F476769
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 711 | 373 | 662 | 267 |
Family's Representative Sequence
| Representative Sequence | 3300006946|Ga0079104_1000008|Ga0079104_1000008180 |
| Length | 277 |
| Sequence | MFSQELLTQLAQELDRSEKTRVQVEHFSKRFPGMTVEDGYRVSREWVRLQIAAGRKVIGHKIGLTSRAMQISSQIDEPDYGTLLDSMLYRCTPGQVLDIPAAHFIAPRVEVELAFVLKAPLRGPGLPGGKEITLQDVLDATDHVTPAIEIIDARIEQFDRHTKAMRKVYDTISDNAANAGIVVGAGQAVPGVLDLPWCGAILRCNGVVEETGLAAGVQGHPAIGVAWLANKLSPWGEALEAGQTVLAGSFTRPVAARAGDLFDADYGPLGRLQFRFV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 2 | 2519103095 | Burkholderia sp. KJ006 | Isolate | Nodule |
| 3 | 2582581311 | Burkholderia sp. WP42 | Isolate | Rhizosphere |
| 4 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 5 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 6 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 7 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 8 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 9 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 10 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 11 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 12 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 13 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 14 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 15 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 16 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 17 | 2816332256 | Burkholderia vietnamiensis MSMB608WGS | Isolate | Unclassified |
| 18 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 19 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 20 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 21 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 22 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 23 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 24 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 25 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 26 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 27 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 28 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 29 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 30 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 31 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 32 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 33 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 34 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 35 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 36 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 37 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 38 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 39 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 40 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 41 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 42 | 2932422444 | Comamonas sp. 4034 | Isolate | Rhizosphere |
| 43 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 44 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 45 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 46 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 47 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 48 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 49 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 50 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 51 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 52 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 53 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 54 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 55 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 56 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 57 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 58 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 59 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 60 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 61 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 62 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 63 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 64 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 65 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 70 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 71 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 78 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 85 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 86 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 88 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 90 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 91 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 92 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 93 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 94 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 95 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 96 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 97 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 98 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 99 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 100 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 101 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 103 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 104 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 105 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 106 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 107 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 108 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 109 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 111 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 112 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 113 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 114 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 116 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 117 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 118 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 131 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 142 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 145 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 146 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 147 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 149 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 154 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 156 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 157 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 159 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 161 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 164 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 167 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 222 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 224 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 228 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 229 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 230 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 231 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 232 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 233 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 234 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 235 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 236 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 237 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 238 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 239 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 240 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 241 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 242 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 243 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 244 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 245 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 246 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 247 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 248 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 249 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 250 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 251 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 252 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 253 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 254 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 255 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 256 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 257 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 258 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 259 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 260 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 261 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 262 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 263 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 264 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 265 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 266 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 267 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 268 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 269 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 270 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 271 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 272 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 273 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 274 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 275 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 276 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 277 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 278 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 279 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 280 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 281 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 282 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 283 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 284 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 285 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 318 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 319 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 320 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 321 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 322 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 323 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 324 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 325 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 326 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 327 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 328 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 329 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 330 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 331 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 332 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 333 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 334 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 335 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 336 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 337 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 338 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 339 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 345 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 347 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 351 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 352 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 353 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 354 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 355 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 356 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 357 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 358 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 359 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 360 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 361 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 362 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 363 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 364 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 365 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 366 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 367 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 368 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 369 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 370 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 371 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 372 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
