3300025929 Bacteria 4416
449 Ga0207664_10033015 3300025929 Bacteria 3973
450 Ga0207664_10483876 3300025929 Unclassified 1107
451 Ga0207644_10072715 3300025931 Bacteria 2519
452 Ga0207644_10180910 3300025931 Bacteria 1652
453 Ga0207644_10293640 3300025931 Unclassified 1308
454 Ga0207644_10918610 3300025931 Bacteria 734
455 Ga0207690_10009969 3300025932 Bacteria 5642
456 Ga0207690_10042710 3300025932 Bacteria 2979
457 Ga0207690_10153401 3300025932 Bacteria 1710
458 Ga0207706_10000155 3300025933 Bacteria 75598
459 Ga0207706_10000632 3300025933 Bacteria 37313
460 Ga0207706_10088595 3300025933 Bacteria 2721
461 Ga0207686_10000712 3300025934 Bacteria 20636
462 Ga0207686_10051080 3300025934 Bacteria 2574
463 Ga0207709_10029683 3300025935 Bacteria 3175
464 Ga0207709_11070041 3300025935 Bacteria 661
465 Ga0207670_10094161 3300025936 Bacteria 2124
466 Ga0207670_11020223 3300025936 Bacteria 697
467 Ga0207669_10000540 3300025937 Bacteria 16471
468 Ga0207669_10019424 3300025937 Bacteria 3538
469 Ga0207669_10325411 3300025937 Bacteria 1178
470 Ga0207704_10001012 3300025938 Bacteria 12464
471 Ga0207704_10015704 3300025938 Bacteria 3868
472 Ga0207704_10039945 3300025938 Bacteria 2738
473 Ga0207704_10708671 3300025938 Bacteria 834
474 Ga0207665_10016481 3300025939 Bacteria 4852
475 Ga0207665_10021110 3300025939 Bacteria 4280
476 Ga0207691_10001667 3300025940 Bacteria 21972
477 Ga0207691_10002873 3300025940 Bacteria 16783
478 Ga0207691_10293469 3300025940 Bacteria 1398
479 Ga0207691_10404759 3300025940 Bacteria 1164
480 Ga0207711_10002131 3300025941 Bacteria 17836
481 Ga0207711_10286202 3300025941 Bacteria 1518
482 Ga0207711_10410705 3300025941 Bacteria 1258
483 Ga0207711_10549574 3300025941 Bacteria 1077
484 Ga0207711_11504459 3300025941 Unclassified 616
485 Ga0207689_10002158 3300025942 Bacteria 18505
486 Ga0207689_10002528 3300025942 Bacteria 16994
487 Ga0207661_10057765 3300025944 Bacteria 3121
488 Ga0207661_10167001 3300025944 Bacteria 1913
489 Ga0207679_10001557 3300025945 Bacteria 14345
490 Ga0207679_10002457 3300025945 Bacteria 11407
491 Ga0207679_10010095 3300025945 Bacteria 6070
492 Ga0207679_10129668 3300025945 Unclassified 2021
493 Ga0207679_10130536 3300025945 Bacteria 2015
494 Ga0207679_10464949 3300025945 Bacteria 1124
495 Ga0207667_10029575 3300025949 Bacteria 5939
496 Ga0207667_10031049 3300025949 Bacteria 5771
497 Ga0207667_10035036 3300025949 Bacteria 5387
498 Ga0207667_10488134 3300025949 Unclassified 1250
499 Ga0207651_10703919 3300025960 Bacteria 890
500 Ga0207712_10000098 3300025961 Bacteria 99232
501 Ga0207712_10000892 3300025961 Bacteria 21673
502 Ga0207712_10006933 3300025961 Bacteria 7148
503 Ga0207712_10030631 3300025961 Bacteria 3619
504 Ga0207668_10004444 3300025972 Bacteria 8236
505 Ga0207668_10022463 3300025972 Bacteria 4040
506 Ga0207668_10052146 3300025972 Bacteria 2829
507 Ga0207640_10015447 3300025981 Bacteria 4420
508 Ga0207640_10114406 3300025981 Bacteria 1920
509 Ga0207640_10194793 3300025981 Bacteria 1530
510 Ga0207640_10471531 3300025981 Bacteria 1039
511 Ga0207640_11523393 3300025981 Bacteria 601
512 Ga0207658_10035910 3300025986 Bacteria 3552
513 Ga0207658_10264149 3300025986 Bacteria 1468
514 Ga0207677_10146290 3300026023 Bacteria 1816
515 Ga0207677_10349810 3300026023 Bacteria 1238
516 Ga0207677_10804621 3300026023 Bacteria 842
517 Ga0207703_10837849 3300026035 Bacteria 879
518 Ga0207639_10014233 3300026041 Bacteria 5587
519 Ga0207639_10017698 3300026041 Bacteria 5053
520 Ga0207639_10053210 3300026041 Bacteria 3088
521 Ga0207678_10067512 3300026067 Unclassified 3069
522 Ga0207678_10258538 3300026067 Bacteria 1492
523 Ga0207708_10014950 3300026075 Bacteria 5813
524 Ga0207708_10049485 3300026075 Bacteria 3200
525 Ga0207708_10054665 3300026075 Bacteria 3044
526 Ga0207702_10052706 3300026078 Bacteria 3443
527 Ga0207702_10453405 3300026078 Unclassified 1245
528 Ga0207702_10572486 3300026078 Bacteria 1106
529 Ga0207702_11258212 3300026078 Unclassified 734
530 Ga0207641_10154272 3300026088 Bacteria 2082
531 Ga0207648_10001121 3300026089 Bacteria 30059
