F476769

General Info

Members Datasets Scaffolds Average Seq Length
711 373 662 267

Family's Representative Sequence

Representative Sequence 3300006946|Ga0079104_1000008|Ga0079104_1000008180
Length 277
Sequence MFSQELLTQLAQELDRSEKTRVQVEHFSKRFPGMTVEDGYRVSREWVRLQIAAGRKVIGHKIGLTSRAMQISSQIDEPDYGTLLDSMLYRCTPGQVLDIPAAHFIAPRVEVELAFVLKAPLRGPGLPGGKEITLQDVLDATDHVTPAIEIIDARIEQFDRHTKAMRKVYDTISDNAANAGIVVGAGQAVPGVLDLPWCGAILRCNGVVEETGLAAGVQGHPAIGVAWLANKLSPWGEALEAGQTVLAGSFTRPVAARAGDLFDADYGPLGRLQFRFV

Samples

Sample ID Description Type Environment
1 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
2 2519103095 Burkholderia sp. KJ006 Isolate Nodule
3 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
4 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
5 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
6 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
7 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
8 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
9 2643221658 Variovorax sp. Root411 Isolate Unclassified
10 2643221672 Variovorax sp. Root434 Isolate Unclassified
11 2643221683 Variovorax sp. Root473 Isolate Unclassified
12 2721755523 Delftia sp. HK171 Isolate Unclassified
13 2738541277 Variovorax sp. GV051 Isolate Unclassified
14 2738541307 Variovorax sp. GV008 Isolate Unclassified
15 2738543019 Variovorax sp. GV040 Isolate Unclassified
16 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
17 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
18 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
19 2818991446 Variovorax sp. 1180 Isolate Unclassified
20 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
21 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
22 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
23 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
24 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
25 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
26 2885198086 Variovorax sp. 679 Isolate Unclassified
27 2885211737 Variovorax sp. 553 Isolate Unclassified
28 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
29 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
30 2904456579 Variovorax sp. 2002 Isolate Unclassified
31 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
32 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
33 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
34 2928037797 Variovorax sp. 1126 Isolate Unclassified
35 2928044640 Variovorax sp. 1128 Isolate Unclassified
36 2928051484 Variovorax sp. 1133 Isolate Unclassified
37 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
38 2928070936 Variovorax gossypii 1167 Isolate Unclassified
39 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
40 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
41 2929520902 Variovorax beijingensis 502 Isolate Unclassified
42 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
43 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
44 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
45 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
46 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
47 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
48 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
49 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
50 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
51 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
52 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
53 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
54 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
55 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
56 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
57 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
58 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
59 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
60 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
61 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
62 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
63 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
64 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
65 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
66 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
67 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
68 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
69 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
70 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
71 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
72 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
73 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
74 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
75 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
76 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
77 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
78 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
79 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
80 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
81 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
82 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
83 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
84 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
85 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
86 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
87 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
88 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
89 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
90 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
91 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
92 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
93 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
94 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
95 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
96 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
97 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
98 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
99 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
100 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
101 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
102 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
103 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
104 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
105 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
106 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
107 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
108 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
109 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
110 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
111 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
112 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
113 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
114 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
115 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
116 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
117 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
118 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
119 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
120 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
121 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
122 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
123 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
124 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
125 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
126 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
127 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
128 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
129 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
130 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
131 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
132 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
133 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
134 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
135 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
136 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
137 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
138 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
139 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
140 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
141 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
142 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
143 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
144 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
145 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
146 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
147 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
148 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
149 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
150 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
154 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
156 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
157 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
159 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
160 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
161 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
163 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
164 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
165 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
167 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
168 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
222 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
224 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
228 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
229 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
230 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
231 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
232 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
233 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
234 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
235 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
236 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
237 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
238 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
239 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
240 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
241 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
242 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
243 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
244 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
245 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
246 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
247 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
248 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
249 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
250 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
251 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
252 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
253 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
254 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
255 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
256 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
257 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
258 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
259 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
260 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