| 373 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.11 |
| Metatranscriptomes | 0 |
| Isolates | 6.89 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 23.63 |
| Nodule | 1.13 |
| Rhizoplane | 2.67 |
| Rhizosphere | 60.48 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.1 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25150J39212_1001772 | 3300002774 | Bacteria | 5748 |
| 2 | JGI25150J39212_1014412 | 3300002774 | Bacteria | 1344 |
| 3 | JGI25151J46595_10012355 | 3300003187 | Bacteria | 3889 |
| 4 | JGI25153J46596_10018590 | 3300003215 | Bacteria | 2694 |
| 5 | JGI25160J50197_1013974 | 3300003354 | Bacteria | 2708 |
| 6 | JGI25161J50226_1004864 | 3300003374 | Bacteria | 2736 |
| 7 | JGI25161J50226_1009372 | 3300003374 | Bacteria | 1401 |
| 8 | Ga0055527_1006839 | 3300003760 | Bacteria | 1415 |
| 9 | Ga0055535_1000260 | 3300003761 | Bacteria | 55578 |
| 10 | Ga0055542_1000013 | 3300003762 | Bacteria | 387560 |
| 11 | Ga0055529_1002592 | 3300003763 | Bacteria | 3378 |
| 12 | Ga0055526_1014267 | 3300003771 | Bacteria | 3282 |
| 13 | Ga0055526_1017494 | 3300003771 | Bacteria | 2733 |
| 14 | Ga0055537_1000922 | 3300003773 | Bacteria | 13775 |
| 15 | Ga0055524_1015825 | 3300003775 | Bacteria | 2733 |
| 16 | Ga0055524_1016512 | 3300003775 | Bacteria | 2644 |
| 17 | Ga0055534_1000138 | 3300003784 | Bacteria | 54891 |
| 18 | Ga0055528_1003358 | 3300003790 | Bacteria | 8086 |
| 19 | Ga0055530_10029344 | 3300003791 | Bacteria | 1471 |
| 20 | Ga0055540_1002855 | 3300003792 | Bacteria | 8790 |
| 21 | Ga0055540_1003737 | 3300003792 | Bacteria | 7194 |
| 22 | Ga0055540_1003745 | 3300003792 | Bacteria | 7187 |
| 23 | Ga0055531_10000248 | 3300003794 | Bacteria | 58150 |
| 24 | Ga0055531_10058180 | 3300003794 | Bacteria | 963 |
| 25 | Ga0055543_1002039 | 3300004625 | Bacteria | 7094 |
| 26 | Ga0055543_1004369 | 3300004625 | Bacteria | 3874 |
| 27 | Ga0065165_1007017 | 3300005262 | Bacteria | 5679 |
| 28 | Ga0065165_1036092 | 3300005262 | Bacteria | 1511 |
| 29 | Ga0065714_10095103 | 3300005288 | Bacteria | 1790 |
| 30 | Ga0070658_10060456 | 3300005327 | Bacteria | 3086 |
| 31 | Ga0070658_10240717 | 3300005327 | Bacteria | 1534 |
| 32 | Ga0070676_10294542 | 3300005328 | Bacteria | 1098 |
| 33 | Ga0070670_100116518 | 3300005331 | Bacteria | 2303 |
| 34 | Ga0070670_100366897 | 3300005331 | Bacteria | 1267 |
| 35 | Ga0070677_10004569 | 3300005333 | Bacteria | 4524 |
| 36 | Ga0070677_10026341 | 3300005333 | Bacteria | 2179 |
| 37 | Ga0070677_10041514 | 3300005333 | Bacteria | 1817 |
| 38 | Ga0068869_100027667 | 3300005334 | Bacteria | 3956 |
| 39 | Ga0068868_100058993 | 3300005338 | Bacteria | 3034 |
| 40 | Ga0070660_100006337 | 3300005339 | Bacteria | 8197 |
| 41 | Ga0070668_100174073 | 3300005347 | Bacteria | 1754 |
| 42 | Ga0070669_100042109 | 3300005353 | Bacteria | 3323 |
| 43 | Ga0070675_100003640 | 3300005354 | Bacteria | 11721 |
| 44 | Ga0070675_100396320 | 3300005354 | Bacteria | 1231 |
| 45 | Ga0070671_100003362 | 3300005355 | Bacteria | 12479 |
| 46 | Ga0070671_100094857 | 3300005355 | Bacteria | 2501 |
| 47 | Ga0070673_100013143 | 3300005364 | Bacteria | 5715 |
| 48 | Ga0070673_100148408 | 3300005364 | Bacteria | 1984 |
| 49 | Ga0070673_100630742 | 3300005364 | Bacteria | 980 |
| 50 | Ga0070688_100072960 | 3300005365 | Bacteria | 2201 |
| 51 | Ga0070667_100018875 | 3300005367 | Bacteria | 5717 |
| 52 | Ga0070667_100375375 | 3300005367 | Bacteria | 1291 |
| 53 | Ga0070714_100014672 | 3300005435 | Bacteria | 6295 |
| 54 | Ga0070713_100015395 | 3300005436 | Bacteria | 5715 |
| 55 | Ga0070700_100135469 | 3300005441 | Bacteria | 1667 |
| 56 | Ga0070678_100003291 | 3300005456 | Bacteria | 8984 |
| 57 | Ga0070678_100014948 | 3300005456 | Bacteria | 4916 |
| 58 | Ga0070678_100031946 | 3300005456 | Bacteria | 3638 |
| 59 | Ga0070662_100489586 | 3300005457 | Bacteria | 1025 |
| 60 | Ga0070679_100010359 | 3300005530 | Bacteria | 8842 |
| 61 | Ga0070679_100209585 | 3300005530 | Bacteria | 1913 |
| 62 | Ga0068853_100137681 | 3300005539 | Bacteria | 2190 |
| 63 | Ga0070672_100021540 | 3300005543 | Bacteria | 4719 |
| 64 | Ga0070672_100147814 | 3300005543 | Bacteria | 1942 |
| 65 | Ga0070686_100134465 | 3300005544 | Bacteria | 1714 |
| 66 | Ga0070665_100062004 | 3300005548 | Bacteria | 3749 |
| 67 | Ga0070665_100501927 | 3300005548 | Bacteria | 1224 |
| 68 | Ga0068855_100042747 | 3300005563 | Bacteria | 5369 |
| 69 | Ga0068857_100030061 | 3300005577 | Bacteria | 4793 |
| 70 | Ga0068857_100187432 | 3300005577 | Bacteria | 1884 |
| 71 | Ga0068854_100180519 | 3300005578 | Bacteria | 1649 |
| 72 | Ga0068856_100103102 | 3300005614 | Bacteria | 2847 |
| 73 | Ga0068859_100013199 | 3300005617 | Bacteria | 8294 |
| 74 | Ga0068859_100037016 | 3300005617 | Bacteria | 4898 |
| 75 | Ga0068859_100318716 | 3300005617 | Bacteria | 1649 |
| 76 | Ga0068864_100002240 | 3300005618 | Bacteria | 15980 |
| 77 | Ga0068864_100074998 | 3300005618 | Bacteria | 2952 |
| 78 | Ga0068861_100016474 | 3300005719 | Bacteria | 5231 |
| 79 | Ga0068851_10004053 | 3300005834 | Bacteria | 6577 |
| 80 | Ga0068863_100005528 | 3300005841 | Bacteria | 12426 |
| 81 | Ga0068863_100044781 | 3300005841 | Bacteria | 4199 |
| 82 | Ga0068858_100003274 | 3300005842 | Bacteria | 16136 |
| 83 | Ga0068858_100004778 | 3300005842 | Bacteria | 13269 |
| 84 | Ga0068858_100047756 | 3300005842 | Bacteria | 3968 |
| 85 | Ga0068860_100000371 | 3300005843 | Bacteria | 59118 |
| 86 | Ga0068860_100001058 | 3300005843 | Bacteria | 30353 |
| 87 | Ga0068860_100323975 | 3300005843 | Bacteria | 1513 |
| 88 | Ga0068862_100031775 | 3300005844 | Bacteria | 4459 |
| 89 | Ga0068862_100102662 | 3300005844 | Bacteria | 2503 |
| 90 | Ga0068862_100106247 | 3300005844 | Bacteria | 2461 |
| 91 | Ga0070717_10063928 | 3300006028 | Bacteria | 3055 |
| 92 | Ga0075365_10046394 | 3300006038 | Bacteria | 2853 |
| 93 | Ga0075365_10053524 | 3300006038 | Bacteria | 2674 |
| 94 | Ga0075365_10056202 | 3300006038 | Bacteria | 2616 |
| 95 | Ga0075365_10083672 | 3300006038 | Bacteria | 2164 |
| 96 | Ga0075365_10128873 | 3300006038 | Bacteria | 1750 |
| 97 | Ga0075363_100033381 | 3300006048 | Bacteria | 2679 |
| 98 | Ga0075363_100039475 | 3300006048 | Bacteria | 2485 |
| 99 | Ga0075363_100089811 | 3300006048 | Bacteria | 1690 |
| 100 | Ga0075363_100134968 | 3300006048 | Bacteria | 1386 |
| 101 | Ga0075364_10030718 | 3300006051 | Bacteria | 3449 |
| 102 | Ga0075364_10117244 | 3300006051 | Bacteria | 1780 |
| 103 | Ga0075362_10002917 | 3300006177 | Bacteria | 5861 |
| 104 | Ga0075362_10006043 | 3300006177 | Bacteria | 4482 |
| 105 | Ga0075362_10022445 | 3300006177 | Bacteria | 2659 |
| 106 | Ga0075362_10022701 | 3300006177 | Bacteria | 2646 |
| 107 | Ga0075362_10025590 | 3300006177 | Bacteria | 2514 |
| 108 | Ga0075362_10188392 | 3300006177 | Bacteria | 1001 |
| 109 | Ga0075367_10156135 | 3300006178 | Bacteria | 1418 |
| 110 | Ga0075367_10181554 | 3300006178 | Bacteria | 1312 |
| 111 | Ga0075369_10112772 | 3300006186 | Bacteria | 1226 |
| 112 | Ga0075366_10001720 | 3300006195 | Bacteria | 11004 |
| 113 | Ga0075366_10002197 | 3300006195 | Bacteria | 9957 |
| 114 | Ga0075366_10015615 | 3300006195 | Bacteria | 4357 |
| 115 | Ga0075366_10054941 | 3300006195 | Bacteria | 2365 |
| 116 | Ga0075366_10066711 | 3300006195 | Bacteria | 2141 |
| 117 | Ga0075366_10114721 | 3300006195 | Bacteria | 1622 |
| 118 | Ga0075366_10182753 | 3300006195 | Bacteria | 1274 |
| 119 | Ga0097621_100009715 | 3300006237 | Bacteria | 6999 |
| 120 | Ga0097621_100040702 | 3300006237 | Bacteria | 3738 |
| 121 | Ga0097621_100294537 | 3300006237 | Bacteria | 1432 |
| 122 | Ga0097621_100506586 | 3300006237 | Bacteria | 1094 |
| 123 | Ga0097621_100707771 | 3300006237 | Bacteria | 928 |
| 124 | Ga0075370_10000534 | 3300006353 | Bacteria | 14576 |
| 125 | Ga0075370_10010367 | 3300006353 | Bacteria | 4871 |
| 126 | Ga0075370_10010499 | 3300006353 | Bacteria | 4842 |
| 127 | Ga0075370_10013279 | 3300006353 | Bacteria | 4373 |
| 128 | Ga0075370_10014006 | 3300006353 | Bacteria | 4270 |
| 129 | Ga0075370_10014626 | 3300006353 | Bacteria | 4190 |
| 130 | Ga0075370_10030994 | 3300006353 | Bacteria | 2984 |
| 131 | Ga0075370_10032676 | 3300006353 | Bacteria | 2910 |
| 132 | Ga0075370_10059761 | 3300006353 | Bacteria | 2170 |
| 133 | Ga0075370_10072475 | 3300006353 | Bacteria | 1972 |
| 134 | Ga0068871_100024386 | 3300006358 | Bacteria | 4690 |
| 135 | Ga0068871_100743921 | 3300006358 | Bacteria | 901 |
| 136 | Ga0068865_100245885 | 3300006881 | Bacteria | 1410 |
| 137 | Ga0068865_100272018 | 3300006881 | Bacteria | 1345 |
| 138 | Ga0075436_100029938 | 3300006914 | Bacteria | 3745 |
| 139 | Ga0097620_100013199 | 3300006931 | Bacteria | 8294 |
| 140 | Ga0097620_100037016 | 3300006931 | Bacteria | 4898 |
| 141 | Ga0097620_100318712 | 3300006931 | Bacteria | 1649 |
| 142 | Ga0079104_1000008 | 3300006946 | Bacteria | 371223 |
| 143 | Ga0099826_10018923 | 3300006948 | Bacteria | 5186 |
| 144 | Ga0075435_100004686 | 3300007076 | Bacteria | 9430 |
| 145 | Ga0105244_10001247 | 3300009036 | Bacteria | 20853 |
| 146 | Ga0105244_10010868 | 3300009036 | Bacteria | 5495 |
| 147 | Ga0105250_10000043 | 3300009092 | Bacteria | 129336 |
| 148 | Ga0105240_10003831 | 3300009093 | Bacteria | 23258 |
| 149 | Ga0105240_10054320 | 3300009093 | Bacteria | 5020 |
| 150 | Ga0105245_10046840 | 3300009098 | Bacteria | 3864 |
| 151 | Ga0105245_10603297 | 3300009098 | Bacteria | 1124 |
| 152 | Ga0105247_10008264 | 3300009101 | Bacteria | 6352 |
| 153 | Ga0105243_10001568 | 3300009148 | Bacteria | 19974 |
| 154 | Ga0105243_10002163 | 3300009148 | Bacteria | 16598 |
| 155 | Ga0105243_10004514 | 3300009148 | Bacteria | 11003 |
| 156 | Ga0105243_10048919 | 3300009148 | Bacteria | 3334 |
| 157 | Ga0105243_10072505 | 3300009148 | Bacteria | 2788 |
| 158 | Ga0105241_10495594 | 3300009174 | Bacteria | 1088 |
| 159 | Ga0105242_10100850 | 3300009176 | Bacteria | 2446 |
| 160 | Ga0105242_10162328 | 3300009176 | Bacteria | 1957 |
| 161 | Ga0105248_10026007 | 3300009177 | Bacteria | 6510 |