532 Ga0207648_10016415 3300026089 Bacteria 6765
533 Ga0207648_10122403 3300026089 Bacteria 2288
534 Ga0207648_10353919 3300026089 Bacteria 1324
535 Ga0207648_11294258 3300026089 Unclassified 685
536 Ga0207676_10019772 3300026095 Bacteria 4918
537 Ga0207676_10046437 3300026095 Bacteria 3361
538 Ga0207676_10049150 3300026095 Bacteria 3279
539 Ga0207676_10188579 3300026095 Bacteria 1812
540 Ga0207674_10001550 3300026116 Bacteria 29596
541 Ga0207674_10001551 3300026116 Bacteria 29595
542 Ga0207674_10004982 3300026116 Bacteria 15877
543 Ga0207674_10017983 3300026116 Bacteria 7700
544 Ga0207674_10109385 3300026116 Bacteria 2740
545 Ga0207675_100001026 3300026118 Bacteria 27652
546 Ga0207675_100086073 3300026118 Bacteria 2951
547 Ga0207675_100717463 3300026118 Bacteria 1009
548 Ga0207683_10053585 3300026121 Bacteria 3537
549 Ga0207683_10116397 3300026121 Bacteria 2396
550 Ga0207683_10373087 3300026121 Bacteria 1311
551 Ga0207698_10039732 3300026142 Bacteria 3488
552 Ga0207698_10075498 3300026142 Bacteria 2694
553 Ga0207698_11505787 3300026142 Bacteria 688
554 Ga0207428_10319421 3300027907 Bacteria 1147
555 Ga0268266_10040493 3300028379 Bacteria 3971
556 Ga0268266_10266601 3300028379 Bacteria 1589
557 Ga0268266_10356235 3300028379 Bacteria 1376
558 Ga0268265_10003561 3300028380 Bacteria 11130
559 Ga0268265_10012541 3300028380 Bacteria 5745
560 Ga0268265_10025393 3300028380 Bacteria 4204
561 Ga0268265_10269121 3300028380 Unclassified 1519
562 Ga0268264_10040011 3300028381 Bacteria 3873
563 Ga0268264_10967962 3300028381 Bacteria 857
564 Ga0265332_10003146 3300031238 Bacteria 8039
565 Ga0265327_10079221 3300031251 Bacteria 1626
566 Ga0307408_100033611 3300031548 Bacteria 3585
567 Ga0307408_100370241 3300031548 Bacteria 1222
568 Ga0265314_10013156 3300031711 Bacteria 6702
569 Ga0307405_10010082 3300031731 Bacteria 4875
570 Ga0307405_10012954 3300031731 Bacteria 4435
571 Ga0307405_10113504 3300031731 Bacteria 1840
572 Ga0307405_10548692 3300031731 Bacteria 935
573 Ga0307413_10000588 3300031824 Bacteria 12205
574 Ga0307413_10110610 3300031824 Bacteria 1838
575 Ga0307413_10167564 3300031824 Bacteria 1551
576 Ga0307413_10472124 3300031824 Unclassified 1001
577 Ga0307413_10645459 3300031824 Bacteria 872
578 Ga0307410_10008824 3300031852 Bacteria 5618
579 Ga0307410_10012850 3300031852 Bacteria 4861
580 Ga0307410_10066404 3300031852 Bacteria 2485
581 Ga0307410_10236549 3300031852 Bacteria 1413
582 Ga0307410_10440130 3300031852 Bacteria 1061
583 Ga0307410_10598189 3300031852 Bacteria 920
584 Ga0307406_10001667 3300031901 Bacteria 12207
585 Ga0307406_10032347 3300031901 Bacteria 3193
586 Ga0307406_10047040 3300031901 Bacteria 2717
587 Ga0307407_10001245 3300031903 Bacteria 9059
588 Ga0307407_10018611 3300031903 Bacteria 3517
589 Ga0307407_10154793 3300031903 Bacteria 1494
590 Ga0307407_10280055 3300031903 Bacteria 1155
591 Ga0307412_10010351 3300031911 Bacteria 5369
592 Ga0307412_10063227 3300031911 Bacteria 2496
593 Ga0307409_100017363 3300031995 Bacteria 4793
594 Ga0307409_100025800 3300031995 Bacteria 4130
595 Ga0307409_100198873 3300031995 Bacteria 1791
596 Ga0307409_100465222 3300031995 Bacteria 1223
597 Ga0307409_101514531 3300031995 Unclassified 698
598 Ga0307409_101965696 3300031995 Bacteria 614
599 Ga0307416_100012575 3300032002 Bacteria 5711
600 Ga0307416_100023653 3300032002 Bacteria 4464
601 Ga0307416_100082932 3300032002 Bacteria 2718
602 Ga0307416_101775638 3300032002 Bacteria 721
603 Ga0307416_102287195 3300032002 Bacteria 641
604 Ga0307414_10004995 3300032004 Bacteria 7257
605 Ga0307414_10141619 3300032004 Bacteria 1883
606 Ga0307411_10000266 3300032005 Bacteria 17168
607 Ga0307411_10009129 3300032005 Bacteria 5191
608 Ga0307411_10560895 3300032005 Bacteria 976
609 Ga0307415_100003789 3300032126 Bacteria 7749
610 Ga0307415_100009913 3300032126 Bacteria 5369
611 Ga0307415_100186435 3300032126 Bacteria 1633
612 Ga0373944_0070761 3300035089 Unclassified 1136
613 Ga0373946_0156456 3300035171 Bacteria 1067
614 Ga0373947_0298272 3300035725 Bacteria 1074
615 Ga0373947_0895436 3300035725 Unclassified 606