261 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
262 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
263 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
264 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
265 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
266 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
267 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
268 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
269 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
270 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
271 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
272 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
273 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
274 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
275 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
276 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
277 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
278 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
279 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
280 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
281 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
282 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
283 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
284 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
285 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
286 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
287 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
288 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
289 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
290 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
291 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
292 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
293 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
294 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
295 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
296 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
297 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
298 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
299 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
300 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
301 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
302 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
303 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
304 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
305 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
306 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
307 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
308 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
309 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
310 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
311 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
312 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
313 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
314 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
315 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
316 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
317 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
318 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
319 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
320 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
321 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
322 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
323 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
324 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
325 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
326 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
327 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
328 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
329 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
330 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
331 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
332 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
333 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
334 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
335 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
336 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
337 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
338 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
339 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
344 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
345 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
346 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
347 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
348 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
349 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
350 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
351 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
352 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
353 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
354 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
355 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
356 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
357 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
358 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
359 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
360 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
361 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
362 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
363 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
364 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
365 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
366 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
367 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
368 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
369 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
370 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
371 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
372 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
373 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.11
Metatranscriptomes 0
Isolates 6.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 23.63
Nodule 1.13
Rhizoplane 2.67
Rhizosphere 60.48
Stem 0
Stem Tuber 0
Unclassified 12.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25150J39212_1001772 3300002774 Bacteria 5748
2 JGI25150J39212_1014412 3300002774 Bacteria 1344
3 JGI25151J46595_10012355 3300003187 Bacteria 3889
4 JGI25153J46596_10018590 3300003215 Bacteria 2694
5 JGI25160J50197_1013974 3300003354 Bacteria 2708
6 JGI25161J50226_1004864 3300003374 Bacteria 2736
7 JGI25161J50226_1009372 3300003374 Bacteria 1401
8 Ga0055527_1006839 3300003760 Bacteria 1415
9 Ga0055535_1000260 3300003761 Bacteria 55578
10 Ga0055542_1000013 3300003762 Bacteria 387560
11 Ga0055529_1002592 3300003763 Bacteria 3378
12 Ga0055526_1014267 3300003771 Bacteria 3282
13 Ga0055526_1017494 3300003771 Bacteria 2733
14 Ga0055537_1000922 3300003773 Bacteria 13775
15 Ga0055524_1015825 3300003775 Bacteria 2733
16 Ga0055524_1016512 3300003775 Bacteria 2644
17 Ga0055534_1000138 3300003784 Bacteria 54891
18 Ga0055528_1003358 3300003790 Bacteria 8086
19 Ga0055530_10029344 3300003791 Bacteria 1471
20 Ga0055540_1002855 3300003792 Bacteria 8790
21 Ga0055540_1003737 3300003792 Bacteria 7194
22 Ga0055540_1003745 3300003792 Bacteria 7187
23 Ga0055531_10000248 3300003794 Bacteria 58150
24 Ga0055531_10058180 3300003794 Bacteria 963
25 Ga0055543_1002039 3300004625 Bacteria 7094
26 Ga0055543_1004369 3300004625 Bacteria 3874
27 Ga0065165_1007017 3300005262 Bacteria 5679
28 Ga0065165_1036092 3300005262 Bacteria 1511
29 Ga0065714_10095103 3300005288 Bacteria 1790
30 Ga0070658_10060456 3300005327 Bacteria 3086
31 Ga0070658_10240717 3300005327 Bacteria 1534
32 Ga0070676_10294542 3300005328 Bacteria 1098
33 Ga0070670_100116518 3300005331 Bacteria 2303
34 Ga0070670_100366897 3300005331 Bacteria 1267
35 Ga0070677_10004569 3300005333 Bacteria 4524
36 Ga0070677_10026341 3300005333 Bacteria 2179
37 Ga0070677_10041514 3300005333 Bacteria 1817
38 Ga0068869_100027667 3300005334 Bacteria 3956
39 Ga0068868_100058993 3300005338 Bacteria 3034
40 Ga0070660_100006337 3300005339 Bacteria 8197
41 Ga0070668_100174073 3300005347 Bacteria 1754
42 Ga0070669_100042109 3300005353 Bacteria 3323
43 Ga0070675_100003640 3300005354 Bacteria 11721
44 Ga0070675_100396320 3300005354 Bacteria 1231
45 Ga0070671_100003362 3300005355 Bacteria 12479
46 Ga0070671_100094857 3300005355 Bacteria 2501
47 Ga0070673_100013143 3300005364 Bacteria 5715
48 Ga0070673_100148408 3300005364 Bacteria 1984
49 Ga0070673_100630742 3300005364 Bacteria 980
50 Ga0070688_100072960 3300005365 Bacteria 2201
51 Ga0070667_100018875 3300005367 Bacteria 5717
52 Ga0070667_100375375 3300005367 Bacteria 1291
53 Ga0070714_100014672 3300005435 Bacteria 6295
54 Ga0070713_100015395 3300005436 Bacteria 5715
55 Ga0070700_100135469 3300005441 Bacteria 1667
56 Ga0070678_100003291 3300005456 Bacteria 8984
57 Ga0070678_100014948 3300005456 Bacteria 4916
58 Ga0070678_100031946 3300005456 Bacteria 3638
59 Ga0070662_100489586 3300005457 Bacteria 1025
60 Ga0070679_100010359 3300005530 Bacteria 8842
61 Ga0070679_100209585 3300005530 Bacteria 1913
62 Ga0068853_100137681 3300005539 Bacteria 2190
63 Ga0070672_100021540 3300005543 Bacteria 4719
64 Ga0070672_100147814 3300005543 Bacteria 1942
65 Ga0070686_100134465 3300005544 Bacteria 1714
66 Ga0070665_100062004 3300005548 Bacteria 3749
67 Ga0070665_100501927 3300005548 Bacteria 1224
68 Ga0068855_100042747 3300005563 Bacteria 5369
69 Ga0068857_100030061 3300005577 Bacteria 4793
70 Ga0068857_100187432 3300005577 Bacteria 1884
71 Ga0068854_100180519 3300005578 Bacteria 1649
72 Ga0068856_100103102 3300005614 Bacteria 2847
73 Ga0068859_100013199 3300005617 Bacteria 8294
74 Ga0068859_100037016 3300005617 Bacteria 4898
75 Ga0068859_100318716 3300005617 Bacteria 1649
76 Ga0068864_100002240 3300005618 Bacteria 15980
77 Ga0068864_100074998 3300005618 Bacteria 2952
78 Ga0068861_100016474 3300005719 Bacteria 5231
79 Ga0068851_10004053 3300005834 Bacteria 6577
80 Ga0068863_100005528 3300005841 Bacteria 12426
81 Ga0068863_100044781 3300005841 Bacteria 4199
82 Ga0068858_100003274 3300005842 Bacteria 16136
83 Ga0068858_100004778 3300005842 Bacteria 13269
84 Ga0068858_100047756 3300005842 Bacteria 3968
85 Ga0068860_100000371 3300005843 Bacteria 59118
86 Ga0068860_100001058 3300005843 Bacteria 30353
87 Ga0068860_100323975 3300005843 Bacteria 1513
88 Ga0068862_100031775 3300005844 Bacteria 4459
89 Ga0068862_100102662 3300005844 Bacteria 2503
90 Ga0068862_100106247 3300005844 Bacteria 2461
91 Ga0070717_10063928 3300006028 Bacteria 3055
92 Ga0075365_10046394 3300006038 Bacteria 2853
93 Ga0075365_10053524 3300006038 Bacteria 2674
94 Ga0075365_10056202 3300006038 Bacteria 2616
95 Ga0075365_10083672 3300006038 Bacteria 2164
96 Ga0075365_10128873 3300006038 Bacteria 1750
97 Ga0075363_100033381 3300006048 Bacteria 2679
98 Ga0075363_100039475 3300006048 Bacteria 2485
99 Ga0075363_100089811 3300006048 Bacteria 1690
100 Ga0075363_100134968 3300006048 Bacteria 1386
101 Ga0075364_10030718 3300006051 Bacteria 3449
102 Ga0075364_10117244 3300006051 Bacteria 1780
103 Ga0075362_10002917 3300006177 Bacteria 5861
104 Ga0075362_10006043 3300006177 Bacteria 4482
105 Ga0075362_10022445 3300006177 Bacteria 2659
106 Ga0075362_10022701 3300006177 Bacteria 2646
107 Ga0075362_10025590 3300006177 Bacteria 2514
108 Ga0075362_10188392 3300006177 Bacteria 1001
109 Ga0075367_10156135 3300006178 Bacteria 1418