| 162 | Ga0105248_10195703 | 3300009177 | Bacteria | 2278 |
| 163 | Ga0105237_10083745 | 3300009545 | Bacteria | 3180 |
| 164 | Ga0105237_10342139 | 3300009545 | Bacteria | 1500 |
| 165 | Ga0105238_10056308 | 3300009551 | Bacteria | 3945 |
| 166 | Ga0105249_10078699 | 3300009553 | Bacteria | 3059 |
| 167 | Ga0099796_10002453 | 3300010159 | Bacteria | 4067 |
| 168 | Ga0105239_10143210 | 3300010375 | Bacteria | 2665 |
| 169 | Ga0105239_10198599 | 3300010375 | Bacteria | 2247 |
| 170 | Ga0105239_10444889 | 3300010375 | Bacteria | 1470 |
| 171 | Ga0105239_10943188 | 3300010375 | Bacteria | 991 |
| 172 | Ga0105246_10635010 | 3300011119 | Bacteria | 927 |
| 173 | Ga0157370_10124733 | 3300013104 | Bacteria | 2404 |
| 174 | Ga0157369_10026781 | 3300013105 | Bacteria | 6394 |
| 175 | Ga0157374_10537236 | 3300013296 | Bacteria | 1176 |
| 176 | Ga0157378_10015128 | 3300013297 | Bacteria | 6755 |
| 177 | Ga0157378_10092181 | 3300013297 | Bacteria | 2756 |
| 178 | Ga0157378_10127355 | 3300013297 | Bacteria | 2354 |
| 179 | Ga0163162_10003522 | 3300013306 | Bacteria | 14976 |
| 180 | Ga0163162_10268555 | 3300013306 | Bacteria | 1837 |
| 181 | Ga0157372_10062587 | 3300013307 | Bacteria | 4170 |
| 182 | Ga0157375_10017779 | 3300013308 | Bacteria | 6429 |
| 183 | Ga0157375_10020971 | 3300013308 | Bacteria | 5981 |
| 184 | Ga0157375_10095185 | 3300013308 | Bacteria | 3048 |
| 185 | Ga0157375_11051467 | 3300013308 | Bacteria | 952 |
| 186 | Ga0163163_10064045 | 3300014325 | Bacteria | 3648 |
| 187 | Ga0163163_10100384 | 3300014325 | Bacteria | 2916 |
| 188 | Ga0163163_10135649 | 3300014325 | Bacteria | 2502 |
| 189 | Ga0163163_10154346 | 3300014325 | Bacteria | 2340 |
| 190 | Ga0163163_10402479 | 3300014325 | Bacteria | 1427 |
| 191 | Ga0163163_10665290 | 3300014325 | Bacteria | 1105 |
| 192 | Ga0182008_10004684 | 3300014497 | Bacteria | 7943 |
| 193 | Ga0182008_10012898 | 3300014497 | Bacteria | 4400 |
| 194 | Ga0182008_10020966 | 3300014497 | Bacteria | 3361 |
| 195 | Ga0157379_10019351 | 3300014968 | Bacteria | 6013 |
| 196 | Ga0157379_10267110 | 3300014968 | Bacteria | 1555 |
| 197 | Ga0157376_10144267 | 3300014969 | Bacteria | 2140 |
| 198 | Ga0182006_1009529 | 3300015261 | Bacteria | 4349 |
| 199 | Ga0182007_10000359 | 3300015262 | Bacteria | 28779 |
| 200 | Ga0182007_10095711 | 3300015262 | Bacteria | 980 |
| 201 | Ga0183362_10004 | 3300015683 | Bacteria | 569303 |
| 202 | Ga0163161_10000842 | 3300017792 | Bacteria | 23934 |
| 203 | Ga0163161_10001977 | 3300017792 | Bacteria | 14877 |
| 204 | Ga0213872_10008739 | 3300021361 | Bacteria | 4890 |
| 205 | Ga0209436_103311 | 3300025208 | Bacteria | 4343 |
| 206 | Ga0209672_100958 | 3300025228 | Bacteria | 12844 |
| 207 | Ga0209147_100771 | 3300025229 | Bacteria | 15623 |
| 208 | Ga0209258_100020 | 3300025242 | Bacteria | 565241 |
| 209 | Ga0209258_110342 | 3300025242 | Bacteria | 1215 |
| 210 | Ga0207425_1000286 | 3300025245 | Bacteria | 36973 |
| 211 | Ga0207425_1008461 | 3300025245 | Bacteria | 2629 |
| 212 | Ga0209148_1000031 | 3300025254 | Bacteria | 564601 |
| 213 | Ga0209129_1000406 | 3300025258 | Bacteria | 33954 |
| 214 | Ga0209565_1000078 | 3300025263 | Bacteria | 160838 |
| 215 | Ga0209565_1000181 | 3300025263 | Bacteria | 77793 |
| 216 | Ga0209565_1003024 | 3300025263 | Bacteria | 5683 |
| 217 | Ga0209565_1015625 | 3300025263 | Bacteria | 1707 |
| 218 | Ga0209455_1001046 | 3300025272 | Bacteria | 13728 |
| 219 | Ga0209673_1000442 | 3300025273 | Bacteria | 71413 |
| 220 | Ga0209673_1001199 | 3300025273 | Bacteria | 27809 |
| 221 | Ga0209673_1001899 | 3300025273 | Bacteria | 16769 |
| 222 | Ga0209673_1003029 | 3300025273 | Bacteria | 10414 |
| 223 | Ga0209130_1000443 | 3300025284 | Bacteria | 43777 |
| 224 | Ga0209130_1000673 | 3300025284 | Bacteria | 30982 |
| 225 | Ga0209675_1000055 | 3300025291 | Bacteria | 193129 |
| 226 | Ga0209675_1000339 | 3300025291 | Bacteria | 40950 |
| 227 | Ga0209675_1001290 | 3300025291 | Bacteria | 14889 |
| 228 | Ga0209675_1042746 | 3300025291 | Bacteria | 980 |
| 229 | Ga0209676_1000040 | 3300025292 | Bacteria | 438184 |
| 230 | Ga0209676_1000312 | 3300025292 | Bacteria | 95234 |
| 231 | Ga0209676_1039785 | 3300025292 | Bacteria | 1331 |
| 232 | Ga0209025_1000242 | 3300025294 | Bacteria | 128169 |
| 233 | Ga0209025_1000512 | 3300025294 | Bacteria | 74071 |
| 234 | Ga0209025_1001359 | 3300025294 | Bacteria | 32831 |
| 235 | Ga0209025_1001384 | 3300025294 | Bacteria | 32381 |
| 236 | Ga0209025_1023497 | 3300025294 | Bacteria | 3219 |
| 237 | Ga0209564_1000157 | 3300025295 | Bacteria | 164758 |
| 238 | Ga0209564_1000806 | 3300025295 | Bacteria | 42875 |
| 239 | Ga0209758_1000042 | 3300025297 | Bacteria | 407145 |
| 240 | Ga0209758_1036340 | 3300025297 | Bacteria | 1924 |
| 241 | Ga0209050_1000021 | 3300025298 | Bacteria | 574406 |
| 242 | Ga0209050_1012191 | 3300025298 | Bacteria | 3973 |
| 243 | Ga0209256_1000056 | 3300025299 | Bacteria | 283044 |
| 244 | Ga0209256_1000124 | 3300025299 | Bacteria | 165390 |
| 245 | Ga0207426_1000055 | 3300025302 | Bacteria | 374450 |
| 246 | Ga0207426_1000079 | 3300025302 | Bacteria | 314709 |
| 247 | Ga0209051_1000111 | 3300025303 | Bacteria | 153024 |
| 248 | Ga0209051_1000124 | 3300025303 | Bacteria | 142998 |
| 249 | Ga0209051_1000423 | 3300025303 | Bacteria | 58174 |
| 250 | Ga0209051_1000436 | 3300025303 | Bacteria | 56547 |
| 251 | Ga0209051_1001224 | 3300025303 | Bacteria | 23078 |
| 252 | Ga0209257_1000015 | 3300025304 | Bacteria | 908141 |
| 253 | Ga0209257_1000043 | 3300025304 | Bacteria | 512127 |
| 254 | Ga0209257_1000215 | 3300025304 | Bacteria | 136521 |
| 255 | Ga0209257_1006849 | 3300025304 | Bacteria | 7159 |
| 256 | Ga0207656_10004630 | 3300025321 | Bacteria | 4820 |
| 257 | Ga0207696_1000424 | 3300025711 | Bacteria | 38612 |
| 258 | Ga0207655_1001321 | 3300025728 | Bacteria | 23412 |
| 259 | Ga0207682_10015042 | 3300025893 | Bacteria | 3013 |
| 260 | Ga0207682_10020389 | 3300025893 | Bacteria | 2603 |
| 261 | Ga0207692_10065557 | 3300025898 | Bacteria | 1895 |
| 262 | Ga0207710_10010003 | 3300025900 | Bacteria | 3989 |
| 263 | Ga0207645_10131775 | 3300025907 | Bacteria | 1627 |
| 264 | Ga0207645_10208326 | 3300025907 | Bacteria | 1287 |
| 265 | Ga0207705_10233260 | 3300025909 | Bacteria | 1400 |
| 266 | Ga0207695_10082278 | 3300025913 | Bacteria | 3256 |
| 267 | Ga0207695_10089472 | 3300025913 | Bacteria | 3096 |
| 268 | Ga0207695_10122651 | 3300025913 | Bacteria | 2565 |
| 269 | Ga0207695_10257041 | 3300025913 | Bacteria | 1645 |
| 270 | Ga0207671_10030696 | 3300025914 | Bacteria | 4006 |
| 271 | Ga0207671_10137806 | 3300025914 | Bacteria | 1878 |
| 272 | Ga0207671_10270064 | 3300025914 | Bacteria | 1340 |
| 273 | Ga0207671_10307381 | 3300025914 | Bacteria | 1253 |
| 274 | Ga0207663_10134044 | 3300025916 | Bacteria | 1716 |
| 275 | Ga0207660_10027724 | 3300025917 | Bacteria | 3869 |
| 276 | Ga0207660_10295052 | 3300025917 | Bacteria | 1290 |
| 277 | Ga0207662_10175611 | 3300025918 | Bacteria | 1376 |
| 278 | Ga0207657_10008951 | 3300025919 | Bacteria | 10117 |
| 279 | Ga0207652_10032584 | 3300025921 | Bacteria | 4383 |
| 280 | Ga0207652_10036216 | 3300025921 | Bacteria | 4172 |
| 281 | Ga0207652_10228919 | 3300025921 | Bacteria | 1675 |
| 282 | Ga0207681_10060993 | 3300025923 | Bacteria | 2591 |
| 283 | Ga0207694_10089135 | 3300025924 | Bacteria | 2433 |
| 284 | Ga0207650_10150408 | 3300025925 | Bacteria | 1837 |
| 285 | Ga0207650_10254853 | 3300025925 | Bacteria | 1422 |
| 286 | Ga0207659_10072560 | 3300025926 | Bacteria | 2517 |
| 287 | Ga0207659_10146746 | 3300025926 | Bacteria | 1838 |
| 288 | Ga0207687_10127542 | 3300025927 | Bacteria | 1913 |
| 289 | Ga0207700_10066934 | 3300025928 | Bacteria | 2747 |
| 290 | Ga0207664_10003449 | 3300025929 | Bacteria | 10541 |
| 291 | Ga0207644_10002626 | 3300025931 | Bacteria | 11570 |
| 292 | Ga0207644_10025739 | 3300025931 | Bacteria | 4048 |
| 293 | Ga0207644_10091115 | 3300025931 | Bacteria | 2273 |
| 294 | Ga0207690_10097368 | 3300025932 | Bacteria | 2093 |
| 295 | Ga0207706_10038355 | 3300025933 | Bacteria | 4250 |
| 296 | Ga0207706_10065370 | 3300025933 | Bacteria | 3203 |
| 297 | Ga0207706_10149905 | 3300025933 | Bacteria | 2051 |
| 298 | Ga0207706_10321957 | 3300025933 | Bacteria | 1346 |
| 299 | Ga0207686_10061983 | 3300025934 | Bacteria | 2373 |
| 300 | Ga0207686_10143380 | 3300025934 | Bacteria | 1654 |
| 301 | Ga0207709_10000070 | 3300025935 | Bacteria | 183020 |
| 302 | Ga0207709_10000394 | 3300025935 | Bacteria | 43194 |
| 303 | Ga0207709_10002808 | 3300025935 | Bacteria | 10713 |
| 304 | Ga0207709_10015819 | 3300025935 | Bacteria | 4188 |
| 305 | Ga0207709_10039627 | 3300025935 | Bacteria | 2815 |
| 306 | Ga0207704_10099597 | 3300025938 | Bacteria | 1934 |
| 307 | Ga0207704_10133902 | 3300025938 | Bacteria | 1722 |
| 308 | Ga0207691_10018059 | 3300025940 | Bacteria | 6679 |
| 309 | Ga0207691_10035583 | 3300025940 | Bacteria | 4620 |
| 310 | Ga0207691_10105069 | 3300025940 | Bacteria | 2516 |
| 311 | Ga0207691_10239222 | 3300025940 | Bacteria | 1570 |
| 312 | Ga0207711_10015375 | 3300025941 | Bacteria | 6351 |
| 313 | Ga0207711_10121057 | 3300025941 | Bacteria | 2336 |
| 314 | Ga0207711_10434700 | 3300025941 | Bacteria | 1221 |
| 315 | Ga0207689_10054741 | 3300025942 | Bacteria | 3285 |
| 316 | Ga0207689_10309493 | 3300025942 | Bacteria | 1310 |
| 317 | Ga0207679_10604520 | 3300025945 | Bacteria | 988 |
| 318 | Ga0207667_10044598 | 3300025949 | Bacteria | 4698 |
| 319 | Ga0207667_10086845 | 3300025949 | Bacteria | 3236 |
| 320 | Ga0207651_10055471 | 3300025960 | Bacteria | 2722 |
| 321 | Ga0207651_10058227 | 3300025960 | Bacteria | 2669 |
| 322 | Ga0207651_10231222 | 3300025960 | Bacteria | 1501 |
| 323 | Ga0207712_10049088 | 3300025961 | Bacteria | 2939 |
| 324 | Ga0207668_10453067 | 3300025972 | Bacteria | 1095 |
| 325 | Ga0207640_10080320 | 3300025981 | Bacteria | 2226 |
| 326 | Ga0207640_10108229 | 3300025981 | Bacteria | 1964 |
| 327 | Ga0207658_10053035 | 3300025986 | Bacteria | 2994 |
| 328 | Ga0207658_10057826 | 3300025986 | Bacteria | 2883 |
| 329 | Ga0207658_10236337 | 3300025986 | Bacteria | 1545 |
| 330 | Ga0207658_10254487 | 3300025986 | Bacteria | 1494 |
| 331 | Ga0207677_10071828 | 3300026023 | Bacteria | 2444 |
| 332 | Ga0207677_10487572 | 3300026023 | Bacteria | 1063 |
| 333 | Ga0207703_10001680 | 3300026035 | Bacteria | 19905 |
| 334 | Ga0207703_10147259 | 3300026035 | Bacteria | 2049 |
| 335 | Ga0207639_10104394 | 3300026041 | Bacteria | 2298 |
| 336 | Ga0207639_10141873 | 3300026041 | Bacteria | 2002 |
| 337 | Ga0207678_10028486 | 3300026067 | Bacteria | 4877 |
| 338 | Ga0207678_10087406 | 3300026067 | Bacteria | 2664 |
| 339 | Ga0207678_10764593 | 3300026067 | Bacteria | 852 |
| 340 | Ga0207708_10007039 | 3300026075 | Bacteria | 8311 |
| 341 | Ga0207702_10034475 | 3300026078 | Bacteria | 4232 |
| 342 | Ga0207641_10000273 | 3300026088 | Bacteria | 65757 |
| 343 | Ga0207641_10122257 | 3300026088 | Bacteria | 2325 |
| 344 | Ga0207641_10267316 | 3300026088 | Bacteria | 1603 |
| 345 | Ga0207641_10735513 | 3300026088 | Bacteria | 973 |
| 346 | Ga0207648_10001832 | 3300026089 | Bacteria | 23254 |
| 347 | Ga0207648_10047113 | 3300026089 | Bacteria | 3779 |
| 348 | Ga0207648_10230215 | 3300026089 | Bacteria | 1648 |
| 349 | Ga0207676_10013465 | 3300026095 | Bacteria | 5875 |
| 350 | Ga0207674_10021133 | 3300026116 | Bacteria | 7016 |
| 351 | Ga0207674_10024162 | 3300026116 | Bacteria | 6497 |
| 352 | Ga0207675_100027120 | 3300026118 | Bacteria | 5334 |