616 Ga0395899_0054189 3300037312 Bacteria 2968
617 Ga0395900_0019850 3300037418 Bacteria 6851
618 Ga0395898_1179730 3300037466 Bacteria 697
619 Ga0395905_0004652 3300037471 Bacteria 14191
620 Ga0395905_0077015 3300037471 Bacteria 3125
621 Ga0395905_0406131 3300037471 Bacteria 1257
622 Ga0395901_0005373 3300038443 Bacteria 12953
623 Ga0451853_3193447 3300041512 Bacteria 1119
624 Ga0439448_0039041 3300042005 Bacteria 1530
625 Ga0439462_0030382 3300042015 Bacteria 1429
626 Ga0450894_005019 3300042131 Bacteria 1711
627 Ga0439446_0244695 3300042156 Unclassified 617
628 Ga0439446_0250793 3300042156 Unclassified 610
629 Ga0439444_0078627 3300042437 Bacteria 718
630 Ga0451577_0483815 3300042876 Bacteria 1124
631 Ga0466969_0064432 3300044656 Unclassified 1774
632 Ga0466966_0162515 3300044684 Bacteria 1359
633 Ga0453684_0192184 3300044712 Bacteria 2387
634 Ga0466957_0213288 3300044842 Bacteria 1272
635 Ga0451576_0019886 3300045051 Bacteria 7323
636 Ga0451576_0218199 3300045051 Bacteria 1991
637 Ga0451576_1019418 3300045051 Bacteria 867
638 Ga0466967_0005004 3300045976 Bacteria 9079
639 Ga0466967_0406310 3300045976 Bacteria 1326
640 Ga0495603_0014167 3300046455 Bacteria 4824
641 Ga0495580_0315771 3300046472 Bacteria 1062
642 Ga0495582_0709344 3300046473 Unclassified 582
643 Ga0495594_0022374 3300046499 Bacteria 3381
644 Ga0495586_0239422 3300046535 Bacteria 1034
645 Ga0495622_0211113 3300046557 Unclassified 862
646 Ga0495670_0203821 3300046691 Bacteria 1048
647 Ga0495636_0026745 3300047318 Bacteria 2348
648 Ga0496100_0860174 3300048903 Bacteria 711
649 Ga0496106_0019817 3300048909 Bacteria 4987
650 Ga0496107_0970609 3300048910 Bacteria 617
651 Ga0496108_0130917 3300048911 Unclassified 2156
652 Ga0496109_0137832 3300048912 Bacteria 2281
653 Ga0496112_0422361 3300048915 Bacteria 1272
654 Ga0496113_0124975 3300048916 Bacteria 2014
655 Ga0496114_0017197 3300048917 Bacteria 5833
656 Ga0501036_0123062 3300049572 Bacteria 2191
657 Ga0501039_0243515 3300049575 Bacteria 1414
658 Ga0501040_0038121 3300049576 Bacteria 3267
659 Ga0501041_0119130 3300049577 Bacteria 1640
660 Ga0501042_0032730 3300049578 Bacteria 3683
661 Ga0501042_0090517 3300049578 Bacteria 2196
662 Ga0501042_0674616 3300049578 Bacteria 751
663 Ga0501067_0120775 3300049583 Bacteria 1458
664 Ga0501075_0113098 3300049591 Bacteria 2064
665 Ga0501075_0216750 3300049591 Bacteria 1460
666 Ga0501076_0177376 3300049592 Bacteria 1737
667 Ga0501076_0240473 3300049592 Bacteria 1481
668 Ga0501202_203531 3300049652 Unclassified 542
669 Ga0501247_047678 3300049677 Unclassified 628
670 Ga0501261_027162 3300049690 Bacteria 850
671 Ga0501079_0102460 3300049741 Bacteria 2220
672 Ga0501079_0279848 3300049741 Bacteria 1305
673 Ga0501079_0686420 3300049741 Bacteria 806
674 Ga0501080_0296575 3300049742 Bacteria 1467
675 Ga0501081_0314705 3300049743 Bacteria 1150
676 Ga0501083_0255777 3300049744 Bacteria 1140
677 Ga0501044_0591226 3300049823 Unclassified 1004
678 Ga0501045_0006710 3300049824 Bacteria 7975
679 nmdc:mga05p37_250486_c1 3300050507 Bacteria 2125
680 nmdc:mga05p37_25234_c1 3300050507 Bacteria 7227
681 nmdc:mga05p37_749592_c1 3300050507 Bacteria 1076
682 nmdc:mga05p37_841687_c1 3300050507 Unclassified 998
683 nmdc:mga09592_17168_c1 3300050508 Bacteria 5927
684 nmdc:mga09592_20657_c1 3300050508 Bacteria 5418
685 nmdc:mga09592_255042_c1 3300050508 Bacteria 1520
686 nmdc:mga09592_67409_c1 3300050508 Bacteria 3035
687 nmdc:mga0qj67_22271_c1 3300050509 Bacteria 4867
688 nmdc:mga0qj67_24729_c1 3300050509 Bacteria 4634
689 nmdc:mga0qj67_3124_c1 3300050509 Bacteria 11922
690 nmdc:mga06r32_53578_c1 3300050510 Bacteria 3865
691 nmdc:mga06r32_569257_c1 3300050510 Bacteria 1106
692 nmdc:mga06r32_775397_c1 3300050510 Bacteria 921
693 nmdc:mga06r32_852492_c1 3300050510 Bacteria 870
694 nmdc:mga08y16_1099716_c1 3300050511 Bacteria 770
695 nmdc:mga08y16_127858_c1 3300050511 Bacteria 2643
696 nmdc:mga08y16_355283_c1 3300050511 Bacteria 1505
697 nmdc:mga0n895_1346_c1 3300050512 Bacteria 18224
698 nmdc:mga0n895_1421231_c1 3300050512 Bacteria 662