110 Ga0075367_10181554 3300006178 Bacteria 1312
111 Ga0075369_10112772 3300006186 Bacteria 1226
112 Ga0075366_10001720 3300006195 Bacteria 11004
113 Ga0075366_10002197 3300006195 Bacteria 9957
114 Ga0075366_10015615 3300006195 Bacteria 4357
115 Ga0075366_10054941 3300006195 Bacteria 2365
116 Ga0075366_10066711 3300006195 Bacteria 2141
117 Ga0075366_10114721 3300006195 Bacteria 1622
118 Ga0075366_10182753 3300006195 Bacteria 1274
119 Ga0097621_100009715 3300006237 Bacteria 6999
120 Ga0097621_100040702 3300006237 Bacteria 3738
121 Ga0097621_100294537 3300006237 Bacteria 1432
122 Ga0097621_100506586 3300006237 Bacteria 1094
123 Ga0097621_100707771 3300006237 Bacteria 928
124 Ga0075370_10000534 3300006353 Bacteria 14576
125 Ga0075370_10010367 3300006353 Bacteria 4871
126 Ga0075370_10010499 3300006353 Bacteria 4842
127 Ga0075370_10013279 3300006353 Bacteria 4373
128 Ga0075370_10014006 3300006353 Bacteria 4270
129 Ga0075370_10014626 3300006353 Bacteria 4190
130 Ga0075370_10030994 3300006353 Bacteria 2984
131 Ga0075370_10032676 3300006353 Bacteria 2910
132 Ga0075370_10059761 3300006353 Bacteria 2170
133 Ga0075370_10072475 3300006353 Bacteria 1972
134 Ga0068871_100024386 3300006358 Bacteria 4690
135 Ga0068871_100743921 3300006358 Bacteria 901
136 Ga0068865_100245885 3300006881 Bacteria 1410
137 Ga0068865_100272018 3300006881 Bacteria 1345
138 Ga0075436_100029938 3300006914 Bacteria 3745
139 Ga0097620_100013199 3300006931 Bacteria 8294
140 Ga0097620_100037016 3300006931 Bacteria 4898
141 Ga0097620_100318712 3300006931 Bacteria 1649
142 Ga0079104_1000008 3300006946 Bacteria 371223
143 Ga0099826_10018923 3300006948 Bacteria 5186
144 Ga0075435_100004686 3300007076 Bacteria 9430
145 Ga0105244_10001247 3300009036 Bacteria 20853
146 Ga0105244_10010868 3300009036 Bacteria 5495
147 Ga0105250_10000043 3300009092 Bacteria 129336
148 Ga0105240_10003831 3300009093 Bacteria 23258
149 Ga0105240_10054320 3300009093 Bacteria 5020
150 Ga0105245_10046840 3300009098 Bacteria 3864
151 Ga0105245_10603297 3300009098 Bacteria 1124
152 Ga0105247_10008264 3300009101 Bacteria 6352
153 Ga0105243_10001568 3300009148 Bacteria 19974
154 Ga0105243_10002163 3300009148 Bacteria 16598
155 Ga0105243_10004514 3300009148 Bacteria 11003
156 Ga0105243_10048919 3300009148 Bacteria 3334
157 Ga0105243_10072505 3300009148 Bacteria 2788
158 Ga0105241_10495594 3300009174 Bacteria 1088
159 Ga0105242_10100850 3300009176 Bacteria 2446
160 Ga0105242_10162328 3300009176 Bacteria 1957
161 Ga0105248_10026007 3300009177 Bacteria 6510
162 Ga0105248_10195703 3300009177 Bacteria 2278
163 Ga0105237_10083745 3300009545 Bacteria 3180
164 Ga0105237_10342139 3300009545 Bacteria 1500
165 Ga0105238_10056308 3300009551 Bacteria 3945
166 Ga0105249_10078699 3300009553 Bacteria 3059
167 Ga0099796_10002453 3300010159 Bacteria 4067
168 Ga0105239_10143210 3300010375 Bacteria 2665
169 Ga0105239_10198599 3300010375 Bacteria 2247
170 Ga0105239_10444889 3300010375 Bacteria 1470
171 Ga0105239_10943188 3300010375 Bacteria 991
172 Ga0105246_10635010 3300011119 Bacteria 927
173 Ga0157370_10124733 3300013104 Bacteria 2404
174 Ga0157369_10026781 3300013105 Bacteria 6394
175 Ga0157374_10537236 3300013296 Bacteria 1176
176 Ga0157378_10015128 3300013297 Bacteria 6755
177 Ga0157378_10092181 3300013297 Bacteria 2756
178 Ga0157378_10127355 3300013297 Bacteria 2354
179 Ga0163162_10003522 3300013306 Bacteria 14976
180 Ga0163162_10268555 3300013306 Bacteria 1837
181 Ga0157372_10062587 3300013307 Bacteria 4170
182 Ga0157375_10017779 3300013308 Bacteria 6429
183 Ga0157375_10020971 3300013308 Bacteria 5981
184 Ga0157375_10095185 3300013308 Bacteria 3048
185 Ga0157375_11051467 3300013308 Bacteria 952
186 Ga0163163_10064045 3300014325 Bacteria 3648
187 Ga0163163_10100384 3300014325 Bacteria 2916
188 Ga0163163_10135649 3300014325 Bacteria 2502
189 Ga0163163_10154346 3300014325 Bacteria 2340
190 Ga0163163_10402479 3300014325 Bacteria 1427
191 Ga0163163_10665290 3300014325 Bacteria 1105
192 Ga0182008_10004684 3300014497 Bacteria 7943
193 Ga0182008_10012898 3300014497 Bacteria 4400
194 Ga0182008_10020966 3300014497 Bacteria 3361
195 Ga0157379_10019351 3300014968 Bacteria 6013
196 Ga0157379_10267110 3300014968 Bacteria 1555
197 Ga0157376_10144267 3300014969 Bacteria 2140
198 Ga0182006_1009529 3300015261 Bacteria 4349
199 Ga0182007_10000359 3300015262 Bacteria 28779
200 Ga0182007_10095711 3300015262 Bacteria 980
201 Ga0183362_10004 3300015683 Bacteria 569303
202 Ga0163161_10000842 3300017792 Bacteria 23934
203 Ga0163161_10001977 3300017792 Bacteria 14877
204 Ga0213872_10008739 3300021361 Bacteria 4890
205 Ga0209436_103311 3300025208 Bacteria 4343
206 Ga0209672_100958 3300025228 Bacteria 12844
207 Ga0209147_100771 3300025229 Bacteria 15623
208 Ga0209258_100020 3300025242 Bacteria 565241
209 Ga0209258_110342 3300025242 Bacteria 1215
210 Ga0207425_1000286 3300025245 Bacteria 36973
211 Ga0207425_1008461 3300025245 Bacteria 2629
212 Ga0209148_1000031 3300025254 Bacteria 564601
213 Ga0209129_1000406 3300025258 Bacteria 33954
214 Ga0209565_1000078 3300025263 Bacteria 160838
215 Ga0209565_1000181 3300025263 Bacteria 77793
216 Ga0209565_1003024 3300025263 Bacteria 5683
217 Ga0209565_1015625 3300025263 Bacteria 1707
218 Ga0209455_1001046 3300025272 Bacteria 13728
219 Ga0209673_1000442 3300025273 Bacteria 71413
220 Ga0209673_1001199 3300025273 Bacteria 27809
221 Ga0209673_1001899 3300025273 Bacteria 16769
222 Ga0209673_1003029 3300025273 Bacteria 10414
223 Ga0209130_1000443 3300025284 Bacteria 43777
224 Ga0209130_1000673 3300025284 Bacteria 30982
225 Ga0209675_1000055 3300025291 Bacteria 193129
226 Ga0209675_1000339 3300025291 Bacteria 40950
227 Ga0209675_1001290 3300025291 Bacteria 14889
228 Ga0209675_1042746 3300025291 Bacteria 980
229 Ga0209676_1000040 3300025292 Bacteria 438184
230 Ga0209676_1000312 3300025292 Bacteria 95234
231 Ga0209676_1039785 3300025292 Bacteria 1331
232 Ga0209025_1000242 3300025294 Bacteria 128169
233 Ga0209025_1000512 3300025294 Bacteria 74071
234 Ga0209025_1001359 3300025294 Bacteria 32831
235 Ga0209025_1001384 3300025294 Bacteria 32381
236 Ga0209025_1023497 3300025294 Bacteria 3219
237 Ga0209564_1000157 3300025295 Bacteria 164758
238 Ga0209564_1000806 3300025295 Bacteria 42875
239 Ga0209758_1000042 3300025297 Bacteria 407145
240 Ga0209758_1036340 3300025297 Bacteria 1924
241 Ga0209050_1000021 3300025298 Bacteria 574406
242 Ga0209050_1012191 3300025298 Bacteria 3973
243 Ga0209256_1000056 3300025299 Bacteria 283044
244 Ga0209256_1000124 3300025299 Bacteria 165390
245 Ga0207426_1000055 3300025302 Bacteria 374450
246 Ga0207426_1000079 3300025302 Bacteria 314709
247 Ga0209051_1000111 3300025303 Bacteria 153024
248 Ga0209051_1000124 3300025303 Bacteria 142998
249 Ga0209051_1000423 3300025303 Bacteria 58174
250 Ga0209051_1000436 3300025303 Bacteria 56547
251 Ga0209051_1001224 3300025303 Bacteria 23078
252 Ga0209257_1000015 3300025304 Bacteria 908141
253 Ga0209257_1000043 3300025304 Bacteria 512127
254 Ga0209257_1000215 3300025304 Bacteria 136521
255 Ga0209257_1006849 3300025304 Bacteria 7159
256 Ga0207656_10004630 3300025321 Bacteria 4820
257 Ga0207696_1000424 3300025711 Bacteria 38612
258 Ga0207655_1001321 3300025728 Bacteria 23412
259 Ga0207682_10015042 3300025893 Bacteria 3013
260 Ga0207682_10020389 3300025893 Bacteria 2603
261 Ga0207692_10065557 3300025898 Bacteria 1895
262 Ga0207710_10010003 3300025900 Bacteria 3989
263 Ga0207645_10131775 3300025907 Bacteria 1627
264 Ga0207645_10208326 3300025907 Bacteria 1287
265 Ga0207705_10233260 3300025909 Bacteria 1400
266 Ga0207695_10082278 3300025913 Bacteria 3256
267 Ga0207695_10089472 3300025913 Bacteria 3096
268 Ga0207695_10122651 3300025913 Bacteria 2565
269 Ga0207695_10257041 3300025913 Bacteria 1645
270 Ga0207671_10030696 3300025914 Bacteria 4006
271 Ga0207671_10137806 3300025914 Bacteria 1878
272 Ga0207671_10270064 3300025914 Bacteria 1340
273 Ga0207671_10307381 3300025914 Bacteria 1253
274 Ga0207663_10134044 3300025916 Bacteria 1716
275 Ga0207660_10027724 3300025917 Bacteria 3869
276 Ga0207660_10295052 3300025917 Bacteria 1290
277 Ga0207662_10175611 3300025918 Bacteria 1376
278 Ga0207657_10008951 3300025919 Bacteria 10117
279 Ga0207652_10032584 3300025921 Bacteria 4383
280 Ga0207652_10036216 3300025921 Bacteria 4172
281 Ga0207652_10228919 3300025921 Bacteria 1675
282 Ga0207681_10060993 3300025923 Bacteria 2591
283 Ga0207694_10089135 3300025924 Bacteria 2433
284 Ga0207650_10150408 3300025925 Bacteria 1837
285 Ga0207650_10254853 3300025925 Bacteria 1422
286 Ga0207659_10072560 3300025926 Bacteria 2517
287 Ga0207659_10146746 3300025926 Bacteria 1838
288 Ga0207687_10127542 3300025927 Bacteria 1913
289 Ga0207700_10066934 3300025928 Bacteria 2747
290 Ga0207664_10003449 3300025929 Bacteria 10541
291 Ga0207644_10002626 3300025931 Bacteria 11570
292 Ga0207644_10025739 3300025931 Bacteria 4048
293 Ga0207644_10091115 3300025931 Bacteria 2273
294 Ga0207690_10097368 3300025932 Bacteria 2093
295 Ga0207706_10038355 3300025933 Bacteria 4250
296 Ga0207706_10065370 3300025933 Bacteria 3203
297 Ga0207706_10149905 3300025933 Bacteria 2051
298 Ga0207706_10321957 3300025933 Bacteria 1346
299 Ga0207686_10061983 3300025934 Bacteria 2373
300 Ga0207686_10143380 3300025934 Bacteria 1654
301 Ga0207709_10000070 3300025935 Bacteria 183020
302 Ga0207709_10000394 3300025935 Bacteria 43194
303 Ga0207709_10002808 3300025935 Bacteria 10713
304 Ga0207709_10015819 3300025935 Bacteria 4188
305 Ga0207709_10039627 3300025935 Bacteria 2815
306 Ga0207704_10099597 3300025938 Bacteria 1934
307 Ga0207704_10133902 3300025938 Bacteria 1722
308 Ga0207691_10018059 3300025940 Bacteria 6679
309 Ga0207691_10035583 3300025940 Bacteria 4620
310 Ga0207691_10105069 3300025940 Bacteria 2516
311 Ga0207691_10239222 3300025940 Bacteria 1570
312 Ga0207711_10015375 3300025941 Bacteria 6351
313 Ga0207711_10121057 3300025941 Bacteria 2336
314 Ga0207711_10434700 3300025941 Bacteria 1221
315 Ga0207689_10054741 3300025942 Bacteria 3285
316 Ga0207689_10309493 3300025942 Bacteria 1310
317 Ga0207679_10604520 3300025945 Bacteria 988
318 Ga0207667_10044598 3300025949 Bacteria 4698
319 Ga0207667_10086845 3300025949 Bacteria 3236
320 Ga0207651_10055471 3300025960 Bacteria 2722
321 Ga0207651_10058227 3300025960 Bacteria 2669
322 Ga0207651_10231222 3300025960 Bacteria 1501
323 Ga0207712_10049088 3300025961 Bacteria 2939
324 Ga0207668_10453067 3300025972 Bacteria 1095
325 Ga0207640_10080320 3300025981 Bacteria 2226
326 Ga0207640_10108229 3300025981 Bacteria 1964
327 Ga0207658_10053035 3300025986 Bacteria 2994
328 Ga0207658_10057826 3300025986 Bacteria 2883
329 Ga0207658_10236337 3300025986 Bacteria 1545
330 Ga0207658_10254487 3300025986 Bacteria 1494
331 Ga0207677_10071828 3300026023 Bacteria 2444
332 Ga0207677_10487572 3300026023 Bacteria 1063
333 Ga0207703_10001680 3300026035 Bacteria 19905
334 Ga0207703_10147259 3300026035 Bacteria 2049
335 Ga0207639_10104394 3300026041 Bacteria 2298
336 Ga0207639_10141873 3300026041 Bacteria 2002
337 Ga0207678_10028486 3300026067 Bacteria 4877
338 Ga0207678_10087406 3300026067 Bacteria 2664
339 Ga0207678_10764593 3300026067 Bacteria 852
340 Ga0207708_10007039 3300026075 Bacteria 8311
341 Ga0207702_10034475 3300026078 Bacteria 4232
342 Ga0207641_10000273 3300026088 Bacteria 65757
343 Ga0207641_10122257 3300026088 Bacteria 2325
344 Ga0207641_10267316 3300026088 Bacteria 1603
345 Ga0207641_10735513 3300026088 Bacteria 973
346 Ga0207648_10001832 3300026089 Bacteria 23254
347 Ga0207648_10047113 3300026089 Bacteria 3779
348 Ga0207648_10230215 3300026089 Bacteria 1648
349 Ga0207676_10013465 3300026095 Bacteria 5875
350 Ga0207674_10021133 3300026116 Bacteria 7016
351 Ga0207674_10024162 3300026116 Bacteria 6497
352 Ga0207675_100027120 3300026118 Bacteria 5334
353 Ga0207675_100092269 3300026118 Bacteria 2848
354 Ga0207683_10020420 3300026121 Bacteria 5666