| 353 | Ga0207675_100092269 | 3300026118 | Bacteria | 2848 |
| 354 | Ga0207683_10020420 | 3300026121 | Bacteria | 5666 |
| 355 | Ga0207683_10087069 | 3300026121 | Bacteria | 2778 |
| 356 | Ga0207683_10250904 | 3300026121 | Bacteria | 1615 |
| 357 | Ga0207698_10081158 | 3300026142 | Bacteria | 2616 |
| 358 | Ga0209281_1000029 | 3300027111 | Bacteria | 431495 |
| 359 | Ga0209970_1002551 | 3300027614 | Bacteria | 3086 |
| 360 | Ga0209282_1004597 | 3300027666 | Bacteria | 8342 |
| 361 | Ga0268266_10129803 | 3300028379 | Bacteria | 2253 |
| 362 | Ga0268265_10085953 | 3300028380 | Bacteria | 2498 |
| 363 | Ga0268265_10156685 | 3300028380 | Bacteria | 1928 |
| 364 | Ga0268265_10187619 | 3300028380 | Bacteria | 1782 |
| 365 | Ga0268264_10000151 | 3300028381 | Bacteria | 158241 |
| 366 | Ga0268264_10010515 | 3300028381 | Bacteria | 7650 |
| 367 | Ga0307517_10176598 | 3300028786 | Bacteria | 1389 |
| 368 | Ga0307515_10000101 | 3300028794 | Bacteria | 199593 |
| 369 | Ga0307515_10000322 | 3300028794 | Bacteria | 118563 |
| 370 | Ga0307515_10000877 | 3300028794 | Bacteria | 69170 |
| 371 | Ga0307515_10003504 | 3300028794 | Bacteria | 32990 |
| 372 | Ga0307515_10087893 | 3300028794 | Bacteria | 3937 |
| 373 | Ga0307515_10132267 | 3300028794 | Bacteria | 2738 |
| 374 | Ga0307515_10275249 | 3300028794 | Bacteria | 1398 |
| 375 | Ga0307515_10452152 | 3300028794 | Bacteria | 900 |
| 376 | Ga0265338_10085451 | 3300028800 | Bacteria | 2630 |
| 377 | Ga0314311_1058476 | 3300030733 | Bacteria | 3123 |
| 378 | Ga0265330_10041876 | 3300031235 | Bacteria | 2030 |
| 379 | Ga0265332_10002085 | 3300031238 | Bacteria | 10412 |
| 380 | Ga0265329_10012668 | 3300031242 | Bacteria | 3023 |
| 381 | Ga0265327_10007110 | 3300031251 | Bacteria | 8739 |
| 382 | Ga0307513_10000013 | 3300031456 | Bacteria | 325682 |
| 383 | Ga0307513_10004142 | 3300031456 | Bacteria | 19422 |
| 384 | Ga0307513_10005935 | 3300031456 | Bacteria | 16027 |
| 385 | Ga0307513_10031821 | 3300031456 | Bacteria | 5964 |
| 386 | Ga0307513_10064112 | 3300031456 | Bacteria | 3874 |
| 387 | Ga0307513_10182249 | 3300031456 | Bacteria | 1962 |
| 388 | Ga0307509_10000215 | 3300031507 | Bacteria | 92190 |
| 389 | Ga0307509_10006676 | 3300031507 | Bacteria | 15395 |
| 390 | Ga0307509_10143968 | 3300031507 | Bacteria | 2313 |
| 391 | Ga0307408_100024281 | 3300031548 | Bacteria | 4137 |
| 392 | Ga0307408_100091766 | 3300031548 | Bacteria | 2294 |
| 393 | Ga0307408_100093617 | 3300031548 | Bacteria | 2273 |
| 394 | Ga0307408_100237893 | 3300031548 | Bacteria | 1495 |
| 395 | Ga0307408_100264336 | 3300031548 | Bacteria | 1425 |
| 396 | Ga0307408_100486377 | 3300031548 | Bacteria | 1078 |
| 397 | Ga0307508_10000053 | 3300031616 | Bacteria | 128020 |
| 398 | Ga0307514_10002392 | 3300031649 | Bacteria | 19627 |
| 399 | Ga0307514_10003568 | 3300031649 | Bacteria | 14825 |
| 400 | Ga0307516_10001573 | 3300031730 | Bacteria | 31413 |
| 401 | Ga0307516_10108158 | 3300031730 | Bacteria | 2588 |
| 402 | Ga0307516_10124000 | 3300031730 | Bacteria | 2370 |
| 403 | Ga0307405_10007767 | 3300031731 | Bacteria | 5394 |
| 404 | Ga0307405_10058878 | 3300031731 | Bacteria | 2419 |
| 405 | Ga0307405_10165947 | 3300031731 | Bacteria | 1569 |
| 406 | Ga0307413_10242857 | 3300031824 | Bacteria | 1331 |
| 407 | Ga0307406_10000240 | 3300031901 | Bacteria | 33234 |
| 408 | Ga0307406_10213167 | 3300031901 | Bacteria | 1430 |
| 409 | Ga0307407_10049413 | 3300031903 | Bacteria | 2400 |
| 410 | Ga0307412_10017679 | 3300031911 | Bacteria | 4270 |
| 411 | Ga0307412_10020962 | 3300031911 | Bacteria | 3986 |
| 412 | Ga0307412_10115617 | 3300031911 | Bacteria | 1923 |
| 413 | Ga0307412_10116804 | 3300031911 | Bacteria | 1914 |
| 414 | Ga0307412_10368280 | 3300031911 | Bacteria | 1159 |
| 415 | Ga0307412_10507000 | 3300031911 | Bacteria | 1006 |
| 416 | Ga0307412_10595964 | 3300031911 | Bacteria | 935 |
| 417 | Ga0307409_100009343 | 3300031995 | Bacteria | 6018 |
| 418 | Ga0307416_100006086 | 3300032002 | Bacteria | 7513 |
| 419 | Ga0307416_100137674 | 3300032002 | Bacteria | 2212 |
| 420 | Ga0307415_100002654 | 3300032126 | Bacteria | 8929 |
| 421 | Ga0307510_10000003 | 3300033180 | Bacteria | 756654 |
| 422 | Ga0307510_10000364 | 3300033180 | Bacteria | 42850 |
| 423 | Ga0307510_10049353 | 3300033180 | Bacteria | 4477 |
| 424 | Ga0307510_10268342 | 3300033180 | Bacteria | 1184 |
| 425 | Ga0307510_10338194 | 3300033180 | Bacteria | 958 |
| 426 | Ga0307510_10360550 | 3300033180 | Bacteria | 902 |
| 427 | Ga0373939_0059475 | 3300035114 | Bacteria | 1212 |
| 428 | Ga0395899_0000035 | 3300037312 | Bacteria | 295584 |
| 429 | Ga0395899_0008988 | 3300037312 | Bacteria | 7684 |
| 430 | Ga0395899_0019677 | 3300037312 | Bacteria | 5125 |
| 431 | Ga0395899_0042074 | 3300037312 | Bacteria | 3412 |
| 432 | Ga0395900_0000113 | 3300037418 | Bacteria | 139979 |
| 433 | Ga0395900_0086403 | 3300037418 | Bacteria | 3223 |
| 434 | Ga0395900_0086644 | 3300037418 | Bacteria | 3218 |
| 435 | Ga0395900_0107784 | 3300037418 | Bacteria | 2862 |
| 436 | Ga0395900_0270456 | 3300037418 | Bacteria | 1694 |
| 437 | Ga0395900_0628467 | 3300037418 | Bacteria | 1012 |
| 438 | Ga0395900_0724060 | 3300037418 | Bacteria | 927 |
| 439 | Ga0395898_0000444 | 3300037466 | Bacteria | 85520 |
| 440 | Ga0395898_0021418 | 3300037466 | Bacteria | 6555 |
| 441 | Ga0395898_0042288 | 3300037466 | Bacteria | 4497 |
| 442 | Ga0395898_0705931 | 3300037466 | Bacteria | 950 |
| 443 | Ga0395905_0000078 | 3300037471 | Bacteria | 161593 |
| 444 | Ga0395905_0001615 | 3300037471 | Bacteria | 26797 |
| 445 | Ga0395905_0009266 | 3300037471 | Bacteria | 9631 |
| 446 | Ga0395905_0018804 | 3300037471 | Bacteria | 6553 |
| 447 | Ga0395905_0029165 | 3300037471 | Bacteria | 5200 |
| 448 | Ga0395905_0034096 | 3300037471 | Bacteria | 4779 |
| 449 | Ga0395905_0063884 | 3300037471 | Bacteria | 3445 |
| 450 | Ga0395905_0107340 | 3300037471 | Bacteria | 2621 |
| 451 | Ga0395905_0188662 | 3300037471 | Bacteria | 1934 |
| 452 | Ga0395905_0204766 | 3300037471 | Bacteria | 1849 |
| 453 | Ga0395901_0000718 | 3300038443 | Bacteria | 37719 |
| 454 | Ga0395901_0001521 | 3300038443 | Bacteria | 24065 |
| 455 | Ga0395901_0038349 | 3300038443 | Bacteria | 4956 |
| 456 | Ga0395901_0049667 | 3300038443 | Bacteria | 4359 |
| 457 | Ga0395901_0073846 | 3300038443 | Bacteria | 3557 |
| 458 | Ga0395901_0088797 | 3300038443 | Bacteria | 3233 |
| 459 | Ga0395901_0089244 | 3300038443 | Bacteria | 3226 |
| 460 | Ga0395901_0172767 | 3300038443 | Bacteria | 2267 |
| 461 | Ga0395901_0179658 | 3300038443 | Bacteria | 2219 |
| 462 | Ga0436360_0505175 | 3300039438 | Bacteria | 2718 |
| 463 | Ga0436361_0730633 | 3300039447 | Bacteria | 71783 |
| 464 | Ga0436363_1689440 | 3300039450 | Bacteria | 11337 |
| 465 | Ga0439436_0001899 | 3300041404 | Bacteria | 6176 |
| 466 | Ga0439436_0009738 | 3300041404 | Bacteria | 2942 |
| 467 | Ga0439436_0010303 | 3300041404 | Bacteria | 2853 |
| 468 | Ga0439439_0025930 | 3300041406 | Bacteria | 1476 |
| 469 | Ga0439466_0008532 | 3300041411 | Bacteria | 3863 |
| 470 | Ga0439466_0017261 | 3300041411 | Bacteria | 2602 |
| 471 | Ga0439466_0021720 | 3300041411 | Bacteria | 2271 |
| 472 | Ga0439433_0025447 | 3300041999 | Bacteria | 1337 |
| 473 | Ga0439442_004262 | 3300042002 | Bacteria | 2837 |
| 474 | Ga0439445_0010765 | 3300042004 | Bacteria | 2170 |
| 475 | Ga0439432_018413 | 3300042006 | Bacteria | 2334 |
| 476 | Ga0439449_0002122 | 3300042007 | Bacteria | 7783 |
| 477 | Ga0439449_0007892 | 3300042007 | Bacteria | 4040 |
| 478 | Ga0439449_0041254 | 3300042007 | Bacteria | 1715 |
| 479 | Ga0439449_0055149 | 3300042007 | Bacteria | 1468 |
| 480 | Ga0439452_005666 | 3300042010 | Bacteria | 3998 |
| 481 | Ga0439457_014209 | 3300042014 | Bacteria | 1783 |
| 482 | Ga0439462_0006248 | 3300042015 | Bacteria | 2957 |
| 483 | Ga0450923_002449 | 3300042125 | Bacteria | 2664 |
| 484 | Ga0450898_002238 | 3300042134 | Bacteria | 2690 |
| 485 | Ga0450899_003957 | 3300042135 | Bacteria | 1589 |
| 486 | Ga0439434_0009312 | 3300042435 | Bacteria | 2885 |
| 487 | Ga0439434_0011581 | 3300042435 | Bacteria | 2609 |
| 488 | Ga0450918_000332 | 3300042531 | Bacteria | 10578 |
| 489 | Ga0450893_0003467 | 3300042532 | Bacteria | 2484 |
| 490 | Ga0450893_0013478 | 3300042532 | Bacteria | 1364 |
| 491 | Ga0466969_0009080 | 3300044656 | Bacteria | 5270 |
| 492 | Ga0466969_0017951 | 3300044656 | Bacteria | 3690 |
| 493 | Ga0466969_0041865 | 3300044656 | Bacteria | 2289 |
| 494 | Ga0466965_0089505 | 3300044683 | Bacteria | 1564 |
| 495 | Ga0466966_0027942 | 3300044684 | Bacteria | 3677 |
| 496 | Ga0466966_0035699 | 3300044684 | Bacteria | 3210 |
| 497 | Ga0466961_0029680 | 3300044693 | Bacteria | 3513 |
| 498 | Ga0466961_0057680 | 3300044693 | Bacteria | 2471 |
| 499 | Ga0453684_0143830 | 3300044712 | Bacteria | 2843 |
| 500 | Ga0466959_0002388 | 3300045049 | Bacteria | 11970 |
| 501 | Ga0466959_0004321 | 3300045049 | Bacteria | 9488 |
| 502 | Ga0466959_0146256 | 3300045049 | Bacteria | 1667 |
| 503 | Ga0451576_0004945 | 3300045051 | Bacteria | 16966 |
| 504 | Ga0451576_0216083 | 3300045051 | Bacteria | 2002 |
| 505 | Ga0466958_0000765 | 3300045836 | Bacteria | 14132 |
| 506 | Ga0466958_0009225 | 3300045836 | Bacteria | 5491 |
| 507 | Ga0466967_0132668 | 3300045976 | Bacteria | 2314 |
| 508 | Ga0495592_0000173 | 3300046454 | Bacteria | 57219 |
| 509 | Ga0495629_0426395 | 3300046459 | Bacteria | 900 |
| 510 | Ga0495638_0153364 | 3300046460 | Bacteria | 1335 |
| 511 | Ga0495639_0022234 | 3300046475 | Bacteria | 2781 |
| 512 | Ga0495606_0006456 | 3300046507 | Bacteria | 10804 |
| 513 | Ga0495606_0082228 | 3300046507 | Bacteria | 2000 |
| 514 | Ga0495616_0020994 | 3300046513 | Bacteria | 3545 |
| 515 | Ga0495631_0002066 | 3300046518 | Bacteria | 11696 |
| 516 | Ga0495632_0003077 | 3300046519 | Bacteria | 12111 |
| 517 | Ga0495652_0054302 | 3300046529 | Bacteria | 3412 |
| 518 | Ga0495665_0060761 | 3300046531 | Bacteria | 1995 |
| 519 | Ga0495621_0040965 | 3300046539 | Bacteria | 1625 |
| 520 | Ga0495621_0080220 | 3300046539 | Bacteria | 1216 |
| 521 | Ga0495597_0024569 | 3300046542 | Bacteria | 2780 |
| 522 | Ga0495645_0008045 | 3300046543 | Bacteria | 7344 |
| 523 | Ga0495645_0063703 | 3300046543 | Bacteria | 2669 |
| 524 | Ga0495656_0053999 | 3300046615 | Bacteria | 1728 |
| 525 | Ga0495668_0020719 | 3300046616 | Bacteria | 3779 |
| 526 | Ga0495611_0130508 | 3300046648 | Bacteria | 1172 |
| 527 | Ga0495625_0000206 | 3300046660 | Bacteria | 94070 |
| 528 | Ga0495625_0028232 | 3300046660 | Bacteria | 4211 |
| 529 | Ga0495661_0001271 | 3300046665 | Bacteria | 21687 |
| 530 | Ga0495661_0082960 | 3300046665 | Bacteria | 1844 |
| 531 | Ga0495588_0034670 | 3300046674 | Bacteria | 2554 |
| 532 | Ga0495599_0098473 | 3300046678 | Bacteria | 1823 |
| 533 | Ga0495646_0003204 | 3300046680 | Bacteria | 10167 |
| 534 | Ga0495646_0122555 | 3300046680 | Bacteria | 1470 |
| 535 | Ga0495624_0027527 | 3300046690 | Bacteria | 3722 |
| 536 | Ga0495624_0051090 | 3300046690 | Bacteria | 2617 |
| 537 | Ga0495670_0022247 | 3300046691 | Bacteria | 3130 |
| 538 | Ga0495671_0020716 | 3300046692 | Bacteria | 3463 |
| 539 | Ga0495671_0196104 | 3300046692 | Bacteria | 980 |
| 540 | Ga0495649_0004289 | 3300046694 | Bacteria | 9359 |
| 541 | Ga0495649_0007271 | 3300046694 | Bacteria | 6775 |
| 542 | Ga0495660_0166002 | 3300046810 | Bacteria | 1079 |
| 543 | Ga0495683_0005760 | 3300047323 | Bacteria | 6827 |
| 544 | Ga0495687_001027 | 3300047443 | Bacteria | 27802 |
| 545 | Ga0495687_029024 | 3300047443 | Bacteria | 2565 |