699 nmdc:mga0n895_2625_c1 3300050512 Bacteria 14149
700 nmdc:mga0n895_6917_c1 3300050512 Bacteria 9691
701 nmdc:mga0rr50_94865_c1 3300050513 Bacteria 2331
702 nmdc:mga08x19_17936_c1 3300050514 Bacteria 4334
703 nmdc:mga08x19_84009_c1 3300050514 Bacteria 2094
704 nmdc:mga08x19_9633_c1 3300050514 Bacteria 5786
705 nmdc:mga08x19_97873_c1 3300050514 Bacteria 1943
706 nmdc:mga0a205_10342_c1 3300050515 Bacteria 8577
707 nmdc:mga0a205_37400_c1 3300050515 Bacteria 4667
708 nmdc:mga0a205_44896_c1 3300050515 Bacteria 3576
709 Ga0501084_0187191 3300054114 Bacteria 1747
710 Ga0501084_0260261 3300054114 Bacteria 1465
711 Ga0590077_076255 3300059426 Bacteria 769
712 Ga0501082_0210829 3300060353 Bacteria 1690
713 Ga0501082_0316320 3300060353 Bacteria 1360
714 Ga0070658_11052219
715 MBSR1b_contig_10993752
716 Ga0065712_10364293
717 Ga0065712_10497503
718 Ga0065715_10209553
719 Ga0065715_10351820
720 Ga0070658_10609886
721 Ga0070676_10004381
722 Ga0070676_10006960
723 Ga0070676_10071813
724 Ga0070683_100010082
725 Ga0070683_100030201
726 Ga0070683_100172042
727 Ga0070683_100250990
728 Ga0070690_100779376
729 Ga0070670_100013576
730 Ga0070670_100133419
731 Ga0070670_100181230
732 Ga0070670_100827359
733 Ga0070670_100951761
734 Ga0070677_10545340
735 Ga0068869_100024550
736 Ga0068869_100085778
737 Ga0070666_10144310
738 Ga0070680_100002238
739 Ga0070680_100079736
740 Ga0070680_100091770
741 Ga0070680_100174837
742 Ga0070682_100009648
743 Ga0070682_100189927
744 Ga0068868_100016583
745 Ga0070660_100687271
746 Ga0070660_100949621
747 Ga0070660_101158613
748 Ga0070689_100007804
749 Ga0070689_100238155
750 Ga0070691_10012993
751 Ga0070691_10066101
752 Ga0070691_10139886
753 Ga0070687_100189381
754 Ga0070661_100003761
755 Ga0070661_100010690
756 Ga0070661_100016018
757 Ga0070661_100053819
758 Ga0070661_100078323
759 Ga0070661_100254675
760 Ga0070661_100389761
761 Ga0070692_10011075
762 Ga0070692_10179528
763 Ga0070692_10462742
764 Ga0070668_100002904
765 Ga0070668_100032312
766 Ga0070668_100168227
767 Ga0070668_100296061
768 Ga0070669_100019178
769 Ga0070669_100039291
770 Ga0070669_100118650
771 Ga0070669_100406803
772 Ga0070675_100001661
773 Ga0070675_100009557
774 Ga0070675_100239311
775 Ga0070675_100471902
776 Ga0070675_100623224
777 Ga0070675_100636284
778 Ga0070671_100037881
779 Ga0070671_100089506
780 Ga0070671_100090433
781 Ga0070671_100815621
782 Ga0070671_100971412
783 Ga0070674_100005762
784 Ga0070674_100020405
785 Ga0070674_100137619
786 Ga0070674_100442306
787 Ga0070673_100010604
788 Ga0070673_101445557
789 Ga0070688_100049707
790 Ga0070659_100001454
791 Ga0070659_100035063
792 Ga0070659_100042934
793 Ga0070659_100288173
794 Ga0070659_100439073
795 Ga0070659_100566389
796 Ga0070667_100014476
797 Ga0070667_100040587
798 Ga0070667_100742178
799 Ga0070703_10001597
800 Ga0070703_10004801
801 Ga0070703_10027321
802 Ga0070709_10005390
803 Ga0070709_10071748
804 Ga0070709_10228111
805 Ga0070709_11068620
806 Ga0070714_100026372
807 Ga0070714_100591277
808 Ga0070714_101079615
809 Ga0070713_100759623
810 Ga0070710_10097561
811 Ga0070701_10002895
812 Ga0070711_100000063
813 Ga0070711_100290162
814 Ga0070705_100003672
815 Ga0070700_100044616
816 Ga0070694_100002393
817 Ga0070694_100007139
818 Ga0070694_100008081
819 Ga0070694_100256372
820 Ga0070708_100017525
821 Ga0070708_100420600
822 Ga0070708_100488426
823 Ga0070708_100820955
824 Ga0070663_100008355
825 Ga0070663_100021824
826 Ga0070663_100038762
827 Ga0070678_100051909
828 Ga0070678_100084745
829 Ga0070678_100438309
830 Ga0070662_100001961
831 Ga0070662_100004241
832 Ga0070662_100033697
833 Ga0070662_100183559
834 Ga0070662_100503131
835 Ga0070681_10001192
836 Ga0070681_10075802
837 Ga0070681_10108368
838 Ga0070681_10337260
839 Ga0070681_10379890
840 Ga0068867_100004107
841 Ga0068867_100049245
842 Ga0068867_100229002
843 Ga0070685_10016196
844 Ga0070706_100050479
845 Ga0070706_100120239
846 Ga0070706_100182537
847 Ga0070706_100861758
848 Ga0070707_100168634
849 Ga0070707_100530297
850 Ga0070698_100000360
851 Ga0070698_100008598
852 Ga0070698_100026323