355 Ga0207683_10087069 3300026121 Bacteria 2778
356 Ga0207683_10250904 3300026121 Bacteria 1615
357 Ga0207698_10081158 3300026142 Bacteria 2616
358 Ga0209281_1000029 3300027111 Bacteria 431495
359 Ga0209970_1002551 3300027614 Bacteria 3086
360 Ga0209282_1004597 3300027666 Bacteria 8342
361 Ga0268266_10129803 3300028379 Bacteria 2253
362 Ga0268265_10085953 3300028380 Bacteria 2498
363 Ga0268265_10156685 3300028380 Bacteria 1928
364 Ga0268265_10187619 3300028380 Bacteria 1782
365 Ga0268264_10000151 3300028381 Bacteria 158241
366 Ga0268264_10010515 3300028381 Bacteria 7650
367 Ga0307517_10176598 3300028786 Bacteria 1389
368 Ga0307515_10000101 3300028794 Bacteria 199593
369 Ga0307515_10000322 3300028794 Bacteria 118563
370 Ga0307515_10000877 3300028794 Bacteria 69170
371 Ga0307515_10003504 3300028794 Bacteria 32990
372 Ga0307515_10087893 3300028794 Bacteria 3937
373 Ga0307515_10132267 3300028794 Bacteria 2738
374 Ga0307515_10275249 3300028794 Bacteria 1398
375 Ga0307515_10452152 3300028794 Bacteria 900
376 Ga0265338_10085451 3300028800 Bacteria 2630
377 Ga0314311_1058476 3300030733 Bacteria 3123
378 Ga0265330_10041876 3300031235 Bacteria 2030
379 Ga0265332_10002085 3300031238 Bacteria 10412
380 Ga0265329_10012668 3300031242 Bacteria 3023
381 Ga0265327_10007110 3300031251 Bacteria 8739
382 Ga0307513_10000013 3300031456 Bacteria 325682
383 Ga0307513_10004142 3300031456 Bacteria 19422
384 Ga0307513_10005935 3300031456 Bacteria 16027
385 Ga0307513_10031821 3300031456 Bacteria 5964
386 Ga0307513_10064112 3300031456 Bacteria 3874
387 Ga0307513_10182249 3300031456 Bacteria 1962
388 Ga0307509_10000215 3300031507 Bacteria 92190
389 Ga0307509_10006676 3300031507 Bacteria 15395
390 Ga0307509_10143968 3300031507 Bacteria 2313
391 Ga0307408_100024281 3300031548 Bacteria 4137
392 Ga0307408_100091766 3300031548 Bacteria 2294
393 Ga0307408_100093617 3300031548 Bacteria 2273
394 Ga0307408_100237893 3300031548 Bacteria 1495
395 Ga0307408_100264336 3300031548 Bacteria 1425
396 Ga0307408_100486377 3300031548 Bacteria 1078
397 Ga0307508_10000053 3300031616 Bacteria 128020
398 Ga0307514_10002392 3300031649 Bacteria 19627
399 Ga0307514_10003568 3300031649 Bacteria 14825
400 Ga0307516_10001573 3300031730 Bacteria 31413
401 Ga0307516_10108158 3300031730 Bacteria 2588
402 Ga0307516_10124000 3300031730 Bacteria 2370
403 Ga0307405_10007767 3300031731 Bacteria 5394
404 Ga0307405_10058878 3300031731 Bacteria 2419
405 Ga0307405_10165947 3300031731 Bacteria 1569
406 Ga0307413_10242857 3300031824 Bacteria 1331
407 Ga0307406_10000240 3300031901 Bacteria 33234
408 Ga0307406_10213167 3300031901 Bacteria 1430
409 Ga0307407_10049413 3300031903 Bacteria 2400
410 Ga0307412_10017679 3300031911 Bacteria 4270
411 Ga0307412_10020962 3300031911 Bacteria 3986
412 Ga0307412_10115617 3300031911 Bacteria 1923
413 Ga0307412_10116804 3300031911 Bacteria 1914
414 Ga0307412_10368280 3300031911 Bacteria 1159
415 Ga0307412_10507000 3300031911 Bacteria 1006
416 Ga0307412_10595964 3300031911 Bacteria 935
417 Ga0307409_100009343 3300031995 Bacteria 6018
418 Ga0307416_100006086 3300032002 Bacteria 7513
419 Ga0307416_100137674 3300032002 Bacteria 2212
420 Ga0307415_100002654 3300032126 Bacteria 8929
421 Ga0307510_10000003 3300033180 Bacteria 756654
422 Ga0307510_10000364 3300033180 Bacteria 42850
423 Ga0307510_10049353 3300033180 Bacteria 4477
424 Ga0307510_10268342 3300033180 Bacteria 1184
425 Ga0307510_10338194 3300033180 Bacteria 958
426 Ga0307510_10360550 3300033180 Bacteria 902
427 Ga0373939_0059475 3300035114 Bacteria 1212
428 Ga0395899_0000035 3300037312 Bacteria 295584
429 Ga0395899_0008988 3300037312 Bacteria 7684
430 Ga0395899_0019677 3300037312 Bacteria 5125
431 Ga0395899_0042074 3300037312 Bacteria 3412
432 Ga0395900_0000113 3300037418 Bacteria 139979
433 Ga0395900_0086403 3300037418 Bacteria 3223
434 Ga0395900_0086644 3300037418 Bacteria 3218
435 Ga0395900_0107784 3300037418 Bacteria 2862
436 Ga0395900_0270456 3300037418 Bacteria 1694
437 Ga0395900_0628467 3300037418 Bacteria 1012
438 Ga0395900_0724060 3300037418 Bacteria 927
439 Ga0395898_0000444 3300037466 Bacteria 85520
440 Ga0395898_0021418 3300037466 Bacteria 6555
441 Ga0395898_0042288 3300037466 Bacteria 4497
442 Ga0395898_0705931 3300037466 Bacteria 950
443 Ga0395905_0000078 3300037471 Bacteria 161593
444 Ga0395905_0001615 3300037471 Bacteria 26797
445 Ga0395905_0009266 3300037471 Bacteria 9631
446 Ga0395905_0018804 3300037471 Bacteria 6553
447 Ga0395905_0029165 3300037471 Bacteria 5200
448 Ga0395905_0034096 3300037471 Bacteria 4779
449 Ga0395905_0063884 3300037471 Bacteria 3445
450 Ga0395905_0107340 3300037471 Bacteria 2621
451 Ga0395905_0188662 3300037471 Bacteria 1934
452 Ga0395905_0204766 3300037471 Bacteria 1849
453 Ga0395901_0000718 3300038443 Bacteria 37719
454 Ga0395901_0001521 3300038443 Bacteria 24065
455 Ga0395901_0038349 3300038443 Bacteria 4956
456 Ga0395901_0049667 3300038443 Bacteria 4359
457 Ga0395901_0073846 3300038443 Bacteria 3557
458 Ga0395901_0088797 3300038443 Bacteria 3233
459 Ga0395901_0089244 3300038443 Bacteria 3226
460 Ga0395901_0172767 3300038443 Bacteria 2267
461 Ga0395901_0179658 3300038443 Bacteria 2219
462 Ga0436360_0505175 3300039438 Bacteria 2718
463 Ga0436361_0730633 3300039447 Bacteria 71783
464 Ga0436363_1689440 3300039450 Bacteria 11337
465 Ga0439436_0001899 3300041404 Bacteria 6176
466 Ga0439436_0009738 3300041404 Bacteria 2942
467 Ga0439436_0010303 3300041404 Bacteria 2853
468 Ga0439439_0025930 3300041406 Bacteria 1476
469 Ga0439466_0008532 3300041411 Bacteria 3863
470 Ga0439466_0017261 3300041411 Bacteria 2602
471 Ga0439466_0021720 3300041411 Bacteria 2271
472 Ga0439433_0025447 3300041999 Bacteria 1337
473 Ga0439442_004262 3300042002 Bacteria 2837
474 Ga0439445_0010765 3300042004 Bacteria 2170
475 Ga0439432_018413 3300042006 Bacteria 2334
476 Ga0439449_0002122 3300042007 Bacteria 7783
477 Ga0439449_0007892 3300042007 Bacteria 4040
478 Ga0439449_0041254 3300042007 Bacteria 1715
479 Ga0439449_0055149 3300042007 Bacteria 1468
480 Ga0439452_005666 3300042010 Bacteria 3998
481 Ga0439457_014209 3300042014 Bacteria 1783
482 Ga0439462_0006248 3300042015 Bacteria 2957
483 Ga0450923_002449 3300042125 Bacteria 2664
484 Ga0450898_002238 3300042134 Bacteria 2690
485 Ga0450899_003957 3300042135 Bacteria 1589
486 Ga0439434_0009312 3300042435 Bacteria 2885
487 Ga0439434_0011581 3300042435 Bacteria 2609
488 Ga0450918_000332 3300042531 Bacteria 10578
489 Ga0450893_0003467 3300042532 Bacteria 2484
490 Ga0450893_0013478 3300042532 Bacteria 1364
491 Ga0466969_0009080 3300044656 Bacteria 5270
492 Ga0466969_0017951 3300044656 Bacteria 3690
493 Ga0466969_0041865 3300044656 Bacteria 2289
494 Ga0466965_0089505 3300044683 Bacteria 1564
495 Ga0466966_0027942 3300044684 Bacteria 3677
496 Ga0466966_0035699 3300044684 Bacteria 3210
497 Ga0466961_0029680 3300044693 Bacteria 3513
498 Ga0466961_0057680 3300044693 Bacteria 2471
499 Ga0453684_0143830 3300044712 Bacteria 2843
500 Ga0466959_0002388 3300045049 Bacteria 11970
501 Ga0466959_0004321 3300045049 Bacteria 9488
502 Ga0466959_0146256 3300045049 Bacteria 1667
503 Ga0451576_0004945 3300045051 Bacteria 16966
504 Ga0451576_0216083 3300045051 Bacteria 2002
505 Ga0466958_0000765 3300045836 Bacteria 14132
506 Ga0466958_0009225 3300045836 Bacteria 5491
507 Ga0466967_0132668 3300045976 Bacteria 2314
508 Ga0495592_0000173 3300046454 Bacteria 57219
509 Ga0495629_0426395 3300046459 Bacteria 900
510 Ga0495638_0153364 3300046460 Bacteria 1335
511 Ga0495639_0022234 3300046475 Bacteria 2781
512 Ga0495606_0006456 3300046507 Bacteria 10804
513 Ga0495606_0082228 3300046507 Bacteria 2000
514 Ga0495616_0020994 3300046513 Bacteria 3545
515 Ga0495631_0002066 3300046518 Bacteria 11696
516 Ga0495632_0003077 3300046519 Bacteria 12111
517 Ga0495652_0054302 3300046529 Bacteria 3412
518 Ga0495665_0060761 3300046531 Bacteria 1995
519 Ga0495621_0040965 3300046539 Bacteria 1625
520 Ga0495621_0080220 3300046539 Bacteria 1216
521 Ga0495597_0024569 3300046542 Bacteria 2780
522 Ga0495645_0008045 3300046543 Bacteria 7344
523 Ga0495645_0063703 3300046543 Bacteria 2669
524 Ga0495656_0053999 3300046615 Bacteria 1728
525 Ga0495668_0020719 3300046616 Bacteria 3779
526 Ga0495611_0130508 3300046648 Bacteria 1172
527 Ga0495625_0000206 3300046660 Bacteria 94070
528 Ga0495625_0028232 3300046660 Bacteria 4211
529 Ga0495661_0001271 3300046665 Bacteria 21687
530 Ga0495661_0082960 3300046665 Bacteria 1844
531 Ga0495588_0034670 3300046674 Bacteria 2554
532 Ga0495599_0098473 3300046678 Bacteria 1823
533 Ga0495646_0003204 3300046680 Bacteria 10167
534 Ga0495646_0122555 3300046680 Bacteria 1470
535 Ga0495624_0027527 3300046690 Bacteria 3722
536 Ga0495624_0051090 3300046690 Bacteria 2617
537 Ga0495670_0022247 3300046691 Bacteria 3130
538 Ga0495671_0020716 3300046692 Bacteria 3463
539 Ga0495671_0196104 3300046692 Bacteria 980
540 Ga0495649_0004289 3300046694 Bacteria 9359
541 Ga0495649_0007271 3300046694 Bacteria 6775
542 Ga0495660_0166002 3300046810 Bacteria 1079
543 Ga0495683_0005760 3300047323 Bacteria 6827
544 Ga0495687_001027 3300047443 Bacteria 27802
545 Ga0495687_029024 3300047443 Bacteria 2565
546 Ga0495687_081862 3300047443 Bacteria 1262
547 Ga0495677_0011497 3300047445 Bacteria 3238
548 Ga0495593_0012279 3300047673 Bacteria 4895
549 Ga0495593_0250632 3300047673 Bacteria 886
550 Ga0495614_0016572 3300048089 Bacteria 3206
551 Ga0495626_0048618 3300048091 Bacteria 1967
552 Ga0496100_0027575 3300048903 Bacteria 3494
553 Ga0496100_0085758 3300048903 Bacteria 2138
554 Ga0496101_0001978 3300048904 Bacteria 12427
555 Ga0496102_0002447 3300048905 Bacteria 15843
556 Ga0496102_0036739 3300048905 Bacteria 4415
557 Ga0496103_0035714 3300048906 Bacteria 3043
558 Ga0496104_0052112 3300048907 Bacteria 3864
559 Ga0496105_0005298 3300048908 Bacteria 9775
560 Ga0496105_0151897 3300048908 Bacteria 1903
561 Ga0496106_0433091 3300048909 Bacteria 1057
562 Ga0496108_0208093 3300048911 Bacteria 1698
563 Ga0496108_0312914 3300048911 Bacteria 1368
564 Ga0496110_0036920 3300048913 Bacteria 4245
565 Ga0496111_0092371 3300048914 Bacteria 2218
566 Ga0496112_0472561 3300048915 Bacteria 1191
567 Ga0496114_0046200 3300048917 Bacteria 3618
568 Ga0496116_0023452 3300048919 Bacteria 4594
569 Ga0496116_0043537 3300048919 Bacteria 3057
570 Ga0496117_0000186 3300048920 Bacteria 127231
571 Ga0496117_0047932 3300048920 Bacteria 3058
572 Ga0496117_0073591 3300048920 Bacteria 2279
573 Ga0496118_0000003 3300048921 Bacteria 773148
574 Ga0496118_0018486 3300048921 Bacteria 6287
575 Ga0496118_0021335 3300048921 Bacteria 5705
576 Ga0496118_0146734 3300048921 Bacteria 1484
577 Ga0496119_0001832 3300048922 Bacteria 24618
578 Ga0496119_0008384 3300048922 Bacteria 9088
579 Ga0496119_0061827 3300048922 Bacteria 2234
580 Ga0496120_0000232 3300048923 Bacteria 95655
581 Ga0496120_0049700 3300048923 Bacteria 2405
582 Ga0496121_0035691 3300048924 Bacteria 4448
583 Ga0496121_0103970 3300048924 Bacteria 2183
584 Ga0496121_0110605 3300048924 Bacteria 2096
585 Ga0496123_0051703 3300048926 Bacteria 2734
586 Ga0496123_0185617 3300048926 Bacteria 1081
587 Ga0496124_0124820 3300048927 Bacteria 2052
588 Ga0496124_0144746 3300048927 Bacteria 1871
589 Ga0496124_0296875 3300048927 Bacteria 1169
590 Ga0496125_0001701 3300048928 Bacteria 30700
591 Ga0496125_0002867 3300048928 Bacteria 21703
592 Ga0496125_0023671 3300048928 Bacteria 5663
593 Ga0496125_0113828 3300048928 Bacteria 1950
594 Ga0496125_0213023 3300048928 Bacteria 1253
595 Ga0496126_0000065 3300048929 Bacteria 252549
596 Ga0496126_0101915 3300048929 Bacteria 2510
597 Ga0496126_0198129 3300048929 Bacteria 1697
598 Ga0501043_0147495 3300049579 Bacteria 1842
599 Ga0501046_0000110 3300049580 Bacteria 86752
600 Ga0501047_0000143 3300049581 Bacteria 87124
601 Ga0501047_0230017 3300049581 Bacteria 1708
602 Ga0501048_0000601 3300049582 Bacteria 25551