| 546 | Ga0495687_081862 | 3300047443 | Bacteria | 1262 |
| 547 | Ga0495677_0011497 | 3300047445 | Bacteria | 3238 |
| 548 | Ga0495593_0012279 | 3300047673 | Bacteria | 4895 |
| 549 | Ga0495593_0250632 | 3300047673 | Bacteria | 886 |
| 550 | Ga0495614_0016572 | 3300048089 | Bacteria | 3206 |
| 551 | Ga0495626_0048618 | 3300048091 | Bacteria | 1967 |
| 552 | Ga0496100_0027575 | 3300048903 | Bacteria | 3494 |
| 553 | Ga0496100_0085758 | 3300048903 | Bacteria | 2138 |
| 554 | Ga0496101_0001978 | 3300048904 | Bacteria | 12427 |
| 555 | Ga0496102_0002447 | 3300048905 | Bacteria | 15843 |
| 556 | Ga0496102_0036739 | 3300048905 | Bacteria | 4415 |
| 557 | Ga0496103_0035714 | 3300048906 | Bacteria | 3043 |
| 558 | Ga0496104_0052112 | 3300048907 | Bacteria | 3864 |
| 559 | Ga0496105_0005298 | 3300048908 | Bacteria | 9775 |
| 560 | Ga0496105_0151897 | 3300048908 | Bacteria | 1903 |
| 561 | Ga0496106_0433091 | 3300048909 | Bacteria | 1057 |
| 562 | Ga0496108_0208093 | 3300048911 | Bacteria | 1698 |
| 563 | Ga0496108_0312914 | 3300048911 | Bacteria | 1368 |
| 564 | Ga0496110_0036920 | 3300048913 | Bacteria | 4245 |
| 565 | Ga0496111_0092371 | 3300048914 | Bacteria | 2218 |
| 566 | Ga0496112_0472561 | 3300048915 | Bacteria | 1191 |
| 567 | Ga0496114_0046200 | 3300048917 | Bacteria | 3618 |
| 568 | Ga0496116_0023452 | 3300048919 | Bacteria | 4594 |
| 569 | Ga0496116_0043537 | 3300048919 | Bacteria | 3057 |
| 570 | Ga0496117_0000186 | 3300048920 | Bacteria | 127231 |
| 571 | Ga0496117_0047932 | 3300048920 | Bacteria | 3058 |
| 572 | Ga0496117_0073591 | 3300048920 | Bacteria | 2279 |
| 573 | Ga0496118_0000003 | 3300048921 | Bacteria | 773148 |
| 574 | Ga0496118_0018486 | 3300048921 | Bacteria | 6287 |
| 575 | Ga0496118_0021335 | 3300048921 | Bacteria | 5705 |
| 576 | Ga0496118_0146734 | 3300048921 | Bacteria | 1484 |
| 577 | Ga0496119_0001832 | 3300048922 | Bacteria | 24618 |
| 578 | Ga0496119_0008384 | 3300048922 | Bacteria | 9088 |
| 579 | Ga0496119_0061827 | 3300048922 | Bacteria | 2234 |
| 580 | Ga0496120_0000232 | 3300048923 | Bacteria | 95655 |
| 581 | Ga0496120_0049700 | 3300048923 | Bacteria | 2405 |
| 582 | Ga0496121_0035691 | 3300048924 | Bacteria | 4448 |
| 583 | Ga0496121_0103970 | 3300048924 | Bacteria | 2183 |
| 584 | Ga0496121_0110605 | 3300048924 | Bacteria | 2096 |
| 585 | Ga0496123_0051703 | 3300048926 | Bacteria | 2734 |
| 586 | Ga0496123_0185617 | 3300048926 | Bacteria | 1081 |
| 587 | Ga0496124_0124820 | 3300048927 | Bacteria | 2052 |
| 588 | Ga0496124_0144746 | 3300048927 | Bacteria | 1871 |
| 589 | Ga0496124_0296875 | 3300048927 | Bacteria | 1169 |
| 590 | Ga0496125_0001701 | 3300048928 | Bacteria | 30700 |
| 591 | Ga0496125_0002867 | 3300048928 | Bacteria | 21703 |
| 592 | Ga0496125_0023671 | 3300048928 | Bacteria | 5663 |
| 593 | Ga0496125_0113828 | 3300048928 | Bacteria | 1950 |
| 594 | Ga0496125_0213023 | 3300048928 | Bacteria | 1253 |
| 595 | Ga0496126_0000065 | 3300048929 | Bacteria | 252549 |
| 596 | Ga0496126_0101915 | 3300048929 | Bacteria | 2510 |
| 597 | Ga0496126_0198129 | 3300048929 | Bacteria | 1697 |
| 598 | Ga0501043_0147495 | 3300049579 | Bacteria | 1842 |
| 599 | Ga0501046_0000110 | 3300049580 | Bacteria | 86752 |
| 600 | Ga0501047_0000143 | 3300049581 | Bacteria | 87124 |
| 601 | Ga0501047_0230017 | 3300049581 | Bacteria | 1708 |
| 602 | Ga0501048_0000601 | 3300049582 | Bacteria | 25551 |
| 603 | Ga0501073_0083697 | 3300049589 | Bacteria | 2220 |
| 604 | Ga0501216_032999 | 3300049660 | Bacteria | 964 |
| 605 | Ga0501080_0228782 | 3300049742 | Bacteria | 1700 |
| 606 | Ga0501262_002539 | 3300049759 | Bacteria | 2061 |
| 607 | Ga0501035_0147525 | 3300049822 | Bacteria | 2042 |
| 608 | Ga0501035_0487444 | 3300049822 | Bacteria | 1016 |
| 609 | Ga0501044_0000185 | 3300049823 | Bacteria | 77663 |
| 610 | Ga0501044_0129259 | 3300049823 | Bacteria | 2521 |
| 611 | Ga0501045_0008311 | 3300049824 | Bacteria | 7227 |
| 612 | nmdc:mga03683_1374_c1 | 3300050489 | Bacteria | 7229 |
| 613 | nmdc:mga03683_35960_c1 | 3300050489 | Bacteria | 2012 |
| 614 | nmdc:mga03683_3773_c1 | 3300050489 | Bacteria | 4940 |
| 615 | nmdc:mga03683_8851_c1 | 3300050489 | Bacteria | 3557 |
| 616 | nmdc:mga03n38_128975_c1 | 3300050490 | Bacteria | 1251 |
| 617 | nmdc:mga03n38_57457_c1 | 3300050490 | Bacteria | 1759 |
| 618 | nmdc:mga03n38_9973_c1 | 3300050490 | Bacteria | 3476 |
| 619 | nmdc:mga00v17_103478_c1 | 3300050491 | Bacteria | 1799 |
| 620 | nmdc:mga00v17_27560_c1 | 3300050491 | Bacteria | 3318 |
| 621 | nmdc:mga0yw44_100333_c1 | 3300050492 | Bacteria | 1843 |
| 622 | nmdc:mga0yw44_220168_c1 | 3300050492 | Bacteria | 1258 |
| 623 | nmdc:mga0k408_152164_c1 | 3300050493 | Bacteria | 1378 |
| 624 | nmdc:mga0k408_245729_c1 | 3300050493 | Bacteria | 1069 |
| 625 | nmdc:mga0k408_42363_c1 | 3300050493 | Bacteria | 2622 |
| 626 | nmdc:mga0k408_44619_c1 | 3300050493 | Bacteria | 2557 |
| 627 | nmdc:mga0k408_603_c1 | 3300050493 | Bacteria | 19842 |
| 628 | nmdc:mga0k408_739_c1 | 3300050493 | Bacteria | 17894 |
| 629 | nmdc:mga0k408_9492_c1 | 3300050493 | Bacteria | 5247 |
| 630 | nmdc:mga06z11_110524_c1 | 3300050494 | Bacteria | 1521 |
| 631 | nmdc:mga06z11_12360_c1 | 3300050494 | Bacteria | 3712 |
| 632 | nmdc:mga06z11_159057_c1 | 3300050494 | Bacteria | 1290 |
| 633 | nmdc:mga06z11_16246_c1 | 3300050494 | Bacteria | 3347 |
| 634 | nmdc:mga06z11_244047_c1 | 3300050494 | Bacteria | 1056 |
| 635 | nmdc:mga06z11_27112_c1 | 3300050494 | Bacteria | 2736 |
| 636 | nmdc:mga07m45_11742_c1 | 3300050496 | Bacteria | 4609 |
| 637 | nmdc:mga07m45_123932_c1 | 3300050496 | Bacteria | 1494 |
| 638 | nmdc:mga07m45_14528_c1 | 3300050496 | Bacteria | 4197 |
| 639 | nmdc:mga07m45_14555_c1 | 3300050496 | Bacteria | 4194 |
| 640 | nmdc:mga07m45_2153_c1 | 3300050496 | Bacteria | 9172 |
| 641 | nmdc:mga07m45_24472_c1 | 3300050496 | Bacteria | 3308 |
| 642 | nmdc:mga07m45_2793_c2 | 3300050496 | Bacteria | 4500 |
| 643 | nmdc:mga07m45_482_c1 | 3300050496 | Bacteria | 16838 |
| 644 | nmdc:mga07m45_49154_c1 | 3300050496 | Bacteria | 2373 |
| 645 | nmdc:mga07m45_655_c2 | 3300050496 | Bacteria | 9799 |
| 646 | nmdc:mga07m45_82317_c1 | 3300050496 | Bacteria | 1838 |
| 647 | nmdc:mga07m45_9697_c1 | 3300050496 | Bacteria | 5005 |
| 648 | nmdc:mga0sz30_105633_c1 | 3300050516 | Bacteria | 1232 |
| 649 | Ga0500651_0028268 | 3300053093 | Bacteria | 3526 |
| 650 | Ga0500562_002855 | 3300053108 | Bacteria | 4306 |
| 651 | Ga0500593_008854 | 3300053117 | Bacteria | 4153 |
| 652 | Ga0500594_0003653 | 3300053118 | Bacteria | 3391 |
| 653 | Ga0500607_009331 | 3300053121 | Bacteria | 5908 |
| 654 | Ga0500608_013476 | 3300053122 | Bacteria | 3626 |
| 655 | Ga0500642_0001951 | 3300053130 | Bacteria | 5977 |
| 656 | Ga0500658_0002586 | 3300053134 | Bacteria | 6996 |
| 657 | Ga0500559_0000195 | 3300053136 | Bacteria | 48743 |
| 658 | Ga0500574_007516 | 3300053141 | Bacteria | 2266 |
| 659 | Ga0500622_0007666 | 3300053156 | Bacteria | 6103 |
| 660 | Ga0500622_0035467 | 3300053156 | Bacteria | 2610 |
| 661 | Ga0500627_0005089 | 3300053158 | Bacteria | 4318 |
| 662 | Ga0500636_0051722 | 3300053177 | Bacteria | 2415 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037471 | Ga0395905_0204766 | Ga0395905_0204766_1158_1814 | 218 |
| 2 | 3300046539 | Ga0495621_0040965 | Ga0495621_0040965_904_1602 | 232 |
| 3 | 3300042007 | Ga0439449_0041254 | Ga0439449_0041254_965_1705 | 246 |
| 4 | 3300006914 | Ga0075436_100029938 | Ga0075436_1000299384 | 251 |
| 5 | 3300007076 | Ga0075435_100004686 | Ga0075435_1000046861 | 251 |
| 6 | 3300033180 | Ga0307510_10360550 | Ga0307510_103605501 | 253 |
| 7 | iso_pu_bacteria | 2818991446 | 2819600195 | 262 |
| 8 | iso_pu_bacteria | 2513020051 | 2513230854 | 263 |
| 9 | iso_pu_bacteria | 2519103095 | 2519461706 | 263 |
| 10 | iso_pu_bacteria | 2582581311 | 2585293232 | 263 |
| 11 | iso_pu_bacteria | 2599185214 | 2599622475 | 263 |
| 12 | iso_pu_bacteria | 2599185226 | 2599674433 | 263 |
| 13 | iso_pu_bacteria | 2599185227 | 2599680118 | 263 |
| 14 | iso_pu_bacteria | 2599185229 | 2599692134 | 263 |
| 15 | iso_pu_bacteria | 2643221628 | 2644160824 | 263 |
| 16 | iso_pu_bacteria | 2643221658 | 2644326581 | 263 |
| 17 | iso_pu_bacteria | 2643221672 | 2644396930 | 263 |
| 18 | iso_pu_bacteria | 2643221683 | 2644469393 | 263 |
| 19 | iso_pu_bacteria | 2721755523 | 2722880917 | 263 |
| 20 | iso_pu_bacteria | 2738541277 | 2738719275 | 263 |
| 21 | iso_pu_bacteria | 2738541307 | 2738883378 | 263 |
| 22 | iso_pu_bacteria | 2738543019 | 2739282994 | 263 |
| 23 | iso_pu_bacteria | 2816332253 | 2817258579 | 263 |
| 24 | iso_pu_bacteria | 2816332256 | 2817281003 | 263 |
| 25 | iso_pu_bacteria | 2816332286 | 2817453272 | 263 |
| 26 | iso_pu_bacteria | 2818991446 | 2819599176 | 263 |
| 27 | iso_pu_bacteria | 2831265667 | 2831270956 | 263 |
| 28 | iso_pu_bacteria | 2838054893 | 2838059004 | 263 |
| 29 | iso_pu_bacteria | 2839138175 | 2839138277 | 263 |
| 30 | iso_pu_bacteria | 2881101125 | 2881104573 | 263 |
| 31 | iso_pu_bacteria | 2881412998 | 2881414620 | 263 |
| 32 | iso_pu_bacteria | 2885192300 | 2885194684 | 263 |
| 33 | iso_pu_bacteria | 2885198086 | 2885202225 | 263 |
| 34 | iso_pu_bacteria | 2885211737 | 2885215878 | 263 |
| 35 | iso_pu_bacteria | 2894023352 | 2894024992 | 263 |
| 36 | iso_pu_bacteria | 2904449895 | 2904451591 | 263 |
| 37 | iso_pu_bacteria | 2904456579 | 2904461920 | 263 |
| 38 | iso_pu_bacteria | 2904541872 | 2904543255 | 263 |
| 39 | iso_pu_bacteria | 2919462493 | 2919464456 | 263 |
| 40 | iso_pu_bacteria | 2919704043 | 2919708582 | 263 |
| 41 | iso_pu_bacteria | 2928037797 | 2928043535 | 263 |
| 42 | iso_pu_bacteria | 2928044640 | 2928049835 | 263 |
| 43 | iso_pu_bacteria | 2928051484 | 2928054410 | 263 |
| 44 | iso_pu_bacteria | 2928064002 | 2928069996 | 263 |
| 45 | iso_pu_bacteria | 2928070936 | 2928074384 | 263 |
| 46 | iso_pu_bacteria | 2928084124 | 2928086619 | 263 |
| 47 | iso_pu_bacteria | 2929160207 | 2929160487 | 263 |
| 48 | iso_pu_bacteria | 2929520902 | 2929526509 | 263 |
| 49 | iso_pu_bacteria | 2932422444 | 2932423644 | 263 |
| 50 | iso_pu_bacteria | 2939631187 | 2939633875 | 263 |
| 51 | iso_pu_bacteria | 2945945610 | 2945950484 | 263 |
| 52 | iso_pu_bacteria | 8020807995 | 8020810478 | 263 |
| 53 | iso_pu_bacteria | 8040167225 | 8040167680 | 263 |
| 54 | iso_pu_bacteria | 8040173305 | 8040177739 | 263 |
| 55 | 3300005327 | Ga0070658_10060456 | Ga0070658_100604562 | 265 |
| 56 | 3300005339 | Ga0070660_100006337 | Ga0070660_1000063373 | 265 |
| 57 | 3300005563 | Ga0068855_100042747 | Ga0068855_1000427474 | 265 |
| 58 | 3300006038 | Ga0075365_10056202 | Ga0075365_100562023 | 265 |
| 59 | 3300009093 | Ga0105240_10003831 | Ga0105240_100038314 | 265 |
| 60 | 3300025913 | Ga0207695_10089472 | Ga0207695_100894724 | 265 |
| 61 | 3300025919 | Ga0207657_10008951 | Ga0207657_100089518 | 265 |
| 62 | 3300025921 | Ga0207652_10228919 | Ga0207652_102289192 | 265 |
| 63 | 3300025924 | Ga0207694_10089135 | Ga0207694_100891353 | 265 |
| 64 | 3300025949 | Ga0207667_10086845 | Ga0207667_100868454 | 265 |
| 65 | 3300037312 | Ga0395899_0019677 | Ga0395899_0019677_2249_3049 | 265 |
| 66 | 3300003792 | Ga0055540_1003737 | Ga0055540_10037374 | 266 |
| 67 | 3300003794 | Ga0055531_10000248 | Ga0055531_1000024825 | 266 |
| 68 | 3300005327 | Ga0070658_10240717 | Ga0070658_102407173 | 266 |
| 69 | 3300005334 | Ga0068869_100027667 | Ga0068869_1000276671 | 266 |
| 70 | 3300005338 | Ga0068868_100058993 | Ga0068868_1000589931 | 266 |
| 71 | 3300005530 | Ga0070679_100209585 | Ga0070679_1002095852 | 266 |