853 Ga0070698_100281283
854 Ga0070698_101062799
855 Ga0070699_100006525
856 Ga0070699_100037597
857 Ga0070699_100076608
858 Ga0070699_100315359
859 Ga0070699_100937125
860 Ga0070679_100027193
861 Ga0070679_100041610
862 Ga0070679_100078306
863 Ga0070679_100084719
864 Ga0070679_100251612
865 Ga0070684_100005054
866 Ga0070684_100022465
867 Ga0070684_100077151
868 Ga0070684_100655246
869 Ga0070684_100987484
870 Ga0070697_100008933
871 Ga0070697_100036985
872 Ga0070697_100076605
873 Ga0068853_100074201
874 Ga0068853_100076284
875 Ga0068853_100110232
876 Ga0068853_100148134
877 Ga0070672_100004646
878 Ga0070672_100052796
879 Ga0070672_100299179
880 Ga0070672_100311852
881 Ga0070686_100606734
882 Ga0070695_100003953
883 Ga0070695_100015448
884 Ga0070695_100019954
885 Ga0070695_100049942
886 Ga0070696_100001802
887 Ga0070696_100008309
888 Ga0070696_100066123
889 Ga0070693_100805183
890 Ga0070665_100024001
891 Ga0070665_100092682
892 Ga0070704_100001020
893 Ga0070704_100015227
894 Ga0070704_100172429
895 Ga0068855_100007100
896 Ga0068855_100026559
897 Ga0068855_100096498
898 Ga0068855_100368317
899 Ga0070664_100010557
900 Ga0070664_100036381
901 Ga0070664_100054904
902 Ga0070664_100069771
903 Ga0070664_100091040
904 Ga0070664_100123800
905 Ga0070664_100552393
906 Ga0068857_100009475
907 Ga0068857_100014570
908 Ga0068857_100106433
909 Ga0068857_100232104
910 Ga0068854_100004244
911 Ga0068854_100014364
912 Ga0068854_100116344
913 Ga0068854_100128337
914 Ga0068854_100609111
915 Ga0068856_100018036
916 Ga0068856_100357154
917 Ga0068856_100372825
918 Ga0068856_101689425
919 Ga0070702_100010141
920 Ga0070702_100690862
921 Ga0068852_100037150
922 Ga0068852_100097864
923 Ga0068852_100178469
924 Ga0068852_100839864
925 Ga0068859_100060965
926 Ga0068859_100738437
927 Ga0068859_100926599
928 Ga0068864_100058006
929 Ga0068864_100180131
930 Ga0068864_100379458
931 Ga0068866_10000396
932 Ga0068866_10975832
933 Ga0068861_100018071
934 Ga0068861_100084742
935 Ga0068861_100184342
936 Ga0068861_100591974
937 Ga0068861_101060091
938 Ga0068851_10067247
939 Ga0068851_10814078
940 Ga0068870_10002264
941 Ga0068870_10081092
942 Ga0068863_100083253
943 Ga0068858_100027910
944 Ga0068858_100079511
945 Ga0068860_100008276
946 Ga0068860_100151798
947 Ga0068862_100000563
948 Ga0068862_100016777
949 Ga0068862_100370082
950 Ga0070716_100013974
951 Ga0070716_100032045
952 Ga0070712_100198323
953 Ga0097621_100028696
954 Ga0068871_100385989
955 Ga0068871_100427264
956 Ga0075428_100116530
957 Ga0075428_100173298
958 Ga0075428_100659367
959 Ga0075428_101382877
960 Ga0075430_100002009
961 Ga0075430_100013112
962 Ga0075430_100055453
963 Ga0075430_100103903
964 Ga0075430_100156810
965 Ga0075431_100005920
966 Ga0075431_100065851
967 Ga0075431_100191633
968 Ga0075431_100201027
969 Ga0075431_100296399
970 Ga0075431_100599435
971 Ga0075431_101240064
972 Ga0075433_10000099
973 Ga0075433_10012493
974 Ga0075434_100004057
975 Ga0075434_100055851
976 Ga0075434_100067408
977 Ga0075434_100115447
978 Ga0075429_100025615
979 Ga0075429_100031901
980 Ga0075429_100042420
981 Ga0075429_100067388
982 Ga0075429_101170217
983 Ga0068865_100023492
984 Ga0068865_100026342
985 Ga0068865_100745438
986 Ga0075436_100001526
987 Ga0075436_100002529
988 Ga0075436_100019281
989 Ga0075436_100029983
990 Ga0097620_100060955
991 Ga0097620_100738467
992 Ga0097620_100926522
993 Ga0075435_100038305
994 Ga0099794_10115068
995 Ga0099794_10246125
996 Ga0099795_10183975
997 Ga0105240_10032537
998 Ga0105240_10066320
999 Ga0105240_10094276
1000 Ga0105240_10112844
1001 Ga0105240_10286846
1002 Ga0105240_11946990
1003 Ga0111539_10118385
1004 Ga0111539_10416235
1005 Ga0111539_10848109
1006 Ga0105245_10024871
1007 Ga0105245_10043029
1008 Ga0114129_10003237
1009 Ga0114129_10018210
1010 Ga0114129_10041097
1011 Ga0114129_10659840
1012 Ga0114129_10777313
1013 Ga0105243_10059148
1014 Ga0105243_10133900
1015 Ga0105241_10004794
1016 Ga0105241_10358318
1017 Ga0105242_10004473
1018 Ga0105242_10336368
1019 Ga0105248_10018883
1020 Ga0105248_10071679
1021 Ga0105248_10111900