603 Ga0501073_0083697 3300049589 Bacteria 2220
604 Ga0501216_032999 3300049660 Bacteria 964
605 Ga0501080_0228782 3300049742 Bacteria 1700
606 Ga0501262_002539 3300049759 Bacteria 2061
607 Ga0501035_0147525 3300049822 Bacteria 2042
608 Ga0501035_0487444 3300049822 Bacteria 1016
609 Ga0501044_0000185 3300049823 Bacteria 77663
610 Ga0501044_0129259 3300049823 Bacteria 2521
611 Ga0501045_0008311 3300049824 Bacteria 7227
612 nmdc:mga03683_1374_c1 3300050489 Bacteria 7229
613 nmdc:mga03683_35960_c1 3300050489 Bacteria 2012
614 nmdc:mga03683_3773_c1 3300050489 Bacteria 4940
615 nmdc:mga03683_8851_c1 3300050489 Bacteria 3557
616 nmdc:mga03n38_128975_c1 3300050490 Bacteria 1251
617 nmdc:mga03n38_57457_c1 3300050490 Bacteria 1759
618 nmdc:mga03n38_9973_c1 3300050490 Bacteria 3476
619 nmdc:mga00v17_103478_c1 3300050491 Bacteria 1799
620 nmdc:mga00v17_27560_c1 3300050491 Bacteria 3318
621 nmdc:mga0yw44_100333_c1 3300050492 Bacteria 1843
622 nmdc:mga0yw44_220168_c1 3300050492 Bacteria 1258
623 nmdc:mga0k408_152164_c1 3300050493 Bacteria 1378
624 nmdc:mga0k408_245729_c1 3300050493 Bacteria 1069
625 nmdc:mga0k408_42363_c1 3300050493 Bacteria 2622
626 nmdc:mga0k408_44619_c1 3300050493 Bacteria 2557
627 nmdc:mga0k408_603_c1 3300050493 Bacteria 19842
628 nmdc:mga0k408_739_c1 3300050493 Bacteria 17894
629 nmdc:mga0k408_9492_c1 3300050493 Bacteria 5247
630 nmdc:mga06z11_110524_c1 3300050494 Bacteria 1521
631 nmdc:mga06z11_12360_c1 3300050494 Bacteria 3712
632 nmdc:mga06z11_159057_c1 3300050494 Bacteria 1290
633 nmdc:mga06z11_16246_c1 3300050494 Bacteria 3347
634 nmdc:mga06z11_244047_c1 3300050494 Bacteria 1056
635 nmdc:mga06z11_27112_c1 3300050494 Bacteria 2736
636 nmdc:mga07m45_11742_c1 3300050496 Bacteria 4609
637 nmdc:mga07m45_123932_c1 3300050496 Bacteria 1494
638 nmdc:mga07m45_14528_c1 3300050496 Bacteria 4197
639 nmdc:mga07m45_14555_c1 3300050496 Bacteria 4194
640 nmdc:mga07m45_2153_c1 3300050496 Bacteria 9172
641 nmdc:mga07m45_24472_c1 3300050496 Bacteria 3308
642 nmdc:mga07m45_2793_c2 3300050496 Bacteria 4500
643 nmdc:mga07m45_482_c1 3300050496 Bacteria 16838
644 nmdc:mga07m45_49154_c1 3300050496 Bacteria 2373
645 nmdc:mga07m45_655_c2 3300050496 Bacteria 9799
646 nmdc:mga07m45_82317_c1 3300050496 Bacteria 1838
647 nmdc:mga07m45_9697_c1 3300050496 Bacteria 5005
648 nmdc:mga0sz30_105633_c1 3300050516 Bacteria 1232
649 Ga0500651_0028268 3300053093 Bacteria 3526
650 Ga0500562_002855 3300053108 Bacteria 4306
651 Ga0500593_008854 3300053117 Bacteria 4153
652 Ga0500594_0003653 3300053118 Bacteria 3391
653 Ga0500607_009331 3300053121 Bacteria 5908
654 Ga0500608_013476 3300053122 Bacteria 3626
655 Ga0500642_0001951 3300053130 Bacteria 5977
656 Ga0500658_0002586 3300053134 Bacteria 6996
657 Ga0500559_0000195 3300053136 Bacteria 48743
658 Ga0500574_007516 3300053141 Bacteria 2266
659 Ga0500622_0007666 3300053156 Bacteria 6103
660 Ga0500622_0035467 3300053156 Bacteria 2610
661 Ga0500627_0005089 3300053158 Bacteria 4318
662 Ga0500636_0051722 3300053177 Bacteria 2415

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037471 Ga0395905_0204766 Ga0395905_0204766_1158_1814 218
2 3300046539 Ga0495621_0040965 Ga0495621_0040965_904_1602 232
3 3300042007 Ga0439449_0041254 Ga0439449_0041254_965_1705 246
4 3300006914 Ga0075436_100029938 Ga0075436_1000299384 251
5 3300007076 Ga0075435_100004686 Ga0075435_1000046861 251
6 3300033180 Ga0307510_10360550 Ga0307510_103605501 253
7 iso_pu_bacteria 2818991446 2819600195 262
8 iso_pu_bacteria 2513020051 2513230854 263
9 iso_pu_bacteria 2519103095 2519461706 263
10 iso_pu_bacteria 2582581311 2585293232 263
11 iso_pu_bacteria 2599185214 2599622475 263
12 iso_pu_bacteria 2599185226 2599674433 263
13 iso_pu_bacteria 2599185227 2599680118 263
14 iso_pu_bacteria 2599185229 2599692134 263
15 iso_pu_bacteria 2643221628 2644160824 263
16 iso_pu_bacteria 2643221658 2644326581 263
17 iso_pu_bacteria 2643221672 2644396930 263
18 iso_pu_bacteria 2643221683 2644469393 263
19 iso_pu_bacteria 2721755523 2722880917 263
20 iso_pu_bacteria 2738541277 2738719275 263
21 iso_pu_bacteria 2738541307 2738883378 263
22 iso_pu_bacteria 2738543019 2739282994 263
23 iso_pu_bacteria 2816332253 2817258579 263
24 iso_pu_bacteria 2816332256 2817281003 263
25 iso_pu_bacteria 2816332286 2817453272 263
26 iso_pu_bacteria 2818991446 2819599176 263
27 iso_pu_bacteria 2831265667 2831270956 263
28 iso_pu_bacteria 2838054893 2838059004 263
29 iso_pu_bacteria 2839138175 2839138277 263
30 iso_pu_bacteria 2881101125 2881104573 263
31 iso_pu_bacteria 2881412998 2881414620 263
32 iso_pu_bacteria 2885192300 2885194684 263
33 iso_pu_bacteria 2885198086 2885202225 263
34 iso_pu_bacteria 2885211737 2885215878 263
35 iso_pu_bacteria 2894023352 2894024992 263
36 iso_pu_bacteria 2904449895 2904451591 263
37 iso_pu_bacteria 2904456579 2904461920 263
38 iso_pu_bacteria 2904541872 2904543255 263
39 iso_pu_bacteria 2919462493 2919464456 263
40 iso_pu_bacteria 2919704043 2919708582 263
41 iso_pu_bacteria 2928037797 2928043535 263
42 iso_pu_bacteria 2928044640 2928049835 263
43 iso_pu_bacteria 2928051484 2928054410 263
44 iso_pu_bacteria 2928064002 2928069996 263
45 iso_pu_bacteria 2928070936 2928074384 263
46 iso_pu_bacteria 2928084124 2928086619 263
47 iso_pu_bacteria 2929160207 2929160487 263
48 iso_pu_bacteria 2929520902 2929526509 263
49 iso_pu_bacteria 2932422444 2932423644 263
50 iso_pu_bacteria 2939631187 2939633875 263
51 iso_pu_bacteria 2945945610 2945950484 263
52 iso_pu_bacteria 8020807995 8020810478 263
53 iso_pu_bacteria 8040167225 8040167680 263
54 iso_pu_bacteria 8040173305 8040177739 263
55 3300005327 Ga0070658_10060456 Ga0070658_100604562 265
56 3300005339 Ga0070660_100006337 Ga0070660_1000063373 265
57 3300005563 Ga0068855_100042747 Ga0068855_1000427474 265
58 3300006038 Ga0075365_10056202 Ga0075365_100562023 265
59 3300009093 Ga0105240_10003831 Ga0105240_100038314 265
60 3300025913 Ga0207695_10089472 Ga0207695_100894724 265
61 3300025919 Ga0207657_10008951 Ga0207657_100089518 265
62 3300025921 Ga0207652_10228919 Ga0207652_102289192 265
63 3300025924 Ga0207694_10089135 Ga0207694_100891353 265
64 3300025949 Ga0207667_10086845 Ga0207667_100868454 265
65 3300037312 Ga0395899_0019677 Ga0395899_0019677_2249_3049 265
66 3300003792 Ga0055540_1003737 Ga0055540_10037374 266
67 3300003794 Ga0055531_10000248 Ga0055531_1000024825 266
68 3300005327 Ga0070658_10240717 Ga0070658_102407173 266
69 3300005334 Ga0068869_100027667 Ga0068869_1000276671 266
70 3300005338 Ga0068868_100058993 Ga0068868_1000589931 266
71 3300005530 Ga0070679_100209585 Ga0070679_1002095852 266
72 3300006038 Ga0075365_10046394 Ga0075365_100463943 266
73 3300006038 Ga0075365_10083672 Ga0075365_100836722 266
74 3300006048 Ga0075363_100134968 Ga0075363_1001349682 266
75 3300006051 Ga0075364_10030718 Ga0075364_100307182 266
76 3300006177 Ga0075362_10022701 Ga0075362_100227013 266
77 3300006177 Ga0075362_10188392 Ga0075362_101883922 266
78 3300006178 Ga0075367_10181554 Ga0075367_101815542 266
79 3300006186 Ga0075369_10112772 Ga0075369_101127722 266
80 3300006353 Ga0075370_10013279 Ga0075370_100132794 266
81 3300006353 Ga0075370_10072475 Ga0075370_100724753 266
82 3300010375 Ga0105239_10198599 Ga0105239_101985992 266
83 3300013297 Ga0157378_10092181 Ga0157378_100921813 266
84 3300014325 Ga0163163_10135649 Ga0163163_101356493 266
85 3300014497 Ga0182008_10020966 Ga0182008_100209662 266
86 3300015262 Ga0182007_10095711 Ga0182007_100957112 266
87 3300025303 Ga0209051_1000124 Ga0209051_100012458 266
88 3300025304 Ga0209257_1000015 Ga0209257_100001520 266
89 3300025909 Ga0207705_10233260 Ga0207705_102332603 266
90 3300025917 Ga0207660_10295052 Ga0207660_102950522 266
91 3300025921 Ga0207652_10032584 Ga0207652_100325844 266
92 3300025949 Ga0207667_10044598 Ga0207667_100445981 266
93 3300026023 Ga0207677_10487572 Ga0207677_104875722 266
94 3300027614 Ga0209970_1002551 Ga0209970_10025512 266
95 3300031235 Ga0265330_10041876 Ga0265330_100418762 266
96 3300031238 Ga0265332_10002085 Ga0265332_100020852 266
97 3300031242 Ga0265329_10012668 Ga0265329_100126683 266
98 3300031456 Ga0307513_10000013 Ga0307513_1000001397 266
99 3300031548 Ga0307408_100091766 Ga0307408_1000917663 266
100 3300031548 Ga0307408_100237893 Ga0307408_1002378932 266
101 3300031548 Ga0307408_100486377 Ga0307408_1004863772 266
102 3300031730 Ga0307516_10001573 Ga0307516_1000157324 266
103 3300031911 Ga0307412_10020962 Ga0307412_100209624 266
104 3300031911 Ga0307412_10115617 Ga0307412_101156172 266
105 3300037312 Ga0395899_0008988 Ga0395899_0008988_3696_4496 266
106 3300037418 Ga0395900_0086403 Ga0395900_0086403_1278_2078 266
107 3300037418 Ga0395900_0086644 Ga0395900_0086644_1312_2115 266
108 3300037418 Ga0395900_0107784 Ga0395900_0107784_1817_2617 266
109 3300037418 Ga0395900_0270456 Ga0395900_0270456_458_1261 266
110 3300037418 Ga0395900_0628467 Ga0395900_0628467_86_886 266
111 3300037418 Ga0395900_0724060 Ga0395900_0724060_64_864 266
112 3300037466 Ga0395898_0021418 Ga0395898_0021418_3858_4658 266
113 3300037466 Ga0395898_0042288 Ga0395898_0042288_280_1083 266
114 3300037466 Ga0395898_0705931 Ga0395898_0705931_136_936 266
115 3300037471 Ga0395905_0000078 Ga0395905_0000078_66075_66878 266
116 3300037471 Ga0395905_0001615 Ga0395905_0001615_15486_16286 266
117 3300037471 Ga0395905_0009266 Ga0395905_0009266_3661_4464 266
118 3300037471 Ga0395905_0029165 Ga0395905_0029165_1335_2138 266
119 3300037471 Ga0395905_0034096 Ga0395905_0034096_2129_2932 266
120 3300037471 Ga0395905_0107340 Ga0395905_0107340_1273_2073 266
121 3300037471 Ga0395905_0188662 Ga0395905_0188662_411_1211 266
122 3300038443 Ga0395901_0038349 Ga0395901_0038349_4059_4862 266
123 3300038443 Ga0395901_0049667 Ga0395901_0049667_2283_3083 266
124 3300038443 Ga0395901_0073846 Ga0395901_0073846_565_1365 266
125 3300038443 Ga0395901_0088797 Ga0395901_0088797_1104_1907 266
126 3300038443 Ga0395901_0089244 Ga0395901_0089244_31_831 266
127 3300038443 Ga0395901_0172767 Ga0395901_0172767_261_1064 266
128 3300038443 Ga0395901_0179658 Ga0395901_0179658_979_1782 266
129 3300041406 Ga0439439_0025930 Ga0439439_0025930_308_1108 266
130 3300042007 Ga0439449_0002122 Ga0439449_0002122_4790_5590 266
131 3300042007 Ga0439449_0055149 Ga0439449_0055149_270_1070 266
132 3300042532 Ga0450893_0003467 Ga0450893_0003467_1176_1976 266
133 3300044656 Ga0466969_0009080 Ga0466969_0009080_667_1470 266
134 3300044684 Ga0466966_0035699 Ga0466966_0035699_1534_2337 266
135 3300044693 Ga0466961_0057680 Ga0466961_0057680_241_1044 266
136 3300045049 Ga0466959_0002388 Ga0466959_0002388_4996_5799 266
137 3300045976 Ga0466967_0132668 Ga0466967_0132668_1311_2114 266
138 3300047445 Ga0495677_0011497 Ga0495677_0011497_1049_1849 266
139 3300048909 Ga0496106_0433091 Ga0496106_0433091_54_854 266
140 3300048926 Ga0496123_0185617 Ga0496123_0185617_147_947 266
141 3300049579 Ga0501043_0147495 Ga0501043_0147495_126_929 266
142 3300049581 Ga0501047_0230017 Ga0501047_0230017_716_1519 266
143 3300049589 Ga0501073_0083697 Ga0501073_0083697_1055_1858 266
144 3300049660 Ga0501216_032999 Ga0501216_032999_77_877 266
145 3300049742 Ga0501080_0228782 Ga0501080_0228782_741_1544 266
146 3300049823 Ga0501044_0129259 Ga0501044_0129259_377_1180 266
147 3300050489 nmdc:mga03683_1374_c1 nmdc:mga03683_1374_c1_5270_6070 266
148 3300050490 nmdc:mga03n38_128975_c1 nmdc:mga03n38_128975_c1_432_1232 266
149 3300050491 nmdc:mga00v17_27560_c1 nmdc:mga00v17_27560_c1_1241_2041 266
150 3300050493 nmdc:mga0k408_44619_c1 nmdc:mga0k408_44619_c1_1055_1855 266
151 3300050494 nmdc:mga06z11_159057_c1 nmdc:mga06z11_159057_c1_62_862 266
152 3300050494 nmdc:mga06z11_244047_c1 nmdc:mga06z11_244047_c1_31_831 266
153 3300050496 nmdc:mga07m45_2793_c2 nmdc:mga07m45_2793_c2_1694_2494 266
154 3300050496 nmdc:mga07m45_82317_c1 nmdc:mga07m45_82317_c1_694_1494 266