| 72 | 3300006038 | Ga0075365_10046394 | Ga0075365_100463943 | 266 |
| 73 | 3300006038 | Ga0075365_10083672 | Ga0075365_100836722 | 266 |
| 74 | 3300006048 | Ga0075363_100134968 | Ga0075363_1001349682 | 266 |
| 75 | 3300006051 | Ga0075364_10030718 | Ga0075364_100307182 | 266 |
| 76 | 3300006177 | Ga0075362_10022701 | Ga0075362_100227013 | 266 |
| 77 | 3300006177 | Ga0075362_10188392 | Ga0075362_101883922 | 266 |
| 78 | 3300006178 | Ga0075367_10181554 | Ga0075367_101815542 | 266 |
| 79 | 3300006186 | Ga0075369_10112772 | Ga0075369_101127722 | 266 |
| 80 | 3300006353 | Ga0075370_10013279 | Ga0075370_100132794 | 266 |
| 81 | 3300006353 | Ga0075370_10072475 | Ga0075370_100724753 | 266 |
| 82 | 3300010375 | Ga0105239_10198599 | Ga0105239_101985992 | 266 |
| 83 | 3300013297 | Ga0157378_10092181 | Ga0157378_100921813 | 266 |
| 84 | 3300014325 | Ga0163163_10135649 | Ga0163163_101356493 | 266 |
| 85 | 3300014497 | Ga0182008_10020966 | Ga0182008_100209662 | 266 |
| 86 | 3300015262 | Ga0182007_10095711 | Ga0182007_100957112 | 266 |
| 87 | 3300025303 | Ga0209051_1000124 | Ga0209051_100012458 | 266 |
| 88 | 3300025304 | Ga0209257_1000015 | Ga0209257_100001520 | 266 |
| 89 | 3300025909 | Ga0207705_10233260 | Ga0207705_102332603 | 266 |
| 90 | 3300025917 | Ga0207660_10295052 | Ga0207660_102950522 | 266 |
| 91 | 3300025921 | Ga0207652_10032584 | Ga0207652_100325844 | 266 |
| 92 | 3300025949 | Ga0207667_10044598 | Ga0207667_100445981 | 266 |
| 93 | 3300026023 | Ga0207677_10487572 | Ga0207677_104875722 | 266 |
| 94 | 3300027614 | Ga0209970_1002551 | Ga0209970_10025512 | 266 |
| 95 | 3300031235 | Ga0265330_10041876 | Ga0265330_100418762 | 266 |
| 96 | 3300031238 | Ga0265332_10002085 | Ga0265332_100020852 | 266 |
| 97 | 3300031242 | Ga0265329_10012668 | Ga0265329_100126683 | 266 |
| 98 | 3300031456 | Ga0307513_10000013 | Ga0307513_1000001397 | 266 |
| 99 | 3300031548 | Ga0307408_100091766 | Ga0307408_1000917663 | 266 |
| 100 | 3300031548 | Ga0307408_100237893 | Ga0307408_1002378932 | 266 |
| 101 | 3300031548 | Ga0307408_100486377 | Ga0307408_1004863772 | 266 |
| 102 | 3300031730 | Ga0307516_10001573 | Ga0307516_1000157324 | 266 |
| 103 | 3300031911 | Ga0307412_10020962 | Ga0307412_100209624 | 266 |
| 104 | 3300031911 | Ga0307412_10115617 | Ga0307412_101156172 | 266 |
| 105 | 3300037312 | Ga0395899_0008988 | Ga0395899_0008988_3696_4496 | 266 |
| 106 | 3300037418 | Ga0395900_0086403 | Ga0395900_0086403_1278_2078 | 266 |
| 107 | 3300037418 | Ga0395900_0086644 | Ga0395900_0086644_1312_2115 | 266 |
| 108 | 3300037418 | Ga0395900_0107784 | Ga0395900_0107784_1817_2617 | 266 |
| 109 | 3300037418 | Ga0395900_0270456 | Ga0395900_0270456_458_1261 | 266 |
| 110 | 3300037418 | Ga0395900_0628467 | Ga0395900_0628467_86_886 | 266 |
| 111 | 3300037418 | Ga0395900_0724060 | Ga0395900_0724060_64_864 | 266 |
| 112 | 3300037466 | Ga0395898_0021418 | Ga0395898_0021418_3858_4658 | 266 |
| 113 | 3300037466 | Ga0395898_0042288 | Ga0395898_0042288_280_1083 | 266 |
| 114 | 3300037466 | Ga0395898_0705931 | Ga0395898_0705931_136_936 | 266 |
| 115 | 3300037471 | Ga0395905_0000078 | Ga0395905_0000078_66075_66878 | 266 |
| 116 | 3300037471 | Ga0395905_0001615 | Ga0395905_0001615_15486_16286 | 266 |
| 117 | 3300037471 | Ga0395905_0009266 | Ga0395905_0009266_3661_4464 | 266 |
| 118 | 3300037471 | Ga0395905_0029165 | Ga0395905_0029165_1335_2138 | 266 |
| 119 | 3300037471 | Ga0395905_0034096 | Ga0395905_0034096_2129_2932 | 266 |
| 120 | 3300037471 | Ga0395905_0107340 | Ga0395905_0107340_1273_2073 | 266 |
| 121 | 3300037471 | Ga0395905_0188662 | Ga0395905_0188662_411_1211 | 266 |
| 122 | 3300038443 | Ga0395901_0038349 | Ga0395901_0038349_4059_4862 | 266 |
| 123 | 3300038443 | Ga0395901_0049667 | Ga0395901_0049667_2283_3083 | 266 |
| 124 | 3300038443 | Ga0395901_0073846 | Ga0395901_0073846_565_1365 | 266 |
| 125 | 3300038443 | Ga0395901_0088797 | Ga0395901_0088797_1104_1907 | 266 |
| 126 | 3300038443 | Ga0395901_0089244 | Ga0395901_0089244_31_831 | 266 |
| 127 | 3300038443 | Ga0395901_0172767 | Ga0395901_0172767_261_1064 | 266 |
| 128 | 3300038443 | Ga0395901_0179658 | Ga0395901_0179658_979_1782 | 266 |
| 129 | 3300041406 | Ga0439439_0025930 | Ga0439439_0025930_308_1108 | 266 |
| 130 | 3300042007 | Ga0439449_0002122 | Ga0439449_0002122_4790_5590 | 266 |
| 131 | 3300042007 | Ga0439449_0055149 | Ga0439449_0055149_270_1070 | 266 |
| 132 | 3300042532 | Ga0450893_0003467 | Ga0450893_0003467_1176_1976 | 266 |
| 133 | 3300044656 | Ga0466969_0009080 | Ga0466969_0009080_667_1470 | 266 |
| 134 | 3300044684 | Ga0466966_0035699 | Ga0466966_0035699_1534_2337 | 266 |
| 135 | 3300044693 | Ga0466961_0057680 | Ga0466961_0057680_241_1044 | 266 |
| 136 | 3300045049 | Ga0466959_0002388 | Ga0466959_0002388_4996_5799 | 266 |
| 137 | 3300045976 | Ga0466967_0132668 | Ga0466967_0132668_1311_2114 | 266 |
| 138 | 3300047445 | Ga0495677_0011497 | Ga0495677_0011497_1049_1849 | 266 |
| 139 | 3300048909 | Ga0496106_0433091 | Ga0496106_0433091_54_854 | 266 |
| 140 | 3300048926 | Ga0496123_0185617 | Ga0496123_0185617_147_947 | 266 |
| 141 | 3300049579 | Ga0501043_0147495 | Ga0501043_0147495_126_929 | 266 |
| 142 | 3300049581 | Ga0501047_0230017 | Ga0501047_0230017_716_1519 | 266 |
| 143 | 3300049589 | Ga0501073_0083697 | Ga0501073_0083697_1055_1858 | 266 |
| 144 | 3300049660 | Ga0501216_032999 | Ga0501216_032999_77_877 | 266 |
| 145 | 3300049742 | Ga0501080_0228782 | Ga0501080_0228782_741_1544 | 266 |
| 146 | 3300049823 | Ga0501044_0129259 | Ga0501044_0129259_377_1180 | 266 |
| 147 | 3300050489 | nmdc:mga03683_1374_c1 | nmdc:mga03683_1374_c1_5270_6070 | 266 |
| 148 | 3300050490 | nmdc:mga03n38_128975_c1 | nmdc:mga03n38_128975_c1_432_1232 | 266 |
| 149 | 3300050491 | nmdc:mga00v17_27560_c1 | nmdc:mga00v17_27560_c1_1241_2041 | 266 |
| 150 | 3300050493 | nmdc:mga0k408_44619_c1 | nmdc:mga0k408_44619_c1_1055_1855 | 266 |
| 151 | 3300050494 | nmdc:mga06z11_159057_c1 | nmdc:mga06z11_159057_c1_62_862 | 266 |
| 152 | 3300050494 | nmdc:mga06z11_244047_c1 | nmdc:mga06z11_244047_c1_31_831 | 266 |
| 153 | 3300050496 | nmdc:mga07m45_2793_c2 | nmdc:mga07m45_2793_c2_1694_2494 | 266 |
| 154 | 3300050496 | nmdc:mga07m45_82317_c1 | nmdc:mga07m45_82317_c1_694_1494 | 266 |
| 155 | 3300050516 | nmdc:mga0sz30_105633_c1 | nmdc:mga0sz30_105633_c1_231_1031 | 266 |
| 156 | 3300053108 | Ga0500562_002855 | Ga0500562_002855_975_1781 | 266 |
| 157 | iso_pu_bacteria | 2894023352 | 2894024943 | 266 |
| 158 | 3300002774 | JGI25150J39212_1001772 | JGI25150J39212_10017726 | 267 |
| 159 | 3300002774 | JGI25150J39212_1014412 | JGI25150J39212_10144121 | 267 |
| 160 | 3300003187 | JGI25151J46595_10012355 | JGI25151J46595_100123554 | 267 |
| 161 | 3300003215 | JGI25153J46596_10018590 | JGI25153J46596_100185902 | 267 |
| 162 | 3300003354 | JGI25160J50197_1013974 | JGI25160J50197_10139743 | 267 |
| 163 | 3300003374 | JGI25161J50226_1004864 | JGI25161J50226_10048644 | 267 |
| 164 | 3300003374 | JGI25161J50226_1009372 | JGI25161J50226_10093722 | 267 |
| 165 | 3300003760 | Ga0055527_1006839 | Ga0055527_10068392 | 267 |
| 166 | 3300003761 | Ga0055535_1000260 | Ga0055535_100026036 | 267 |
| 167 | 3300003762 | Ga0055542_1000013 | Ga0055542_1000013230 | 267 |
| 168 | 3300003763 | Ga0055529_1002592 | Ga0055529_10025922 | 267 |
| 169 | 3300003771 | Ga0055526_1014267 | Ga0055526_10142675 | 267 |
| 170 | 3300003771 | Ga0055526_1017494 | Ga0055526_10174942 | 267 |
| 171 | 3300003773 | Ga0055537_1000922 | Ga0055537_10009225 | 267 |
| 172 | 3300003775 | Ga0055524_1015825 | Ga0055524_10158252 | 267 |
| 173 | 3300003775 | Ga0055524_1016512 | Ga0055524_10165124 | 267 |
| 174 | 3300003784 | Ga0055534_1000138 | Ga0055534_100013838 | 267 |
| 175 | 3300003790 | Ga0055528_1003358 | Ga0055528_10033589 | 267 |
| 176 | 3300003791 | Ga0055530_10029344 | Ga0055530_100293442 | 267 |
| 177 | 3300003792 | Ga0055540_1002855 | Ga0055540_10028556 | 267 |
| 178 | 3300003792 | Ga0055540_1003745 | Ga0055540_10037453 | 267 |
| 179 | 3300003794 | Ga0055531_10058180 | Ga0055531_100581801 | 267 |
| 180 | 3300004625 | Ga0055543_1002039 | Ga0055543_10020394 | 267 |
| 181 | 3300004625 | Ga0055543_1004369 | Ga0055543_10043694 | 267 |
| 182 | 3300005262 | Ga0065165_1007017 | Ga0065165_10070174 | 267 |
| 183 | 3300005262 | Ga0065165_1036092 | Ga0065165_10360921 | 267 |
| 184 | 3300005288 | Ga0065714_10095103 | Ga0065714_100951033 | 267 |
| 185 | 3300005328 | Ga0070676_10294542 | Ga0070676_102945421 | 267 |
| 186 | 3300005331 | Ga0070670_100116518 | Ga0070670_1001165182 | 267 |
| 187 | 3300005331 | Ga0070670_100366897 | Ga0070670_1003668971 | 267 |
| 188 | 3300005333 | Ga0070677_10004569 | Ga0070677_100045695 | 267 |
| 189 | 3300005333 | Ga0070677_10026341 | Ga0070677_100263412 | 267 |
| 190 | 3300005333 | Ga0070677_10041514 | Ga0070677_100415142 | 267 |
| 191 | 3300005347 | Ga0070668_100174073 | Ga0070668_1001740733 | 267 |
| 192 | 3300005353 | Ga0070669_100042109 | Ga0070669_1000421092 | 267 |
| 193 | 3300005354 | Ga0070675_100003640 | Ga0070675_1000036405 | 267 |
| 194 | 3300005354 | Ga0070675_100396320 | Ga0070675_1003963202 | 267 |
| 195 | 3300005355 | Ga0070671_100003362 | Ga0070671_1000033626 | 267 |
| 196 | 3300005355 | Ga0070671_100094857 | Ga0070671_1000948571 | 267 |
| 197 | 3300005364 | Ga0070673_100013143 | Ga0070673_1000131434 | 267 |
| 198 | 3300005364 | Ga0070673_100148408 | Ga0070673_1001484082 | 267 |
| 199 | 3300005364 | Ga0070673_100630742 | Ga0070673_1006307421 | 267 |
| 200 | 3300005365 | Ga0070688_100072960 | Ga0070688_1000729603 | 267 |
| 201 | 3300005367 | Ga0070667_100018875 | Ga0070667_1000188753 | 267 |
| 202 | 3300005367 | Ga0070667_100375375 | Ga0070667_1003753752 | 267 |
| 203 | 3300005435 | Ga0070714_100014672 | Ga0070714_1000146725 | 267 |
| 204 | 3300005436 | Ga0070713_100015395 | Ga0070713_1000153953 | 267 |
| 205 | 3300005441 | Ga0070700_100135469 | Ga0070700_1001354692 | 267 |
| 206 | 3300005456 | Ga0070678_100003291 | Ga0070678_1000032916 | 267 |
| 207 | 3300005456 | Ga0070678_100014948 | Ga0070678_1000149483 | 267 |
| 208 | 3300005456 | Ga0070678_100031946 | Ga0070678_1000319463 | 267 |
| 209 | 3300005457 | Ga0070662_100489586 | Ga0070662_1004895861 | 267 |
| 210 | 3300005530 | Ga0070679_100010359 | Ga0070679_1000103593 | 267 |
| 211 | 3300005539 | Ga0068853_100137681 | Ga0068853_1001376813 | 267 |
| 212 | 3300005543 | Ga0070672_100021540 | Ga0070672_1000215405 | 267 |
| 213 | 3300005543 | Ga0070672_100147814 | Ga0070672_1001478142 | 267 |
| 214 | 3300005544 | Ga0070686_100134465 | Ga0070686_1001344652 | 267 |
| 215 | 3300005548 | Ga0070665_100062004 | Ga0070665_1000620042 | 267 |
| 216 | 3300005548 | Ga0070665_100501927 | Ga0070665_1005019272 | 267 |
| 217 | 3300005577 | Ga0068857_100030061 | Ga0068857_1000300616 | 267 |
| 218 | 3300005577 | Ga0068857_100187432 | Ga0068857_1001874322 | 267 |
| 219 | 3300005578 | Ga0068854_100180519 | Ga0068854_1001805192 | 267 |
| 220 | 3300005614 | Ga0068856_100103102 | Ga0068856_1001031023 | 267 |
| 221 | 3300005617 | Ga0068859_100013199 | Ga0068859_1000131996 | 267 |
| 222 | 3300005617 | Ga0068859_100037016 | Ga0068859_1000370165 | 267 |
| 223 | 3300005617 | Ga0068859_100318716 | Ga0068859_1003187162 | 267 |
| 224 | 3300005618 | Ga0068864_100002240 | Ga0068864_10000224015 | 267 |
| 225 | 3300005618 | Ga0068864_100074998 | Ga0068864_1000749983 | 267 |
| 226 | 3300005719 | Ga0068861_100016474 | Ga0068861_1000164744 | 267 |
| 227 | 3300005834 | Ga0068851_10004053 | Ga0068851_100040534 | 267 |
| 228 | 3300005841 | Ga0068863_100005528 | Ga0068863_1000055285 | 267 |