1022 Ga0105248_10112466
1023 Ga0105248_10385902
1024 Ga0105238_10004021
1025 Ga0105238_10132832
1026 Ga0105238_10363823
1027 Ga0105238_10546187
1028 Ga0105249_10000133
1029 Ga0105249_10000662
1030 Ga0105249_10005645
1031 Ga0105249_10088499
1032 Ga0105249_10468457
1033 Ga0099796_10039542
1034 Ga0105239_10042819
1035 Ga0105239_10217802
1036 Ga0105246_10025469
1037 Ga0105246_10814217
1038 Ga0157373_10028435
1039 Ga0157373_10180273
1040 Ga0157371_10033766
1041 Ga0157371_10035423
1042 Ga0157370_10008158
1043 Ga0157370_10093519
1044 Ga0157370_10590075
1045 Ga0157370_10725383
1046 Ga0157369_10015385
1047 Ga0157369_10055735
1048 Ga0157369_10280233
1049 Ga0157369_10608877
1050 Ga0157369_11261387
1051 Ga0157369_12107500
1052 Ga0157378_10086675
1053 Ga0157378_10339310
1054 Ga0157378_10741816
1055 Ga0157378_11881729
1056 Ga0163162_10021469
1057 Ga0163162_10158516
1058 Ga0163162_10473896
1059 Ga0157372_10025436
1060 Ga0157372_10085398
1061 Ga0157372_10093733
1062 Ga0157372_10109041
1063 Ga0157372_10130190
1064 Ga0157372_10331811
1065 Ga0157372_10695250
1066 Ga0157372_10805232
1067 Ga0157372_12725546
1068 Ga0157375_10006374
1069 Ga0157375_10114734
1070 Ga0157375_10162959
1071 Ga0157375_12713322
1072 Ga0163163_10038847
1073 Ga0163163_10546882
1074 Ga0157380_10001269
1075 Ga0157380_11043390
1076 Ga0182008_10001887
1077 Ga0157377_10003414
1078 Ga0157379_10009985
1079 Ga0157379_10052555
1080 Ga0157376_10119725
1081 Ga0157376_11766215
1082 Ga0182007_10050398
1083 Ga0163161_10027024
1084 Ga0197907_10333950
1085 Ga0206356_10916087
1086 Ga0206353_10474079
1087 Ga0207697_10033385
1088 Ga0207656_10038320
1089 Ga0207653_10001011
1090 Ga0207653_10016603
1091 Ga0207653_10020714
1092 Ga0207653_10069394
1093 Ga0207642_10001106
1094 Ga0207642_10329279
1095 Ga0207642_10341429
1096 Ga0207642_10515181
1097 Ga0207688_10046677
1098 Ga0207680_10244077
1099 Ga0207647_10040350
1100 Ga0207699_10007630
1101 Ga0207699_10051807
1102 Ga0207699_10209867
1103 Ga0207645_10006068
1104 Ga0207645_10007630
1105 Ga0207643_10035329
1106 Ga0207643_10052872
1107 Ga0207643_10075973
1108 Ga0207705_10212956
1109 Ga0207684_10003109
1110 Ga0207684_10006288
1111 Ga0207684_10621598
1112 Ga0207707_10003275
1113 Ga0207707_10031715
1114 Ga0207707_10055419
1115 Ga0207707_10084141
1116 Ga0207695_10036015
1117 Ga0207695_10054884
1118 Ga0207695_10142662
1119 Ga0207695_10802493
1120 Ga0207693_10492649
1121 Ga0207663_10000066
1122 Ga0207663_10219106
1123 Ga0207660_10074666
1124 Ga0207660_10083319
1125 Ga0207660_10105973
1126 Ga0207662_10001456
1127 Ga0207662_10190889
1128 Ga0207657_10105584
1129 Ga0207649_10004268
1130 Ga0207649_10020418
1131 Ga0207649_10085541
1132 Ga0207649_10123001
1133 Ga0207649_10236975
1134 Ga0207649_10374740
1135 Ga0207652_10050915
1136 Ga0207652_10192663
1137 Ga0207652_10336273
1138 Ga0207646_10001173
1139 Ga0207646_10001261
1140 Ga0207646_10001743
1141 Ga0207646_10002799
1142 Ga0207646_10003468
1143 Ga0207646_10005458
1144 Ga0207646_10127632
1145 Ga0207681_10042969
1146 Ga0207681_10119367
1147 Ga0207681_10194051
1148 Ga0207681_10228343
1149 Ga0207694_10493582
1150 Ga0207694_10504630
1151 Ga0207650_10028340
1152 Ga0207650_10132643
1153 Ga0207650_10913610
1154 Ga0207650_11359144
1155 Ga0207659_10020893
1156 Ga0207659_10026481
1157 Ga0207659_10034004
1158 Ga0207687_10024522
1159 Ga0207687_10061042
1160 Ga0207700_10034195
1161 Ga0207664_10026031
1162 Ga0207664_10033015
1163 Ga0207664_10483876
1164 Ga0207644_10072715
1165 Ga0207644_10180910
1166 Ga0207644_10293640
1167 Ga0207644_10918610
1168 Ga0207690_10009969
1169 Ga0207690_10042710
1170 Ga0207690_10153401
1171 Ga0207706_10000155
1172 Ga0207706_10000632
1173 Ga0207706_10088595
1174 Ga0207686_10000712
1175 Ga0207686_10051080
1176 Ga0207709_10029683
1177 Ga0207709_11070041
1178 Ga0207670_10094161
1179 Ga0207670_11020223
1180 Ga0207669_10000540
1181 Ga0207669_10019424
1182 Ga0207669_10325411
1183 Ga0207704_10001012
1184 Ga0207704_10015704
1185 Ga0207704_10039945
1186 Ga0207704_10708671
1187 Ga0207665_10016481
1188 Ga0207665_10021110
1189 Ga0207691_10001667
1190 Ga0207691_10002873