155 3300050516 nmdc:mga0sz30_105633_c1 nmdc:mga0sz30_105633_c1_231_1031 266
156 3300053108 Ga0500562_002855 Ga0500562_002855_975_1781 266
157 iso_pu_bacteria 2894023352 2894024943 266
158 3300002774 JGI25150J39212_1001772 JGI25150J39212_10017726 267
159 3300002774 JGI25150J39212_1014412 JGI25150J39212_10144121 267
160 3300003187 JGI25151J46595_10012355 JGI25151J46595_100123554 267
161 3300003215 JGI25153J46596_10018590 JGI25153J46596_100185902 267
162 3300003354 JGI25160J50197_1013974 JGI25160J50197_10139743 267
163 3300003374 JGI25161J50226_1004864 JGI25161J50226_10048644 267
164 3300003374 JGI25161J50226_1009372 JGI25161J50226_10093722 267
165 3300003760 Ga0055527_1006839 Ga0055527_10068392 267
166 3300003761 Ga0055535_1000260 Ga0055535_100026036 267
167 3300003762 Ga0055542_1000013 Ga0055542_1000013230 267
168 3300003763 Ga0055529_1002592 Ga0055529_10025922 267
169 3300003771 Ga0055526_1014267 Ga0055526_10142675 267
170 3300003771 Ga0055526_1017494 Ga0055526_10174942 267
171 3300003773 Ga0055537_1000922 Ga0055537_10009225 267
172 3300003775 Ga0055524_1015825 Ga0055524_10158252 267
173 3300003775 Ga0055524_1016512 Ga0055524_10165124 267
174 3300003784 Ga0055534_1000138 Ga0055534_100013838 267
175 3300003790 Ga0055528_1003358 Ga0055528_10033589 267
176 3300003791 Ga0055530_10029344 Ga0055530_100293442 267
177 3300003792 Ga0055540_1002855 Ga0055540_10028556 267
178 3300003792 Ga0055540_1003745 Ga0055540_10037453 267
179 3300003794 Ga0055531_10058180 Ga0055531_100581801 267
180 3300004625 Ga0055543_1002039 Ga0055543_10020394 267
181 3300004625 Ga0055543_1004369 Ga0055543_10043694 267
182 3300005262 Ga0065165_1007017 Ga0065165_10070174 267
183 3300005262 Ga0065165_1036092 Ga0065165_10360921 267
184 3300005288 Ga0065714_10095103 Ga0065714_100951033 267
185 3300005328 Ga0070676_10294542 Ga0070676_102945421 267
186 3300005331 Ga0070670_100116518 Ga0070670_1001165182 267
187 3300005331 Ga0070670_100366897 Ga0070670_1003668971 267
188 3300005333 Ga0070677_10004569 Ga0070677_100045695 267
189 3300005333 Ga0070677_10026341 Ga0070677_100263412 267
190 3300005333 Ga0070677_10041514 Ga0070677_100415142 267
191 3300005347 Ga0070668_100174073 Ga0070668_1001740733 267
192 3300005353 Ga0070669_100042109 Ga0070669_1000421092 267
193 3300005354 Ga0070675_100003640 Ga0070675_1000036405 267
194 3300005354 Ga0070675_100396320 Ga0070675_1003963202 267
195 3300005355 Ga0070671_100003362 Ga0070671_1000033626 267
196 3300005355 Ga0070671_100094857 Ga0070671_1000948571 267
197 3300005364 Ga0070673_100013143 Ga0070673_1000131434 267
198 3300005364 Ga0070673_100148408 Ga0070673_1001484082 267
199 3300005364 Ga0070673_100630742 Ga0070673_1006307421 267
200 3300005365 Ga0070688_100072960 Ga0070688_1000729603 267
201 3300005367 Ga0070667_100018875 Ga0070667_1000188753 267
202 3300005367 Ga0070667_100375375 Ga0070667_1003753752 267
203 3300005435 Ga0070714_100014672 Ga0070714_1000146725 267
204 3300005436 Ga0070713_100015395 Ga0070713_1000153953 267
205 3300005441 Ga0070700_100135469 Ga0070700_1001354692 267
206 3300005456 Ga0070678_100003291 Ga0070678_1000032916 267
207 3300005456 Ga0070678_100014948 Ga0070678_1000149483 267
208 3300005456 Ga0070678_100031946 Ga0070678_1000319463 267
209 3300005457 Ga0070662_100489586 Ga0070662_1004895861 267
210 3300005530 Ga0070679_100010359 Ga0070679_1000103593 267
211 3300005539 Ga0068853_100137681 Ga0068853_1001376813 267
212 3300005543 Ga0070672_100021540 Ga0070672_1000215405 267
213 3300005543 Ga0070672_100147814 Ga0070672_1001478142 267
214 3300005544 Ga0070686_100134465 Ga0070686_1001344652 267
215 3300005548 Ga0070665_100062004 Ga0070665_1000620042 267
216 3300005548 Ga0070665_100501927 Ga0070665_1005019272 267
217 3300005577 Ga0068857_100030061 Ga0068857_1000300616 267
218 3300005577 Ga0068857_100187432 Ga0068857_1001874322 267
219 3300005578 Ga0068854_100180519 Ga0068854_1001805192 267
220 3300005614 Ga0068856_100103102 Ga0068856_1001031023 267
221 3300005617 Ga0068859_100013199 Ga0068859_1000131996 267
222 3300005617 Ga0068859_100037016 Ga0068859_1000370165 267
223 3300005617 Ga0068859_100318716 Ga0068859_1003187162 267
224 3300005618 Ga0068864_100002240 Ga0068864_10000224015 267
225 3300005618 Ga0068864_100074998 Ga0068864_1000749983 267
226 3300005719 Ga0068861_100016474 Ga0068861_1000164744 267
227 3300005834 Ga0068851_10004053 Ga0068851_100040534 267
228 3300005841 Ga0068863_100005528 Ga0068863_1000055285 267
229 3300005841 Ga0068863_100044781 Ga0068863_1000447815 267
230 3300005842 Ga0068858_100003274 Ga0068858_1000032745 267
231 3300005842 Ga0068858_100004778 Ga0068858_1000047787 267
232 3300005842 Ga0068858_100047756 Ga0068858_1000477564 267
233 3300005843 Ga0068860_100000371 Ga0068860_10000037143 267
234 3300005843 Ga0068860_100001058 Ga0068860_10000105813 267
235 3300005843 Ga0068860_100323975 Ga0068860_1003239752 267
236 3300005844 Ga0068862_100031775 Ga0068862_1000317752 267
237 3300005844 Ga0068862_100102662 Ga0068862_1001026622 267
238 3300005844 Ga0068862_100106247 Ga0068862_1001062473 267
239 3300006028 Ga0070717_10063928 Ga0070717_100639283 267
240 3300006038 Ga0075365_10053524 Ga0075365_100535242 267
241 3300006038 Ga0075365_10128873 Ga0075365_101288732 267
242 3300006048 Ga0075363_100033381 Ga0075363_1000333813 267
243 3300006048 Ga0075363_100039475 Ga0075363_1000394752 267
244 3300006048 Ga0075363_100089811 Ga0075363_1000898113 267
245 3300006051 Ga0075364_10117244 Ga0075364_101172443 267
246 3300006177 Ga0075362_10002917 Ga0075362_100029176 267
247 3300006177 Ga0075362_10006043 Ga0075362_100060434 267
248 3300006177 Ga0075362_10022445 Ga0075362_100224452 267
249 3300006177 Ga0075362_10025590 Ga0075362_100255902 267
250 3300006178 Ga0075367_10156135 Ga0075367_101561352 267
251 3300006195 Ga0075366_10001720 Ga0075366_100017209 267
252 3300006195 Ga0075366_10002197 Ga0075366_100021974 267
253 3300006195 Ga0075366_10015615 Ga0075366_100156151 267
254 3300006195 Ga0075366_10054941 Ga0075366_100549412 267
255 3300006195 Ga0075366_10066711 Ga0075366_100667113 267
256 3300006195 Ga0075366_10114721 Ga0075366_101147212 267
257 3300006195 Ga0075366_10182753 Ga0075366_101827532 267
258 3300006237 Ga0097621_100009715 Ga0097621_1000097155 267
259 3300006237 Ga0097621_100040702 Ga0097621_1000407022 267
260 3300006237 Ga0097621_100294537 Ga0097621_1002945372 267
261 3300006237 Ga0097621_100506586 Ga0097621_1005065862 267
262 3300006237 Ga0097621_100707771 Ga0097621_1007077711 267
263 3300006353 Ga0075370_10000534 Ga0075370_100005348 267
264 3300006353 Ga0075370_10010367 Ga0075370_100103672 267
265 3300006353 Ga0075370_10010499 Ga0075370_100104994 267
266 3300006353 Ga0075370_10014006 Ga0075370_100140063 267
267 3300006353 Ga0075370_10014626 Ga0075370_100146265 267
268 3300006353 Ga0075370_10030994 Ga0075370_100309943 267
269 3300006353 Ga0075370_10032676 Ga0075370_100326761 267
270 3300006353 Ga0075370_10059761 Ga0075370_100597612 267
271 3300006358 Ga0068871_100024386 Ga0068871_1000243863 267
272 3300006358 Ga0068871_100743921 Ga0068871_1007439211 267
273 3300006881 Ga0068865_100245885 Ga0068865_1002458852 267
274 3300006881 Ga0068865_100272018 Ga0068865_1002720182 267
275 3300006931 Ga0097620_100013199 Ga0097620_1000131995 267
276 3300006931 Ga0097620_100037016 Ga0097620_1000370165 267
277 3300006931 Ga0097620_100318712 Ga0097620_1003187122 267
278 3300006946 Ga0079104_1000008 Ga0079104_1000008180 267
279 3300006948 Ga0099826_10018923 Ga0099826_100189234 267
280 3300009036 Ga0105244_10001247 Ga0105244_1000124715 267
281 3300009036 Ga0105244_10010868 Ga0105244_100108685 267
282 3300009092 Ga0105250_10000043 Ga0105250_1000004358 267
283 3300009093 Ga0105240_10054320 Ga0105240_100543203 267
284 3300009098 Ga0105245_10046840 Ga0105245_100468403 267
285 3300009098 Ga0105245_10603297 Ga0105245_106032972 267
286 3300009101 Ga0105247_10008264 Ga0105247_100082645 267
287 3300009148 Ga0105243_10001568 Ga0105243_1000156815 267
288 3300009148 Ga0105243_10002163 Ga0105243_100021634 267
289 3300009148 Ga0105243_10004514 Ga0105243_1000451410 267
290 3300009148 Ga0105243_10048919 Ga0105243_100489194 267
291 3300009148 Ga0105243_10072505 Ga0105243_100725053 267
292 3300009174 Ga0105241_10495594 Ga0105241_104955942 267
293 3300009176 Ga0105242_10100850 Ga0105242_101008503 267
294 3300009176 Ga0105242_10162328 Ga0105242_101623282 267
295 3300009177 Ga0105248_10026007 Ga0105248_100260074 267
296 3300009177 Ga0105248_10195703 Ga0105248_101957033 267
297 3300009545 Ga0105237_10083745 Ga0105237_100837452 267
298 3300009545 Ga0105237_10342139 Ga0105237_103421392 267
299 3300009551 Ga0105238_10056308 Ga0105238_100563083 267
300 3300009553 Ga0105249_10078699 Ga0105249_100786994 267
301 3300010159 Ga0099796_10002453 Ga0099796_100024535 267
302 3300010375 Ga0105239_10143210 Ga0105239_101432103 267
303 3300010375 Ga0105239_10444889 Ga0105239_104448892 267
304 3300010375 Ga0105239_10943188 Ga0105239_109431881 267
305 3300011119 Ga0105246_10635010 Ga0105246_106350101 267
306 3300013104 Ga0157370_10124733 Ga0157370_101247333 267
307 3300013105 Ga0157369_10026781 Ga0157369_100267812 267
308 3300013296 Ga0157374_10537236 Ga0157374_105372361 267
309 3300013297 Ga0157378_10015128 Ga0157378_100151286 267
310 3300013297 Ga0157378_10127355 Ga0157378_101273552 267
311 3300013306 Ga0163162_10003522 Ga0163162_100035229 267
312 3300013306 Ga0163162_10268555 Ga0163162_102685552 267
313 3300013307 Ga0157372_10062587 Ga0157372_100625872 267
314 3300013308 Ga0157375_10017779 Ga0157375_100177792 267
315 3300013308 Ga0157375_10020971 Ga0157375_100209715 267
316 3300013308 Ga0157375_10095185 Ga0157375_100951854 267
317 3300013308 Ga0157375_11051467 Ga0157375_110514671 267
318 3300014325 Ga0163163_10064045 Ga0163163_100640453 267
319 3300014325 Ga0163163_10100384 Ga0163163_101003845 267
320 3300014325 Ga0163163_10154346 Ga0163163_101543462 267
321 3300014325 Ga0163163_10402479 Ga0163163_104024792 267
322 3300014325 Ga0163163_10665290 Ga0163163_106652902 267
323 3300014497 Ga0182008_10004684 Ga0182008_100046847 267
324 3300014497 Ga0182008_10012898 Ga0182008_100128984 267
325 3300014968 Ga0157379_10019351 Ga0157379_100193517 267
326 3300014968 Ga0157379_10267110 Ga0157379_102671102 267
327 3300014969 Ga0157376_10144267 Ga0157376_101442672 267
328 3300015261 Ga0182006_1009529 Ga0182006_10095294 267
329 3300015262 Ga0182007_10000359 Ga0182007_1000035915 267
330 3300015683 Ga0183362_10004 Ga0183362_10004464 267
331 3300017792 Ga0163161_10000842 Ga0163161_1000084219 267
332 3300017792 Ga0163161_10001977 Ga0163161_1000197715 267
333 3300021361 Ga0213872_10008739 Ga0213872_100087393 267
334 3300025208 Ga0209436_103311 Ga0209436_1033113 267
335 3300025228 Ga0209672_100958 Ga0209672_1009584 267
336 3300025229 Ga0209147_100771 Ga0209147_10077114 267
337 3300025242 Ga0209258_100020 Ga0209258_100020386 267
338 3300025242 Ga0209258_110342 Ga0209258_1103422 267
339 3300025245 Ga0207425_1000286 Ga0207425_10002868 267
340 3300025245 Ga0207425_1008461 Ga0207425_10084614 267
341 3300025254 Ga0209148_1000031 Ga0209148_1000031386 267
342 3300025258 Ga0209129_1000406 Ga0209129_10004065 267
343 3300025263 Ga0209565_1000078 Ga0209565_100007844 267
344 3300025263 Ga0209565_1000181 Ga0209565_100018118 267
345 3300025263 Ga0209565_1003024 Ga0209565_10030241 267
346 3300025263 Ga0209565_1015625 Ga0209565_10156253 267
347 3300025272 Ga0209455_1001046 Ga0209455_10010464 267
348 3300025273 Ga0209673_1000442 Ga0209673_100044218 267
349 3300025273 Ga0209673_1001199 Ga0209673_10011994 267
350 3300025273 Ga0209673_1001899 Ga0209673_10018998 267
351 3300025273 Ga0209673_1003029 Ga0209673_10030292 267
352 3300025284 Ga0209130_1000443 Ga0209130_100044317 267
353 3300025284 Ga0209130_1000673 Ga0209130_10006738 267
354 3300025291 Ga0209675_1000055 Ga0209675_1000055140 267
355 3300025291 Ga0209675_1000339 Ga0209675_100033920 267