| 229 | 3300005841 | Ga0068863_100044781 | Ga0068863_1000447815 | 267 |
| 230 | 3300005842 | Ga0068858_100003274 | Ga0068858_1000032745 | 267 |
| 231 | 3300005842 | Ga0068858_100004778 | Ga0068858_1000047787 | 267 |
| 232 | 3300005842 | Ga0068858_100047756 | Ga0068858_1000477564 | 267 |
| 233 | 3300005843 | Ga0068860_100000371 | Ga0068860_10000037143 | 267 |
| 234 | 3300005843 | Ga0068860_100001058 | Ga0068860_10000105813 | 267 |
| 235 | 3300005843 | Ga0068860_100323975 | Ga0068860_1003239752 | 267 |
| 236 | 3300005844 | Ga0068862_100031775 | Ga0068862_1000317752 | 267 |
| 237 | 3300005844 | Ga0068862_100102662 | Ga0068862_1001026622 | 267 |
| 238 | 3300005844 | Ga0068862_100106247 | Ga0068862_1001062473 | 267 |
| 239 | 3300006028 | Ga0070717_10063928 | Ga0070717_100639283 | 267 |
| 240 | 3300006038 | Ga0075365_10053524 | Ga0075365_100535242 | 267 |
| 241 | 3300006038 | Ga0075365_10128873 | Ga0075365_101288732 | 267 |
| 242 | 3300006048 | Ga0075363_100033381 | Ga0075363_1000333813 | 267 |
| 243 | 3300006048 | Ga0075363_100039475 | Ga0075363_1000394752 | 267 |
| 244 | 3300006048 | Ga0075363_100089811 | Ga0075363_1000898113 | 267 |
| 245 | 3300006051 | Ga0075364_10117244 | Ga0075364_101172443 | 267 |
| 246 | 3300006177 | Ga0075362_10002917 | Ga0075362_100029176 | 267 |
| 247 | 3300006177 | Ga0075362_10006043 | Ga0075362_100060434 | 267 |
| 248 | 3300006177 | Ga0075362_10022445 | Ga0075362_100224452 | 267 |
| 249 | 3300006177 | Ga0075362_10025590 | Ga0075362_100255902 | 267 |
| 250 | 3300006178 | Ga0075367_10156135 | Ga0075367_101561352 | 267 |
| 251 | 3300006195 | Ga0075366_10001720 | Ga0075366_100017209 | 267 |
| 252 | 3300006195 | Ga0075366_10002197 | Ga0075366_100021974 | 267 |
| 253 | 3300006195 | Ga0075366_10015615 | Ga0075366_100156151 | 267 |
| 254 | 3300006195 | Ga0075366_10054941 | Ga0075366_100549412 | 267 |
| 255 | 3300006195 | Ga0075366_10066711 | Ga0075366_100667113 | 267 |
| 256 | 3300006195 | Ga0075366_10114721 | Ga0075366_101147212 | 267 |
| 257 | 3300006195 | Ga0075366_10182753 | Ga0075366_101827532 | 267 |
| 258 | 3300006237 | Ga0097621_100009715 | Ga0097621_1000097155 | 267 |
| 259 | 3300006237 | Ga0097621_100040702 | Ga0097621_1000407022 | 267 |
| 260 | 3300006237 | Ga0097621_100294537 | Ga0097621_1002945372 | 267 |
| 261 | 3300006237 | Ga0097621_100506586 | Ga0097621_1005065862 | 267 |
| 262 | 3300006237 | Ga0097621_100707771 | Ga0097621_1007077711 | 267 |
| 263 | 3300006353 | Ga0075370_10000534 | Ga0075370_100005348 | 267 |
| 264 | 3300006353 | Ga0075370_10010367 | Ga0075370_100103672 | 267 |
| 265 | 3300006353 | Ga0075370_10010499 | Ga0075370_100104994 | 267 |
| 266 | 3300006353 | Ga0075370_10014006 | Ga0075370_100140063 | 267 |
| 267 | 3300006353 | Ga0075370_10014626 | Ga0075370_100146265 | 267 |
| 268 | 3300006353 | Ga0075370_10030994 | Ga0075370_100309943 | 267 |
| 269 | 3300006353 | Ga0075370_10032676 | Ga0075370_100326761 | 267 |
| 270 | 3300006353 | Ga0075370_10059761 | Ga0075370_100597612 | 267 |
| 271 | 3300006358 | Ga0068871_100024386 | Ga0068871_1000243863 | 267 |
| 272 | 3300006358 | Ga0068871_100743921 | Ga0068871_1007439211 | 267 |
| 273 | 3300006881 | Ga0068865_100245885 | Ga0068865_1002458852 | 267 |
| 274 | 3300006881 | Ga0068865_100272018 | Ga0068865_1002720182 | 267 |
| 275 | 3300006931 | Ga0097620_100013199 | Ga0097620_1000131995 | 267 |
| 276 | 3300006931 | Ga0097620_100037016 | Ga0097620_1000370165 | 267 |
| 277 | 3300006931 | Ga0097620_100318712 | Ga0097620_1003187122 | 267 |
| 278 | 3300006946 | Ga0079104_1000008 | Ga0079104_1000008180 | 267 |
| 279 | 3300006948 | Ga0099826_10018923 | Ga0099826_100189234 | 267 |
| 280 | 3300009036 | Ga0105244_10001247 | Ga0105244_1000124715 | 267 |
| 281 | 3300009036 | Ga0105244_10010868 | Ga0105244_100108685 | 267 |
| 282 | 3300009092 | Ga0105250_10000043 | Ga0105250_1000004358 | 267 |
| 283 | 3300009093 | Ga0105240_10054320 | Ga0105240_100543203 | 267 |
| 284 | 3300009098 | Ga0105245_10046840 | Ga0105245_100468403 | 267 |
| 285 | 3300009098 | Ga0105245_10603297 | Ga0105245_106032972 | 267 |
| 286 | 3300009101 | Ga0105247_10008264 | Ga0105247_100082645 | 267 |
| 287 | 3300009148 | Ga0105243_10001568 | Ga0105243_1000156815 | 267 |
| 288 | 3300009148 | Ga0105243_10002163 | Ga0105243_100021634 | 267 |
| 289 | 3300009148 | Ga0105243_10004514 | Ga0105243_1000451410 | 267 |
| 290 | 3300009148 | Ga0105243_10048919 | Ga0105243_100489194 | 267 |
| 291 | 3300009148 | Ga0105243_10072505 | Ga0105243_100725053 | 267 |
| 292 | 3300009174 | Ga0105241_10495594 | Ga0105241_104955942 | 267 |
| 293 | 3300009176 | Ga0105242_10100850 | Ga0105242_101008503 | 267 |
| 294 | 3300009176 | Ga0105242_10162328 | Ga0105242_101623282 | 267 |
| 295 | 3300009177 | Ga0105248_10026007 | Ga0105248_100260074 | 267 |
| 296 | 3300009177 | Ga0105248_10195703 | Ga0105248_101957033 | 267 |
| 297 | 3300009545 | Ga0105237_10083745 | Ga0105237_100837452 | 267 |
| 298 | 3300009545 | Ga0105237_10342139 | Ga0105237_103421392 | 267 |
| 299 | 3300009551 | Ga0105238_10056308 | Ga0105238_100563083 | 267 |
| 300 | 3300009553 | Ga0105249_10078699 | Ga0105249_100786994 | 267 |
| 301 | 3300010159 | Ga0099796_10002453 | Ga0099796_100024535 | 267 |
| 302 | 3300010375 | Ga0105239_10143210 | Ga0105239_101432103 | 267 |
| 303 | 3300010375 | Ga0105239_10444889 | Ga0105239_104448892 | 267 |
| 304 | 3300010375 | Ga0105239_10943188 | Ga0105239_109431881 | 267 |
| 305 | 3300011119 | Ga0105246_10635010 | Ga0105246_106350101 | 267 |
| 306 | 3300013104 | Ga0157370_10124733 | Ga0157370_101247333 | 267 |
| 307 | 3300013105 | Ga0157369_10026781 | Ga0157369_100267812 | 267 |
| 308 | 3300013296 | Ga0157374_10537236 | Ga0157374_105372361 | 267 |
| 309 | 3300013297 | Ga0157378_10015128 | Ga0157378_100151286 | 267 |
| 310 | 3300013297 | Ga0157378_10127355 | Ga0157378_101273552 | 267 |
| 311 | 3300013306 | Ga0163162_10003522 | Ga0163162_100035229 | 267 |
| 312 | 3300013306 | Ga0163162_10268555 | Ga0163162_102685552 | 267 |
| 313 | 3300013307 | Ga0157372_10062587 | Ga0157372_100625872 | 267 |
| 314 | 3300013308 | Ga0157375_10017779 | Ga0157375_100177792 | 267 |
| 315 | 3300013308 | Ga0157375_10020971 | Ga0157375_100209715 | 267 |
| 316 | 3300013308 | Ga0157375_10095185 | Ga0157375_100951854 | 267 |
| 317 | 3300013308 | Ga0157375_11051467 | Ga0157375_110514671 | 267 |
| 318 | 3300014325 | Ga0163163_10064045 | Ga0163163_100640453 | 267 |
| 319 | 3300014325 | Ga0163163_10100384 | Ga0163163_101003845 | 267 |
| 320 | 3300014325 | Ga0163163_10154346 | Ga0163163_101543462 | 267 |
| 321 | 3300014325 | Ga0163163_10402479 | Ga0163163_104024792 | 267 |
| 322 | 3300014325 | Ga0163163_10665290 | Ga0163163_106652902 | 267 |
| 323 | 3300014497 | Ga0182008_10004684 | Ga0182008_100046847 | 267 |
| 324 | 3300014497 | Ga0182008_10012898 | Ga0182008_100128984 | 267 |
| 325 | 3300014968 | Ga0157379_10019351 | Ga0157379_100193517 | 267 |
| 326 | 3300014968 | Ga0157379_10267110 | Ga0157379_102671102 | 267 |
| 327 | 3300014969 | Ga0157376_10144267 | Ga0157376_101442672 | 267 |
| 328 | 3300015261 | Ga0182006_1009529 | Ga0182006_10095294 | 267 |
| 329 | 3300015262 | Ga0182007_10000359 | Ga0182007_1000035915 | 267 |
| 330 | 3300015683 | Ga0183362_10004 | Ga0183362_10004464 | 267 |
| 331 | 3300017792 | Ga0163161_10000842 | Ga0163161_1000084219 | 267 |
| 332 | 3300017792 | Ga0163161_10001977 | Ga0163161_1000197715 | 267 |
| 333 | 3300021361 | Ga0213872_10008739 | Ga0213872_100087393 | 267 |
| 334 | 3300025208 | Ga0209436_103311 | Ga0209436_1033113 | 267 |
| 335 | 3300025228 | Ga0209672_100958 | Ga0209672_1009584 | 267 |
| 336 | 3300025229 | Ga0209147_100771 | Ga0209147_10077114 | 267 |
| 337 | 3300025242 | Ga0209258_100020 | Ga0209258_100020386 | 267 |
| 338 | 3300025242 | Ga0209258_110342 | Ga0209258_1103422 | 267 |
| 339 | 3300025245 | Ga0207425_1000286 | Ga0207425_10002868 | 267 |
| 340 | 3300025245 | Ga0207425_1008461 | Ga0207425_10084614 | 267 |
| 341 | 3300025254 | Ga0209148_1000031 | Ga0209148_1000031386 | 267 |
| 342 | 3300025258 | Ga0209129_1000406 | Ga0209129_10004065 | 267 |
| 343 | 3300025263 | Ga0209565_1000078 | Ga0209565_100007844 | 267 |
| 344 | 3300025263 | Ga0209565_1000181 | Ga0209565_100018118 | 267 |
| 345 | 3300025263 | Ga0209565_1003024 | Ga0209565_10030241 | 267 |
| 346 | 3300025263 | Ga0209565_1015625 | Ga0209565_10156253 | 267 |
| 347 | 3300025272 | Ga0209455_1001046 | Ga0209455_10010464 | 267 |
| 348 | 3300025273 | Ga0209673_1000442 | Ga0209673_100044218 | 267 |
| 349 | 3300025273 | Ga0209673_1001199 | Ga0209673_10011994 | 267 |
| 350 | 3300025273 | Ga0209673_1001899 | Ga0209673_10018998 | 267 |
| 351 | 3300025273 | Ga0209673_1003029 | Ga0209673_10030292 | 267 |
| 352 | 3300025284 | Ga0209130_1000443 | Ga0209130_100044317 | 267 |
| 353 | 3300025284 | Ga0209130_1000673 | Ga0209130_10006738 | 267 |
| 354 | 3300025291 | Ga0209675_1000055 | Ga0209675_1000055140 | 267 |
| 355 | 3300025291 | Ga0209675_1000339 | Ga0209675_100033920 | 267 |
| 356 | 3300025291 | Ga0209675_1001290 | Ga0209675_100129011 | 267 |
| 357 | 3300025291 | Ga0209675_1042746 | Ga0209675_10427462 | 267 |
| 358 | 3300025292 | Ga0209676_1000040 | Ga0209676_1000040279 | 267 |
| 359 | 3300025292 | Ga0209676_1000312 | Ga0209676_100031220 | 267 |
| 360 | 3300025292 | Ga0209676_1039785 | Ga0209676_10397852 | 267 |
| 361 | 3300025294 | Ga0209025_1000242 | Ga0209025_100024230 | 267 |
| 362 | 3300025294 | Ga0209025_1000512 | Ga0209025_100051236 | 267 |
| 363 | 3300025294 | Ga0209025_1001359 | Ga0209025_100135924 | 267 |
| 364 | 3300025294 | Ga0209025_1001384 | Ga0209025_100138417 | 267 |
| 365 | 3300025294 | Ga0209025_1023497 | Ga0209025_10234973 | 267 |
| 366 | 3300025295 | Ga0209564_1000157 | Ga0209564_100015734 | 267 |
| 367 | 3300025295 | Ga0209564_1000806 | Ga0209564_100080638 | 267 |
| 368 | 3300025297 | Ga0209758_1000042 | Ga0209758_1000042115 | 267 |
| 369 | 3300025297 | Ga0209758_1036340 | Ga0209758_10363403 | 267 |
| 370 | 3300025298 | Ga0209050_1000021 | Ga0209050_1000021114 | 267 |
| 371 | 3300025298 | Ga0209050_1012191 | Ga0209050_10121914 | 267 |
| 372 | 3300025299 | Ga0209256_1000056 | Ga0209256_1000056159 | 267 |
| 373 | 3300025299 | Ga0209256_1000124 | Ga0209256_100012489 | 267 |
| 374 | 3300025302 | Ga0207426_1000055 | Ga0207426_1000055216 | 267 |
| 375 | 3300025302 | Ga0207426_1000079 | Ga0207426_1000079112 | 267 |
| 376 | 3300025303 | Ga0209051_1000111 | Ga0209051_100011120 | 267 |
| 377 | 3300025303 | Ga0209051_1000423 | Ga0209051_100042329 | 267 |
| 378 | 3300025303 | Ga0209051_1000436 | Ga0209051_100043626 | 267 |
| 379 | 3300025303 | Ga0209051_1001224 | Ga0209051_100122420 | 267 |
| 380 | 3300025304 | Ga0209257_1000043 | Ga0209257_1000043109 | 267 |
| 381 | 3300025304 | Ga0209257_1000215 | Ga0209257_1000215103 | 267 |
| 382 | 3300025304 | Ga0209257_1006849 | Ga0209257_10068494 | 267 |
| 383 | 3300025321 | Ga0207656_10004630 | Ga0207656_100046304 | 267 |
| 384 | 3300025711 | Ga0207696_1000424 | Ga0207696_10004243 | 267 |
| 385 | 3300025728 | Ga0207655_1001321 | Ga0207655_10013212 | 267 |
| 386 | 3300025893 | Ga0207682_10015042 | Ga0207682_100150423 | 267 |
| 387 | 3300025893 | Ga0207682_10020389 | Ga0207682_100203892 | 267 |
| 388 | 3300025898 | Ga0207692_10065557 | Ga0207692_100655572 | 267 |
| 389 | 3300025900 | Ga0207710_10010003 | Ga0207710_100100035 | 267 |
| 390 | 3300025907 | Ga0207645_10131775 | Ga0207645_101317752 | 267 |
| 391 | 3300025907 | Ga0207645_10208326 | Ga0207645_102083261 | 267 |
| 392 | 3300025913 | Ga0207695_10082278 | Ga0207695_100822782 | 267 |
| 393 | 3300025913 | Ga0207695_10122651 | Ga0207695_101226513 | 267 |