1191 Ga0207691_10293469
1192 Ga0207691_10404759
1193 Ga0207711_10002131
1194 Ga0207711_10286202
1195 Ga0207711_10410705
1196 Ga0207711_10549574
1197 Ga0207711_11504459
1198 Ga0207689_10002158
1199 Ga0207689_10002528
1200 Ga0207661_10057765
1201 Ga0207661_10167001
1202 Ga0207679_10001557
1203 Ga0207679_10002457
1204 Ga0207679_10010095
1205 Ga0207679_10129668
1206 Ga0207679_10130536
1207 Ga0207679_10464949
1208 Ga0207667_10029575
1209 Ga0207667_10031049
1210 Ga0207667_10035036
1211 Ga0207667_10488134
1212 Ga0207651_10703919
1213 Ga0207712_10000098
1214 Ga0207712_10000892
1215 Ga0207712_10006933
1216 Ga0207712_10030631
1217 Ga0207668_10004444
1218 Ga0207668_10022463
1219 Ga0207668_10052146
1220 Ga0207640_10015447
1221 Ga0207640_10114406
1222 Ga0207640_10194793
1223 Ga0207640_10471531
1224 Ga0207640_11523393
1225 Ga0207658_10035910
1226 Ga0207658_10264149
1227 Ga0207677_10146290
1228 Ga0207677_10349810
1229 Ga0207677_10804621
1230 Ga0207703_10837849
1231 Ga0207639_10014233
1232 Ga0207639_10017698
1233 Ga0207639_10053210
1234 Ga0207678_10067512
1235 Ga0207678_10258538
1236 Ga0207708_10014950
1237 Ga0207708_10049485
1238 Ga0207708_10054665
1239 Ga0207702_10052706
1240 Ga0207702_10453405
1241 Ga0207702_10572486
1242 Ga0207702_11258212
1243 Ga0207641_10154272
1244 Ga0207648_10001121
1245 Ga0207648_10016415
1246 Ga0207648_10122403
1247 Ga0207648_10353919
1248 Ga0207648_11294258
1249 Ga0207676_10019772
1250 Ga0207676_10046437
1251 Ga0207676_10049150
1252 Ga0207676_10188579
1253 Ga0207674_10001550
1254 Ga0207674_10001551
1255 Ga0207674_10004982
1256 Ga0207674_10017983
1257 Ga0207674_10109385
1258 Ga0207675_100001026
1259 Ga0207675_100086073
1260 Ga0207675_100717463
1261 Ga0207683_10053585
1262 Ga0207683_10116397
1263 Ga0207683_10373087
1264 Ga0207698_10039732
1265 Ga0207698_10075498
1266 Ga0207698_11505787
1267 Ga0207428_10319421
1268 Ga0268266_10040493
1269 Ga0268266_10266601
1270 Ga0268266_10356235
1271 Ga0268265_10003561
1272 Ga0268265_10012541
1273 Ga0268265_10025393
1274 Ga0268265_10269121
1275 Ga0268264_10040011
1276 Ga0268264_10967962
1277 Ga0265332_10003146
1278 Ga0265327_10079221
1279 Ga0307408_100033611
1280 Ga0307408_100370241
1281 Ga0265314_10013156
1282 Ga0307405_10010082
1283 Ga0307405_10012954
1284 Ga0307405_10113504
1285 Ga0307405_10548692
1286 Ga0307413_10000588
1287 Ga0307413_10110610
1288 Ga0307413_10167564
1289 Ga0307413_10472124
1290 Ga0307413_10645459
1291 Ga0307410_10008824
1292 Ga0307410_10012850
1293 Ga0307410_10066404
1294 Ga0307410_10236549
1295 Ga0307410_10440130
1296 Ga0307410_10598189
1297 Ga0307406_10001667
1298 Ga0307406_10032347
1299 Ga0307406_10047040
1300 Ga0307407_10001245
1301 Ga0307407_10018611
1302 Ga0307407_10154793
1303 Ga0307407_10280055
1304 Ga0307412_10010351
1305 Ga0307412_10063227
1306 Ga0307409_100017363
1307 Ga0307409_100025800
1308 Ga0307409_100198873
1309 Ga0307409_100465222
1310 Ga0307409_101514531
1311 Ga0307409_101965696
1312 Ga0307416_100012575
1313 Ga0307416_100023653
1314 Ga0307416_100082932
1315 Ga0307416_101775638
1316 Ga0307416_102287195
1317 Ga0307414_10004995
1318 Ga0307414_10141619
1319 Ga0307411_10000266
1320 Ga0307411_10009129
1321 Ga0307411_10560895
1322 Ga0307415_100003789
1323 Ga0307415_100009913
1324 Ga0307415_100186435
1325 Ga0373944_0070761
1326 Ga0373946_0156456
1327 Ga0373947_0298272
1328 Ga0373947_0895436
1329 Ga0395899_0054189
1330 Ga0395900_0019850
1331 Ga0395898_1179730
1332 Ga0395905_0004652
1333 Ga0395905_0077015
1334 Ga0395905_0406131
1335 Ga0395901_0005373
1336 Ga0451853_3193447
1337 Ga0439448_0039041
1338 Ga0439462_0030382
1339 Ga0450894_005019
1340 Ga0439446_0244695
1341 Ga0439446_0250793
1342 Ga0439444_0078627
1343 Ga0451577_0483815
1344 Ga0466969_0064432
1345 Ga0466966_0162515
1346 Ga0453684_0192184
1347 Ga0466957_0213288
1348 Ga0451576_0019886
1349 Ga0451576_0218199
1350 Ga0451576_1019418
1351 Ga0466967_0005004
1352 Ga0466967_0406310
1353 Ga0495603_0014167
1354 Ga0495580_0315771
1355 Ga0495582_0709344
1356 Ga0495594_0022374
1357 Ga0495586_0239422
1358 Ga0495622_0211113
1359 Ga0495670_0203821
1360 Ga0495636_0026745