356 3300025291 Ga0209675_1001290 Ga0209675_100129011 267
357 3300025291 Ga0209675_1042746 Ga0209675_10427462 267
358 3300025292 Ga0209676_1000040 Ga0209676_1000040279 267
359 3300025292 Ga0209676_1000312 Ga0209676_100031220 267
360 3300025292 Ga0209676_1039785 Ga0209676_10397852 267
361 3300025294 Ga0209025_1000242 Ga0209025_100024230 267
362 3300025294 Ga0209025_1000512 Ga0209025_100051236 267
363 3300025294 Ga0209025_1001359 Ga0209025_100135924 267
364 3300025294 Ga0209025_1001384 Ga0209025_100138417 267
365 3300025294 Ga0209025_1023497 Ga0209025_10234973 267
366 3300025295 Ga0209564_1000157 Ga0209564_100015734 267
367 3300025295 Ga0209564_1000806 Ga0209564_100080638 267
368 3300025297 Ga0209758_1000042 Ga0209758_1000042115 267
369 3300025297 Ga0209758_1036340 Ga0209758_10363403 267
370 3300025298 Ga0209050_1000021 Ga0209050_1000021114 267
371 3300025298 Ga0209050_1012191 Ga0209050_10121914 267
372 3300025299 Ga0209256_1000056 Ga0209256_1000056159 267
373 3300025299 Ga0209256_1000124 Ga0209256_100012489 267
374 3300025302 Ga0207426_1000055 Ga0207426_1000055216 267
375 3300025302 Ga0207426_1000079 Ga0207426_1000079112 267
376 3300025303 Ga0209051_1000111 Ga0209051_100011120 267
377 3300025303 Ga0209051_1000423 Ga0209051_100042329 267
378 3300025303 Ga0209051_1000436 Ga0209051_100043626 267
379 3300025303 Ga0209051_1001224 Ga0209051_100122420 267
380 3300025304 Ga0209257_1000043 Ga0209257_1000043109 267
381 3300025304 Ga0209257_1000215 Ga0209257_1000215103 267
382 3300025304 Ga0209257_1006849 Ga0209257_10068494 267
383 3300025321 Ga0207656_10004630 Ga0207656_100046304 267
384 3300025711 Ga0207696_1000424 Ga0207696_10004243 267
385 3300025728 Ga0207655_1001321 Ga0207655_10013212 267
386 3300025893 Ga0207682_10015042 Ga0207682_100150423 267
387 3300025893 Ga0207682_10020389 Ga0207682_100203892 267
388 3300025898 Ga0207692_10065557 Ga0207692_100655572 267
389 3300025900 Ga0207710_10010003 Ga0207710_100100035 267
390 3300025907 Ga0207645_10131775 Ga0207645_101317752 267
391 3300025907 Ga0207645_10208326 Ga0207645_102083261 267
392 3300025913 Ga0207695_10082278 Ga0207695_100822782 267
393 3300025913 Ga0207695_10122651 Ga0207695_101226513 267
394 3300025913 Ga0207695_10257041 Ga0207695_102570412 267
395 3300025914 Ga0207671_10030696 Ga0207671_100306965 267
396 3300025914 Ga0207671_10137806 Ga0207671_101378063 267
397 3300025914 Ga0207671_10270064 Ga0207671_102700641 267
398 3300025914 Ga0207671_10307381 Ga0207671_103073812 267
399 3300025916 Ga0207663_10134044 Ga0207663_101340441 267
400 3300025917 Ga0207660_10027724 Ga0207660_100277245 267
401 3300025918 Ga0207662_10175611 Ga0207662_101756112 267
402 3300025921 Ga0207652_10036216 Ga0207652_100362165 267
403 3300025923 Ga0207681_10060993 Ga0207681_100609932 267
404 3300025925 Ga0207650_10150408 Ga0207650_101504083 267
405 3300025925 Ga0207650_10254853 Ga0207650_102548532 267
406 3300025926 Ga0207659_10072560 Ga0207659_100725604 267
407 3300025926 Ga0207659_10146746 Ga0207659_101467462 267
408 3300025927 Ga0207687_10127542 Ga0207687_101275422 267
409 3300025928 Ga0207700_10066934 Ga0207700_100669343 267
410 3300025929 Ga0207664_10003449 Ga0207664_100034492 267
411 3300025931 Ga0207644_10002626 Ga0207644_100026265 267
412 3300025931 Ga0207644_10025739 Ga0207644_100257394 267
413 3300025931 Ga0207644_10091115 Ga0207644_100911152 267
414 3300025932 Ga0207690_10097368 Ga0207690_100973683 267
415 3300025933 Ga0207706_10038355 Ga0207706_100383553 267
416 3300025933 Ga0207706_10065370 Ga0207706_100653703 267
417 3300025933 Ga0207706_10149905 Ga0207706_101499053 267
418 3300025933 Ga0207706_10321957 Ga0207706_103219572 267
419 3300025934 Ga0207686_10061983 Ga0207686_100619832 267
420 3300025934 Ga0207686_10143380 Ga0207686_101433803 267
421 3300025935 Ga0207709_10000070 Ga0207709_1000007016 267
422 3300025935 Ga0207709_10000394 Ga0207709_1000039439 267
423 3300025935 Ga0207709_10002808 Ga0207709_100028087 267
424 3300025935 Ga0207709_10015819 Ga0207709_100158195 267
425 3300025935 Ga0207709_10039627 Ga0207709_100396273 267
426 3300025938 Ga0207704_10099597 Ga0207704_100995971 267
427 3300025938 Ga0207704_10133902 Ga0207704_101339021 267
428 3300025940 Ga0207691_10018059 Ga0207691_100180595 267
429 3300025940 Ga0207691_10035583 Ga0207691_100355835 267
430 3300025940 Ga0207691_10105069 Ga0207691_101050692 267
431 3300025940 Ga0207691_10239222 Ga0207691_102392222 267
432 3300025941 Ga0207711_10015375 Ga0207711_100153755 267
433 3300025941 Ga0207711_10121057 Ga0207711_101210572 267
434 3300025941 Ga0207711_10434700 Ga0207711_104347002 267
435 3300025942 Ga0207689_10054741 Ga0207689_100547415 267
436 3300025942 Ga0207689_10309493 Ga0207689_103094932 267
437 3300025945 Ga0207679_10604520 Ga0207679_106045202 267
438 3300025960 Ga0207651_10055471 Ga0207651_100554711 267
439 3300025960 Ga0207651_10058227 Ga0207651_100582272 267
440 3300025960 Ga0207651_10231222 Ga0207651_102312221 267
441 3300025961 Ga0207712_10049088 Ga0207712_100490884 267
442 3300025972 Ga0207668_10453067 Ga0207668_104530672 267
443 3300025981 Ga0207640_10080320 Ga0207640_100803202 267
444 3300025981 Ga0207640_10108229 Ga0207640_101082292 267
445 3300025986 Ga0207658_10053035 Ga0207658_100530352 267
446 3300025986 Ga0207658_10057826 Ga0207658_100578263 267
447 3300025986 Ga0207658_10236337 Ga0207658_102363372 267
448 3300025986 Ga0207658_10254487 Ga0207658_102544872 267
449 3300026023 Ga0207677_10071828 Ga0207677_100718283 267
450 3300026035 Ga0207703_10001680 Ga0207703_1000168015 267
451 3300026035 Ga0207703_10147259 Ga0207703_101472592 267
452 3300026041 Ga0207639_10104394 Ga0207639_101043942 267
453 3300026041 Ga0207639_10141873 Ga0207639_101418732 267
454 3300026067 Ga0207678_10028486 Ga0207678_100284862 267
455 3300026067 Ga0207678_10087406 Ga0207678_100874062 267
456 3300026067 Ga0207678_10764593 Ga0207678_107645931 267
457 3300026075 Ga0207708_10007039 Ga0207708_100070397 267
458 3300026078 Ga0207702_10034475 Ga0207702_100344755 267
459 3300026088 Ga0207641_10000273 Ga0207641_1000027343 267
460 3300026088 Ga0207641_10122257 Ga0207641_101222573 267
461 3300026088 Ga0207641_10267316 Ga0207641_102673162 267
462 3300026088 Ga0207641_10735513 Ga0207641_107355131 267
463 3300026089 Ga0207648_10001832 Ga0207648_1000183212 267
464 3300026089 Ga0207648_10047113 Ga0207648_100471133 267
465 3300026089 Ga0207648_10230215 Ga0207648_102302152 267
466 3300026095 Ga0207676_10013465 Ga0207676_100134656 267
467 3300026116 Ga0207674_10021133 Ga0207674_100211335 267
468 3300026116 Ga0207674_10024162 Ga0207674_100241628 267
469 3300026118 Ga0207675_100027120 Ga0207675_1000271204 267
470 3300026118 Ga0207675_100092269 Ga0207675_1000922692 267
471 3300026121 Ga0207683_10020420 Ga0207683_100204206 267
472 3300026121 Ga0207683_10087069 Ga0207683_100870694 267
473 3300026121 Ga0207683_10250904 Ga0207683_102509041 267
474 3300026142 Ga0207698_10081158 Ga0207698_100811582 267
475 3300027111 Ga0209281_1000029 Ga0209281_1000029217 267
476 3300027666 Ga0209282_1004597 Ga0209282_10045977 267
477 3300028379 Ga0268266_10129803 Ga0268266_101298032 267
478 3300028380 Ga0268265_10085953 Ga0268265_100859533 267
479 3300028380 Ga0268265_10156685 Ga0268265_101566852 267
480 3300028380 Ga0268265_10187619 Ga0268265_101876192 267
481 3300028381 Ga0268264_10000151 Ga0268264_1000015192 267
482 3300028381 Ga0268264_10010515 Ga0268264_100105154 267
483 3300028786 Ga0307517_10176598 Ga0307517_101765982 267
484 3300028794 Ga0307515_10000101 Ga0307515_1000010153 267
485 3300028794 Ga0307515_10000322 Ga0307515_10000322104 267
486 3300028794 Ga0307515_10000877 Ga0307515_1000087752 267
487 3300028794 Ga0307515_10003504 Ga0307515_100035043 267
488 3300028794 Ga0307515_10087893 Ga0307515_100878934 267
489 3300028794 Ga0307515_10132267 Ga0307515_101322673 267
490 3300028794 Ga0307515_10275249 Ga0307515_102752493 267
491 3300028794 Ga0307515_10452152 Ga0307515_104521521 267
492 3300028800 Ga0265338_10085451 Ga0265338_100854512 267
493 3300030733 Ga0314311_1058476 Ga0314311_10584763 267
494 3300031251 Ga0265327_10007110 Ga0265327_100071107 267
495 3300031456 Ga0307513_10004142 Ga0307513_100041422 267
496 3300031456 Ga0307513_10005935 Ga0307513_100059356 267
497 3300031456 Ga0307513_10031821 Ga0307513_100318213 267
498 3300031456 Ga0307513_10064112 Ga0307513_100641122 267
499 3300031456 Ga0307513_10182249 Ga0307513_101822493 267
500 3300031507 Ga0307509_10000215 Ga0307509_1000021517 267
501 3300031507 Ga0307509_10006676 Ga0307509_1000667614 267
502 3300031507 Ga0307509_10143968 Ga0307509_101439682 267
503 3300031548 Ga0307408_100024281 Ga0307408_1000242813 267
504 3300031548 Ga0307408_100093617 Ga0307408_1000936172 267
505 3300031548 Ga0307408_100264336 Ga0307408_1002643362 267
506 3300031616 Ga0307508_10000053 Ga0307508_1000005338 267
507 3300031649 Ga0307514_10002392 Ga0307514_100023923 267
508 3300031649 Ga0307514_10003568 Ga0307514_100035685 267
509 3300031730 Ga0307516_10108158 Ga0307516_101081582 267
510 3300031730 Ga0307516_10124000 Ga0307516_101240001 267
511 3300031731 Ga0307405_10007767 Ga0307405_100077673 267
512 3300031731 Ga0307405_10058878 Ga0307405_100588782 267
513 3300031731 Ga0307405_10165947 Ga0307405_101659472 267
514 3300031824 Ga0307413_10242857 Ga0307413_102428571 267
515 3300031901 Ga0307406_10000240 Ga0307406_1000024022 267
516 3300031901 Ga0307406_10213167 Ga0307406_102131672 267
517 3300031903 Ga0307407_10049413 Ga0307407_100494134 267
518 3300031911 Ga0307412_10017679 Ga0307412_100176793 267
519 3300031911 Ga0307412_10116804 Ga0307412_101168043 267
520 3300031911 Ga0307412_10368280 Ga0307412_103682801 267
521 3300031911 Ga0307412_10507000 Ga0307412_105070001 267
522 3300031911 Ga0307412_10595964 Ga0307412_105959641 267
523 3300031995 Ga0307409_100009343 Ga0307409_1000093436 267
524 3300032002 Ga0307416_100006086 Ga0307416_1000060869 267
525 3300032002 Ga0307416_100137674 Ga0307416_1001376743 267
526 3300032126 Ga0307415_100002654 Ga0307415_1000026548 267
527 3300033180 Ga0307510_10000003 Ga0307510_10000003387 267
528 3300033180 Ga0307510_10000364 Ga0307510_1000036439 267
529 3300033180 Ga0307510_10049353 Ga0307510_100493534 267
530 3300033180 Ga0307510_10268342 Ga0307510_102683422 267
531 3300033180 Ga0307510_10338194 Ga0307510_103381942 267
532 3300035114 Ga0373939_0059475 Ga0373939_0059475_22_825 267
533 3300037312 Ga0395899_0000035 Ga0395899_0000035_23318_24121 267
534 3300037312 Ga0395899_0042074 Ga0395899_0042074_1595_2398 267
535 3300037418 Ga0395900_0000113 Ga0395900_0000113_23318_24121 267
536 3300037466 Ga0395898_0000444 Ga0395898_0000444_20142_20945 267
537 3300037471 Ga0395905_0018804 Ga0395905_0018804_4384_5211 267
538 3300037471 Ga0395905_0063884 Ga0395905_0063884_2403_3206 267
539 3300038443 Ga0395901_0000718 Ga0395901_0000718_13422_14285 267
540 3300038443 Ga0395901_0001521 Ga0395901_0001521_7139_7942 267
541 3300039438 Ga0436360_0505175 Ga0436360_0505175_1622_2425 267
542 3300039447 Ga0436361_0730633 Ga0436361_0730633_61372_62175 267
543 3300039450 Ga0436363_1689440 Ga0436363_1689440_8094_8903 267
544 3300041404 Ga0439436_0001899 Ga0439436_0001899_3772_4575 267
545 3300041404 Ga0439436_0009738 Ga0439436_0009738_421_1224 267
546 3300041404 Ga0439436_0010303 Ga0439436_0010303_400_1203 267
547 3300041411 Ga0439466_0008532 Ga0439466_0008532_1627_2430 267
548 3300041411 Ga0439466_0017261 Ga0439466_0017261_230_1033 267
549 3300041411 Ga0439466_0021720 Ga0439466_0021720_871_1674 267
550 3300041999 Ga0439433_0025447 Ga0439433_0025447_224_1027 267
551 3300042002 Ga0439442_004262 Ga0439442_004262_486_1289 267
552 3300042004 Ga0439445_0010765 Ga0439445_0010765_646_1449 267
553 3300042006 Ga0439432_018413 Ga0439432_018413_422_1225 267
554 3300042007 Ga0439449_0007892 Ga0439449_0007892_2424_3227 267
555 3300042010 Ga0439452_005666 Ga0439452_005666_2235_3038 267
556 3300042014 Ga0439457_014209 Ga0439457_014209_796_1599 267