1361 Ga0496100_0860174
1362 Ga0496106_0019817
1363 Ga0496107_0970609
1364 Ga0496108_0130917
1365 Ga0496109_0137832
1366 Ga0496112_0422361
1367 Ga0496113_0124975
1368 Ga0496114_0017197
1369 Ga0501036_0123062
1370 Ga0501039_0243515
1371 Ga0501040_0038121
1372 Ga0501041_0119130
1373 Ga0501042_0032730
1374 Ga0501042_0090517
1375 Ga0501042_0674616
1376 Ga0501067_0120775
1377 Ga0501075_0113098
1378 Ga0501075_0216750
1379 Ga0501076_0177376
1380 Ga0501076_0240473
1381 Ga0501202_203531
1382 Ga0501247_047678
1383 Ga0501261_027162
1384 Ga0501079_0102460
1385 Ga0501079_0279848
1386 Ga0501079_0686420
1387 Ga0501080_0296575
1388 Ga0501081_0314705
1389 Ga0501083_0255777
1390 Ga0501044_0591226
1391 Ga0501045_0006710
1392 nmdc:mga05p37_250486_c1
1393 nmdc:mga05p37_25234_c1
1394 nmdc:mga05p37_749592_c1
1395 nmdc:mga05p37_841687_c1
1396 nmdc:mga09592_17168_c1
1397 nmdc:mga09592_20657_c1
1398 nmdc:mga09592_255042_c1
1399 nmdc:mga09592_67409_c1
1400 nmdc:mga0qj67_22271_c1
1401 nmdc:mga0qj67_24729_c1
1402 nmdc:mga0qj67_3124_c1
1403 nmdc:mga06r32_53578_c1
1404 nmdc:mga06r32_569257_c1
1405 nmdc:mga06r32_775397_c1
1406 nmdc:mga06r32_852492_c1
1407 nmdc:mga08y16_1099716_c1
1408 nmdc:mga08y16_127858_c1
1409 nmdc:mga08y16_355283_c1
1410 nmdc:mga0n895_1346_c1
1411 nmdc:mga0n895_1421231_c1
1412 nmdc:mga0n895_2625_c1
1413 nmdc:mga0n895_6917_c1
1414 nmdc:mga0rr50_94865_c1
1415 nmdc:mga08x19_17936_c1
1416 nmdc:mga08x19_84009_c1
1417 nmdc:mga08x19_9633_c1
1418 nmdc:mga08x19_97873_c1
1419 nmdc:mga0a205_10342_c1
1420 nmdc:mga0a205_37400_c1
1421 nmdc:mga0a205_44896_c1
1422 Ga0501084_0187191
1423 Ga0501084_0260261
1424 Ga0590077_076255
1425 Ga0501082_0210829
1426 Ga0501082_0316320

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03830

PTSIIB_sorb

PTS system sorbose subfamily IIB component

6

159

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3eye-assembly1.cif.gz_A crystal structure of pts system n-acetylgalactosamine-specific iib component 1 from escherichia coli 0.9145 3 151
5t5d-assembly1.cif.gz_A crystal structure of the pts iib protein associated with the fucose utilization operon from streptococcus pneumoniae 0.9027 3 155
3p3v-assembly1.cif.gz_A crystal structure of a pts dependent n-acetyl-galactosamine-iib component (agav, spy_0631) from streptococcus pyogenes at 1.65 a resolution 0.894 1 155
3eye-assembly1.cif.gz_A crystal structure of pts system n-acetylgalactosamine-specific iib component 1 from escherichia coli 0.8864 3 151
1ble-assembly1.cif.gz_A phosphoenolpyruvate-dependent phosphotransferase system 0.8859 1 158
ID Description Score Start End Superfamily
af_P42904_1_156_3.40.35.10 Alpha Beta;3-Layer(aba) Sandwich;Fructose Permease;Phosphotransferase system, sorbose subfamily IIB component 0.9218 1 155 3.40.35.10
3eyeA00 Alpha Beta;3-Layer(aba) Sandwich;Fructose Permease;Phosphotransferase system, sorbose subfamily IIB component 0.9145 3 151 3.40.35.10
af_P42904_1_156_3.40.35.10 Alpha Beta;3-Layer(aba) Sandwich;Fructose Permease;Phosphotransferase system, sorbose subfamily IIB component 0.9106 1 155 3.40.35.10
5t5dA00 Alpha Beta;3-Layer(aba) Sandwich;Fructose Permease;Phosphotransferase system, sorbose subfamily IIB component 0.9027 3 155 3.40.35.10
af_P69797_159_323_3.40.35.10 Alpha Beta;3-Layer(aba) Sandwich;Fructose Permease;Phosphotransferase system, sorbose subfamily IIB component 0.8902 1 162 3.40.35.10
ID Description Score Start End GO Terms
AF-A0A2V7ED61-F1-model_v4 PTS EIIB type-4 domain-containing protein 0.9965 1 100 GO:0005737
GO:0005886
GO:0008982
GO:0009401
GO:0016301
AF-A0A2V7JRT8-F1-model_v4 PTS EIIB type-4 domain-containing protein 0.9944 20 159 GO:0005737
GO:0008982
GO:0009401
GO:0016301
AF-A0A2V7T0X9-F1-model_v4 PTS EIIB type-4 domain-containing protein 0.9887 2 159 GO:0005737
GO:0008982
GO:0009401
GO:0016301
AF-A0A1Q7KC78-F1-model_v4 PTS EIIB type-4 domain-containing protein 0.9877 1 156 GO:0005737
GO:0008982
GO:0009401
GO:0016301
AF-A0A1E4B7F9-F1-model_v4 PTS EIIB type-4 domain-containing protein 0.985 3 160 GO:0005737
GO:0008982
GO:0009401
GO:0016301

Map