557 3300042015 Ga0439462_0006248 Ga0439462_0006248_866_1669 267
558 3300042125 Ga0450923_002449 Ga0450923_002449_322_1125 267
559 3300042134 Ga0450898_002238 Ga0450898_002238_507_1310 267
560 3300042135 Ga0450899_003957 Ga0450899_003957_731_1534 267
561 3300042435 Ga0439434_0009312 Ga0439434_0009312_876_1679 267
562 3300042435 Ga0439434_0011581 Ga0439434_0011581_767_1570 267
563 3300042531 Ga0450918_000332 Ga0450918_000332_3078_3881 267
564 3300042532 Ga0450893_0013478 Ga0450893_0013478_439_1242 267
565 3300044656 Ga0466969_0017951 Ga0466969_0017951_2689_3492 267
566 3300044656 Ga0466969_0041865 Ga0466969_0041865_623_1426 267
567 3300044683 Ga0466965_0089505 Ga0466965_0089505_397_1200 267
568 3300044684 Ga0466966_0027942 Ga0466966_0027942_1611_2414 267
569 3300044693 Ga0466961_0029680 Ga0466961_0029680_180_983 267
570 3300044712 Ga0453684_0143830 Ga0453684_0143830_1816_2622 267
571 3300045049 Ga0466959_0004321 Ga0466959_0004321_2048_2851 267
572 3300045049 Ga0466959_0146256 Ga0466959_0146256_619_1422 267
573 3300045051 Ga0451576_0004945 Ga0451576_0004945_14453_15280 267
574 3300045051 Ga0451576_0216083 Ga0451576_0216083_513_1316 267
575 3300045836 Ga0466958_0000765 Ga0466958_0000765_1936_2739 267
576 3300045836 Ga0466958_0009225 Ga0466958_0009225_2140_2943 267
577 3300046454 Ga0495592_0000173 Ga0495592_0000173_3522_4325 267
578 3300046459 Ga0495629_0426395 Ga0495629_0426395_65_868 267
579 3300046460 Ga0495638_0153364 Ga0495638_0153364_489_1292 267
580 3300046475 Ga0495639_0022234 Ga0495639_0022234_124_927 267
581 3300046507 Ga0495606_0006456 Ga0495606_0006456_8433_9236 267
582 3300046507 Ga0495606_0082228 Ga0495606_0082228_742_1545 267
583 3300046513 Ga0495616_0020994 Ga0495616_0020994_2083_2886 267
584 3300046518 Ga0495631_0002066 Ga0495631_0002066_4000_4803 267
585 3300046519 Ga0495632_0003077 Ga0495632_0003077_1509_2312 267
586 3300046529 Ga0495652_0054302 Ga0495652_0054302_1060_1863 267
587 3300046531 Ga0495665_0060761 Ga0495665_0060761_237_1040 267
588 3300046539 Ga0495621_0080220 Ga0495621_0080220_295_1098 267
589 3300046542 Ga0495597_0024569 Ga0495597_0024569_666_1478 267
590 3300046543 Ga0495645_0008045 Ga0495645_0008045_2316_3119 267
591 3300046543 Ga0495645_0063703 Ga0495645_0063703_85_888 267
592 3300046615 Ga0495656_0053999 Ga0495656_0053999_814_1617 267
593 3300046616 Ga0495668_0020719 Ga0495668_0020719_2322_3125 267
594 3300046648 Ga0495611_0130508 Ga0495611_0130508_313_1116 267
595 3300046660 Ga0495625_0000206 Ga0495625_0000206_25275_26078 267
596 3300046660 Ga0495625_0028232 Ga0495625_0028232_2075_2878 267
597 3300046665 Ga0495661_0001271 Ga0495661_0001271_17757_18560 267
598 3300046665 Ga0495661_0082960 Ga0495661_0082960_592_1395 267
599 3300046674 Ga0495588_0034670 Ga0495588_0034670_32_835 267
600 3300046678 Ga0495599_0098473 Ga0495599_0098473_831_1634 267
601 3300046680 Ga0495646_0003204 Ga0495646_0003204_8668_9471 267
602 3300046680 Ga0495646_0122555 Ga0495646_0122555_508_1311 267
603 3300046690 Ga0495624_0027527 Ga0495624_0027527_715_1518 267
604 3300046690 Ga0495624_0051090 Ga0495624_0051090_857_1660 267
605 3300046691 Ga0495670_0022247 Ga0495670_0022247_1650_2453 267
606 3300046692 Ga0495671_0020716 Ga0495671_0020716_2166_2969 267
607 3300046692 Ga0495671_0196104 Ga0495671_0196104_132_935 267
608 3300046694 Ga0495649_0004289 Ga0495649_0004289_2685_3497 267
609 3300046694 Ga0495649_0007271 Ga0495649_0007271_3703_4506 267
610 3300046810 Ga0495660_0166002 Ga0495660_0166002_159_962 267
611 3300047323 Ga0495683_0005760 Ga0495683_0005760_4590_5393 267
612 3300047443 Ga0495687_001027 Ga0495687_001027_21176_21988 267
613 3300047443 Ga0495687_029024 Ga0495687_029024_790_1602 267
614 3300047443 Ga0495687_081862 Ga0495687_081862_383_1186 267
615 3300047673 Ga0495593_0012279 Ga0495593_0012279_1062_1865 267
616 3300047673 Ga0495593_0250632 Ga0495593_0250632_39_842 267
617 3300048089 Ga0495614_0016572 Ga0495614_0016572_133_936 267
618 3300048091 Ga0495626_0048618 Ga0495626_0048618_342_1154 267
619 3300048903 Ga0496100_0027575 Ga0496100_0027575_1563_2366 267
620 3300048903 Ga0496100_0085758 Ga0496100_0085758_826_1629 267
621 3300048904 Ga0496101_0001978 Ga0496101_0001978_9354_10157 267
622 3300048905 Ga0496102_0002447 Ga0496102_0002447_2405_3208 267
623 3300048905 Ga0496102_0036739 Ga0496102_0036739_1995_2798 267
624 3300048906 Ga0496103_0035714 Ga0496103_0035714_1465_2268 267
625 3300048907 Ga0496104_0052112 Ga0496104_0052112_2083_2886 267
626 3300048908 Ga0496105_0005298 Ga0496105_0005298_2339_3142 267
627 3300048908 Ga0496105_0151897 Ga0496105_0151897_836_1639 267
628 3300048911 Ga0496108_0208093 Ga0496108_0208093_218_1021 267
629 3300048911 Ga0496108_0312914 Ga0496108_0312914_223_1026 267
630 3300048913 Ga0496110_0036920 Ga0496110_0036920_2717_3520 267
631 3300048914 Ga0496111_0092371 Ga0496111_0092371_1208_2011 267
632 3300048915 Ga0496112_0472561 Ga0496112_0472561_46_849 267
633 3300048917 Ga0496114_0046200 Ga0496114_0046200_1570_2373 267
634 3300048919 Ga0496116_0023452 Ga0496116_0023452_663_1466 267
635 3300048919 Ga0496116_0043537 Ga0496116_0043537_1303_2106 267
636 3300048920 Ga0496117_0000186 Ga0496117_0000186_122959_123762 267
637 3300048920 Ga0496117_0047932 Ga0496117_0047932_1078_1881 267
638 3300048920 Ga0496117_0073591 Ga0496117_0073591_188_991 267
639 3300048921 Ga0496118_0000003 Ga0496118_0000003_315550_316353 267
640 3300048921 Ga0496118_0018486 Ga0496118_0018486_953_1756 267
641 3300048921 Ga0496118_0021335 Ga0496118_0021335_1281_2084 267
642 3300048921 Ga0496118_0146734 Ga0496118_0146734_425_1228 267
643 3300048922 Ga0496119_0001832 Ga0496119_0001832_14000_14803 267
644 3300048922 Ga0496119_0008384 Ga0496119_0008384_2037_2840 267
645 3300048922 Ga0496119_0061827 Ga0496119_0061827_986_1789 267
646 3300048923 Ga0496120_0000232 Ga0496120_0000232_19665_20468 267
647 3300048923 Ga0496120_0049700 Ga0496120_0049700_915_1718 267
648 3300048924 Ga0496121_0035691 Ga0496121_0035691_1082_1885 267
649 3300048924 Ga0496121_0103970 Ga0496121_0103970_1285_2088 267
650 3300048924 Ga0496121_0110605 Ga0496121_0110605_197_1000 267
651 3300048926 Ga0496123_0051703 Ga0496123_0051703_1235_2038 267
652 3300048927 Ga0496124_0124820 Ga0496124_0124820_845_1648 267
653 3300048927 Ga0496124_0144746 Ga0496124_0144746_474_1277 267
654 3300048927 Ga0496124_0296875 Ga0496124_0296875_104_907 267
655 3300048928 Ga0496125_0001701 Ga0496125_0001701_4690_5493 267
656 3300048928 Ga0496125_0002867 Ga0496125_0002867_7214_8017 267
657 3300048928 Ga0496125_0023671 Ga0496125_0023671_3503_4306 267
658 3300048928 Ga0496125_0113828 Ga0496125_0113828_221_1024 267
659 3300048928 Ga0496125_0213023 Ga0496125_0213023_309_1112 267
660 3300048929 Ga0496126_0000065 Ga0496126_0000065_215530_216333 267
661 3300048929 Ga0496126_0101915 Ga0496126_0101915_1423_2226 267
662 3300048929 Ga0496126_0198129 Ga0496126_0198129_149_952 267
663 3300049580 Ga0501046_0000110 Ga0501046_0000110_5709_6512 267
664 3300049581 Ga0501047_0000143 Ga0501047_0000143_6081_6884 267
665 3300049582 Ga0501048_0000601 Ga0501048_0000601_19154_19957 267
666 3300049759 Ga0501262_002539 Ga0501262_002539_766_1569 267
667 3300049822 Ga0501035_0147525 Ga0501035_0147525_1193_2008 267
668 3300049822 Ga0501035_0487444 Ga0501035_0487444_17_820 267
669 3300049823 Ga0501044_0000185 Ga0501044_0000185_63628_64443 267
670 3300049824 Ga0501045_0008311 Ga0501045_0008311_5835_6638 267
671 3300050489 nmdc:mga03683_35960_c1 nmdc:mga03683_35960_c1_729_1541 267
672 3300050489 nmdc:mga03683_3773_c1 nmdc:mga03683_3773_c1_2593_3396 267
673 3300050489 nmdc:mga03683_8851_c1 nmdc:mga03683_8851_c1_2569_3381 267
674 3300050490 nmdc:mga03n38_57457_c1 nmdc:mga03n38_57457_c1_194_1006 267
675 3300050490 nmdc:mga03n38_9973_c1 nmdc:mga03n38_9973_c1_1791_2594 267
676 3300050491 nmdc:mga00v17_103478_c1 nmdc:mga00v17_103478_c1_612_1424 267
677 3300050492 nmdc:mga0yw44_100333_c1 nmdc:mga0yw44_100333_c1_822_1625 267
678 3300050492 nmdc:mga0yw44_220168_c1 nmdc:mga0yw44_220168_c1_146_961 267
679 3300050493 nmdc:mga0k408_152164_c1 nmdc:mga0k408_152164_c1_352_1158 267
680 3300050493 nmdc:mga0k408_245729_c1 nmdc:mga0k408_245729_c1_44_847 267
681 3300050493 nmdc:mga0k408_42363_c1 nmdc:mga0k408_42363_c1_602_1405 267
682 3300050493 nmdc:mga0k408_603_c1 nmdc:mga0k408_603_c1_2611_3423 267
683 3300050493 nmdc:mga0k408_739_c1 nmdc:mga0k408_739_c1_1584_2387 267
684 3300050493 nmdc:mga0k408_9492_c1 nmdc:mga0k408_9492_c1_1355_2167 267
685 3300050494 nmdc:mga06z11_110524_c1 nmdc:mga06z11_110524_c1_237_1049 267
686 3300050494 nmdc:mga06z11_12360_c1 nmdc:mga06z11_12360_c1_482_1294 267
687 3300050494 nmdc:mga06z11_16246_c1 nmdc:mga06z11_16246_c1_2230_3045 267
688 3300050494 nmdc:mga06z11_27112_c1 nmdc:mga06z11_27112_c1_561_1373 267
689 3300050496 nmdc:mga07m45_11742_c1 nmdc:mga07m45_11742_c1_1764_2567 267
690 3300050496 nmdc:mga07m45_123932_c1 nmdc:mga07m45_123932_c1_181_993 267
691 3300050496 nmdc:mga07m45_14528_c1 nmdc:mga07m45_14528_c1_2229_3032 267
692 3300050496 nmdc:mga07m45_14555_c1 nmdc:mga07m45_14555_c1_3169_3972 267
693 3300050496 nmdc:mga07m45_2153_c1 nmdc:mga07m45_2153_c1_336_1148 267
694 3300050496 nmdc:mga07m45_24472_c1 nmdc:mga07m45_24472_c1_359_1171 267
695 3300050496 nmdc:mga07m45_482_c1 nmdc:mga07m45_482_c1_6117_6920 267
696 3300050496 nmdc:mga07m45_49154_c1 nmdc:mga07m45_49154_c1_570_1373 267
697 3300050496 nmdc:mga07m45_655_c2 nmdc:mga07m45_655_c2_2087_2899 267
698 3300050496 nmdc:mga07m45_9697_c1 nmdc:mga07m45_9697_c1_302_1114 267
699 3300053093 Ga0500651_0028268 Ga0500651_0028268_737_1540 267
700 3300053117 Ga0500593_008854 Ga0500593_008854_3080_3883 267
701 3300053118 Ga0500594_0003653 Ga0500594_0003653_2360_3163 267
702 3300053121 Ga0500607_009331 Ga0500607_009331_3511_4314 267
703 3300053122 Ga0500608_013476 Ga0500608_013476_738_1541 267
704 3300053130 Ga0500642_0001951 Ga0500642_0001951_1078_1884 267
705 3300053134 Ga0500658_0002586 Ga0500658_0002586_1052_1864 267
706 3300053136 Ga0500559_0000195 Ga0500559_0000195_25286_26089 267
707 3300053141 Ga0500574_007516 Ga0500574_007516_471_1274 267
708 3300053156 Ga0500622_0007666 Ga0500622_0007666_665_1468 267
709 3300053156 Ga0500622_0035467 Ga0500622_0035467_384_1187 267
710 3300053158 Ga0500627_0005089 Ga0500627_0005089_3140_3943 267
711 3300053177 Ga0500636_0051722 Ga0500636_0051722_229_1032 267

Structural Annotation

Top 5 Hits

ID Description Score Start End
2eb6-assembly1.cif.gz_A crystal structure of hpcg complexed with mg ion 0.9855 1 267
2eb6-assembly1.cif.gz_D-2 crystal structure of hpcg complexed with mg ion 0.9855 1 267
2eb6-assembly1.cif.gz_D-2 crystal structure of hpcg complexed with mg ion 0.9819 1 267
2eb5-assembly1.cif.gz_E-2 crystal structure of hpcg complexed with oxalate 0.9798 1 267
2eb5-assembly1.cif.gz_B-2 crystal structure of hpcg complexed with oxalate 0.9779 1 267
ID Description Score Start End Superfamily
af_I6XHH5_1_260_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9664 1 266 3.90.850.10
2eb4C00 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9659 1 267 3.90.850.10
af_I6XHH5_1_260_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9627 1 266 3.90.850.10
2eb4C00 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9623 1 267 3.90.850.10
5d2kB00 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9612 1 267 3.90.850.10
ID Description Score Start End GO Terms
AF-A0A447U5C0-F1-model_v4 2-oxo-hepta-3-ene-1,7-dioic acid hydratase (EC 4.2.-.-, EC 4.2.1.80) 0.9975 183 267 GO:0005737
GO:0008684
AF-A0A727S3R6-F1-model_v4 2-oxo-hepta-3-ene-1,7-dioic acid hydratase 0.9964 177 267 GO:0005737
GO:0008684
AF-A0A7W7EBG9-F1-model_v4 deleted 0.9961 1 267
AF-A0A2C9AK24-F1-model_v4 deleted 0.9959 1 267
AF-A0A1N6LNE5-F1-model_v4 deleted 0.9958 1 267

Feature Viewer

pLDDT pTM Quality
95.46 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map