| 394 | 3300025913 | Ga0207695_10257041 | Ga0207695_102570412 | 267 |
| 395 | 3300025914 | Ga0207671_10030696 | Ga0207671_100306965 | 267 |
| 396 | 3300025914 | Ga0207671_10137806 | Ga0207671_101378063 | 267 |
| 397 | 3300025914 | Ga0207671_10270064 | Ga0207671_102700641 | 267 |
| 398 | 3300025914 | Ga0207671_10307381 | Ga0207671_103073812 | 267 |
| 399 | 3300025916 | Ga0207663_10134044 | Ga0207663_101340441 | 267 |
| 400 | 3300025917 | Ga0207660_10027724 | Ga0207660_100277245 | 267 |
| 401 | 3300025918 | Ga0207662_10175611 | Ga0207662_101756112 | 267 |
| 402 | 3300025921 | Ga0207652_10036216 | Ga0207652_100362165 | 267 |
| 403 | 3300025923 | Ga0207681_10060993 | Ga0207681_100609932 | 267 |
| 404 | 3300025925 | Ga0207650_10150408 | Ga0207650_101504083 | 267 |
| 405 | 3300025925 | Ga0207650_10254853 | Ga0207650_102548532 | 267 |
| 406 | 3300025926 | Ga0207659_10072560 | Ga0207659_100725604 | 267 |
| 407 | 3300025926 | Ga0207659_10146746 | Ga0207659_101467462 | 267 |
| 408 | 3300025927 | Ga0207687_10127542 | Ga0207687_101275422 | 267 |
| 409 | 3300025928 | Ga0207700_10066934 | Ga0207700_100669343 | 267 |
| 410 | 3300025929 | Ga0207664_10003449 | Ga0207664_100034492 | 267 |
| 411 | 3300025931 | Ga0207644_10002626 | Ga0207644_100026265 | 267 |
| 412 | 3300025931 | Ga0207644_10025739 | Ga0207644_100257394 | 267 |
| 413 | 3300025931 | Ga0207644_10091115 | Ga0207644_100911152 | 267 |
| 414 | 3300025932 | Ga0207690_10097368 | Ga0207690_100973683 | 267 |
| 415 | 3300025933 | Ga0207706_10038355 | Ga0207706_100383553 | 267 |
| 416 | 3300025933 | Ga0207706_10065370 | Ga0207706_100653703 | 267 |
| 417 | 3300025933 | Ga0207706_10149905 | Ga0207706_101499053 | 267 |
| 418 | 3300025933 | Ga0207706_10321957 | Ga0207706_103219572 | 267 |
| 419 | 3300025934 | Ga0207686_10061983 | Ga0207686_100619832 | 267 |
| 420 | 3300025934 | Ga0207686_10143380 | Ga0207686_101433803 | 267 |
| 421 | 3300025935 | Ga0207709_10000070 | Ga0207709_1000007016 | 267 |
| 422 | 3300025935 | Ga0207709_10000394 | Ga0207709_1000039439 | 267 |
| 423 | 3300025935 | Ga0207709_10002808 | Ga0207709_100028087 | 267 |
| 424 | 3300025935 | Ga0207709_10015819 | Ga0207709_100158195 | 267 |
| 425 | 3300025935 | Ga0207709_10039627 | Ga0207709_100396273 | 267 |
| 426 | 3300025938 | Ga0207704_10099597 | Ga0207704_100995971 | 267 |
| 427 | 3300025938 | Ga0207704_10133902 | Ga0207704_101339021 | 267 |
| 428 | 3300025940 | Ga0207691_10018059 | Ga0207691_100180595 | 267 |
| 429 | 3300025940 | Ga0207691_10035583 | Ga0207691_100355835 | 267 |
| 430 | 3300025940 | Ga0207691_10105069 | Ga0207691_101050692 | 267 |
| 431 | 3300025940 | Ga0207691_10239222 | Ga0207691_102392222 | 267 |
| 432 | 3300025941 | Ga0207711_10015375 | Ga0207711_100153755 | 267 |
| 433 | 3300025941 | Ga0207711_10121057 | Ga0207711_101210572 | 267 |
| 434 | 3300025941 | Ga0207711_10434700 | Ga0207711_104347002 | 267 |
| 435 | 3300025942 | Ga0207689_10054741 | Ga0207689_100547415 | 267 |
| 436 | 3300025942 | Ga0207689_10309493 | Ga0207689_103094932 | 267 |
| 437 | 3300025945 | Ga0207679_10604520 | Ga0207679_106045202 | 267 |
| 438 | 3300025960 | Ga0207651_10055471 | Ga0207651_100554711 | 267 |
| 439 | 3300025960 | Ga0207651_10058227 | Ga0207651_100582272 | 267 |
| 440 | 3300025960 | Ga0207651_10231222 | Ga0207651_102312221 | 267 |
| 441 | 3300025961 | Ga0207712_10049088 | Ga0207712_100490884 | 267 |
| 442 | 3300025972 | Ga0207668_10453067 | Ga0207668_104530672 | 267 |
| 443 | 3300025981 | Ga0207640_10080320 | Ga0207640_100803202 | 267 |
| 444 | 3300025981 | Ga0207640_10108229 | Ga0207640_101082292 | 267 |
| 445 | 3300025986 | Ga0207658_10053035 | Ga0207658_100530352 | 267 |
| 446 | 3300025986 | Ga0207658_10057826 | Ga0207658_100578263 | 267 |
| 447 | 3300025986 | Ga0207658_10236337 | Ga0207658_102363372 | 267 |
| 448 | 3300025986 | Ga0207658_10254487 | Ga0207658_102544872 | 267 |
| 449 | 3300026023 | Ga0207677_10071828 | Ga0207677_100718283 | 267 |
| 450 | 3300026035 | Ga0207703_10001680 | Ga0207703_1000168015 | 267 |
| 451 | 3300026035 | Ga0207703_10147259 | Ga0207703_101472592 | 267 |
| 452 | 3300026041 | Ga0207639_10104394 | Ga0207639_101043942 | 267 |
| 453 | 3300026041 | Ga0207639_10141873 | Ga0207639_101418732 | 267 |
| 454 | 3300026067 | Ga0207678_10028486 | Ga0207678_100284862 | 267 |
| 455 | 3300026067 | Ga0207678_10087406 | Ga0207678_100874062 | 267 |
| 456 | 3300026067 | Ga0207678_10764593 | Ga0207678_107645931 | 267 |
| 457 | 3300026075 | Ga0207708_10007039 | Ga0207708_100070397 | 267 |
| 458 | 3300026078 | Ga0207702_10034475 | Ga0207702_100344755 | 267 |
| 459 | 3300026088 | Ga0207641_10000273 | Ga0207641_1000027343 | 267 |
| 460 | 3300026088 | Ga0207641_10122257 | Ga0207641_101222573 | 267 |
| 461 | 3300026088 | Ga0207641_10267316 | Ga0207641_102673162 | 267 |
| 462 | 3300026088 | Ga0207641_10735513 | Ga0207641_107355131 | 267 |
| 463 | 3300026089 | Ga0207648_10001832 | Ga0207648_1000183212 | 267 |
| 464 | 3300026089 | Ga0207648_10047113 | Ga0207648_100471133 | 267 |
| 465 | 3300026089 | Ga0207648_10230215 | Ga0207648_102302152 | 267 |
| 466 | 3300026095 | Ga0207676_10013465 | Ga0207676_100134656 | 267 |
| 467 | 3300026116 | Ga0207674_10021133 | Ga0207674_100211335 | 267 |
| 468 | 3300026116 | Ga0207674_10024162 | Ga0207674_100241628 | 267 |
| 469 | 3300026118 | Ga0207675_100027120 | Ga0207675_1000271204 | 267 |
| 470 | 3300026118 | Ga0207675_100092269 | Ga0207675_1000922692 | 267 |
| 471 | 3300026121 | Ga0207683_10020420 | Ga0207683_100204206 | 267 |
| 472 | 3300026121 | Ga0207683_10087069 | Ga0207683_100870694 | 267 |
| 473 | 3300026121 | Ga0207683_10250904 | Ga0207683_102509041 | 267 |
| 474 | 3300026142 | Ga0207698_10081158 | Ga0207698_100811582 | 267 |
| 475 | 3300027111 | Ga0209281_1000029 | Ga0209281_1000029217 | 267 |
| 476 | 3300027666 | Ga0209282_1004597 | Ga0209282_10045977 | 267 |
| 477 | 3300028379 | Ga0268266_10129803 | Ga0268266_101298032 | 267 |
| 478 | 3300028380 | Ga0268265_10085953 | Ga0268265_100859533 | 267 |
| 479 | 3300028380 | Ga0268265_10156685 | Ga0268265_101566852 | 267 |
| 480 | 3300028380 | Ga0268265_10187619 | Ga0268265_101876192 | 267 |
| 481 | 3300028381 | Ga0268264_10000151 | Ga0268264_1000015192 | 267 |
| 482 | 3300028381 | Ga0268264_10010515 | Ga0268264_100105154 | 267 |
| 483 | 3300028786 | Ga0307517_10176598 | Ga0307517_101765982 | 267 |
| 484 | 3300028794 | Ga0307515_10000101 | Ga0307515_1000010153 | 267 |
| 485 | 3300028794 | Ga0307515_10000322 | Ga0307515_10000322104 | 267 |
| 486 | 3300028794 | Ga0307515_10000877 | Ga0307515_1000087752 | 267 |
| 487 | 3300028794 | Ga0307515_10003504 | Ga0307515_100035043 | 267 |
| 488 | 3300028794 | Ga0307515_10087893 | Ga0307515_100878934 | 267 |
| 489 | 3300028794 | Ga0307515_10132267 | Ga0307515_101322673 | 267 |
| 490 | 3300028794 | Ga0307515_10275249 | Ga0307515_102752493 | 267 |
| 491 | 3300028794 | Ga0307515_10452152 | Ga0307515_104521521 | 267 |
| 492 | 3300028800 | Ga0265338_10085451 | Ga0265338_100854512 | 267 |
| 493 | 3300030733 | Ga0314311_1058476 | Ga0314311_10584763 | 267 |
| 494 | 3300031251 | Ga0265327_10007110 | Ga0265327_100071107 | 267 |
| 495 | 3300031456 | Ga0307513_10004142 | Ga0307513_100041422 | 267 |
| 496 | 3300031456 | Ga0307513_10005935 | Ga0307513_100059356 | 267 |
| 497 | 3300031456 | Ga0307513_10031821 | Ga0307513_100318213 | 267 |
| 498 | 3300031456 | Ga0307513_10064112 | Ga0307513_100641122 | 267 |
| 499 | 3300031456 | Ga0307513_10182249 | Ga0307513_101822493 | 267 |
| 500 | 3300031507 | Ga0307509_10000215 | Ga0307509_1000021517 | 267 |
| 501 | 3300031507 | Ga0307509_10006676 | Ga0307509_1000667614 | 267 |
| 502 | 3300031507 | Ga0307509_10143968 | Ga0307509_101439682 | 267 |
| 503 | 3300031548 | Ga0307408_100024281 | Ga0307408_1000242813 | 267 |
| 504 | 3300031548 | Ga0307408_100093617 | Ga0307408_1000936172 | 267 |
| 505 | 3300031548 | Ga0307408_100264336 | Ga0307408_1002643362 | 267 |
| 506 | 3300031616 | Ga0307508_10000053 | Ga0307508_1000005338 | 267 |
| 507 | 3300031649 | Ga0307514_10002392 | Ga0307514_100023923 | 267 |
| 508 | 3300031649 | Ga0307514_10003568 | Ga0307514_100035685 | 267 |
| 509 | 3300031730 | Ga0307516_10108158 | Ga0307516_101081582 | 267 |
| 510 | 3300031730 | Ga0307516_10124000 | Ga0307516_101240001 | 267 |
| 511 | 3300031731 | Ga0307405_10007767 | Ga0307405_100077673 | 267 |
| 512 | 3300031731 | Ga0307405_10058878 | Ga0307405_100588782 | 267 |
| 513 | 3300031731 | Ga0307405_10165947 | Ga0307405_101659472 | 267 |
| 514 | 3300031824 | Ga0307413_10242857 | Ga0307413_102428571 | 267 |
| 515 | 3300031901 | Ga0307406_10000240 | Ga0307406_1000024022 | 267 |
| 516 | 3300031901 | Ga0307406_10213167 | Ga0307406_102131672 | 267 |
| 517 | 3300031903 | Ga0307407_10049413 | Ga0307407_100494134 | 267 |
| 518 | 3300031911 | Ga0307412_10017679 | Ga0307412_100176793 | 267 |
| 519 | 3300031911 | Ga0307412_10116804 | Ga0307412_101168043 | 267 |
| 520 | 3300031911 | Ga0307412_10368280 | Ga0307412_103682801 | 267 |
| 521 | 3300031911 | Ga0307412_10507000 | Ga0307412_105070001 | 267 |
| 522 | 3300031911 | Ga0307412_10595964 | Ga0307412_105959641 | 267 |
| 523 | 3300031995 | Ga0307409_100009343 | Ga0307409_1000093436 | 267 |
| 524 | 3300032002 | Ga0307416_100006086 | Ga0307416_1000060869 | 267 |
| 525 | 3300032002 | Ga0307416_100137674 | Ga0307416_1001376743 | 267 |
| 526 | 3300032126 | Ga0307415_100002654 | Ga0307415_1000026548 | 267 |
| 527 | 3300033180 | Ga0307510_10000003 | Ga0307510_10000003387 | 267 |
| 528 | 3300033180 | Ga0307510_10000364 | Ga0307510_1000036439 | 267 |
| 529 | 3300033180 | Ga0307510_10049353 | Ga0307510_100493534 | 267 |
| 530 | 3300033180 | Ga0307510_10268342 | Ga0307510_102683422 | 267 |
| 531 | 3300033180 | Ga0307510_10338194 | Ga0307510_103381942 | 267 |
| 532 | 3300035114 | Ga0373939_0059475 | Ga0373939_0059475_22_825 | 267 |
| 533 | 3300037312 | Ga0395899_0000035 | Ga0395899_0000035_23318_24121 | 267 |
| 534 | 3300037312 | Ga0395899_0042074 | Ga0395899_0042074_1595_2398 | 267 |
| 535 | 3300037418 | Ga0395900_0000113 | Ga0395900_0000113_23318_24121 | 267 |
| 536 | 3300037466 | Ga0395898_0000444 | Ga0395898_0000444_20142_20945 | 267 |
| 537 | 3300037471 | Ga0395905_0018804 | Ga0395905_0018804_4384_5211 | 267 |
| 538 | 3300037471 | Ga0395905_0063884 | Ga0395905_0063884_2403_3206 | 267 |
| 539 | 3300038443 | Ga0395901_0000718 | Ga0395901_0000718_13422_14285 | 267 |
| 540 | 3300038443 | Ga0395901_0001521 | Ga0395901_0001521_7139_7942 | 267 |
| 541 | 3300039438 | Ga0436360_0505175 | Ga0436360_0505175_1622_2425 | 267 |
| 542 | 3300039447 | Ga0436361_0730633 | Ga0436361_0730633_61372_62175 | 267 |
| 543 | 3300039450 | Ga0436363_1689440 | Ga0436363_1689440_8094_8903 | 267 |
| 544 | 3300041404 | Ga0439436_0001899 | Ga0439436_0001899_3772_4575 | 267 |
| 545 | 3300041404 | Ga0439436_0009738 | Ga0439436_0009738_421_1224 | 267 |
| 546 | 3300041404 | Ga0439436_0010303 | Ga0439436_0010303_400_1203 | 267 |
| 547 | 3300041411 | Ga0439466_0008532 | Ga0439466_0008532_1627_2430 | 267 |
| 548 | 3300041411 | Ga0439466_0017261 | Ga0439466_0017261_230_1033 | 267 |
| 549 | 3300041411 | Ga0439466_0021720 | Ga0439466_0021720_871_1674 | 267 |
| 550 | 3300041999 | Ga0439433_0025447 | Ga0439433_0025447_224_1027 | 267 |
| 551 | 3300042002 | Ga0439442_004262 | Ga0439442_004262_486_1289 | 267 |
| 552 | 3300042004 | Ga0439445_0010765 | Ga0439445_0010765_646_1449 | 267 |
| 553 | 3300042006 | Ga0439432_018413 | Ga0439432_018413_422_1225 | 267 |
| 554 | 3300042007 | Ga0439449_0007892 | Ga0439449_0007892_2424_3227 | 267 |
| 555 | 3300042010 | Ga0439452_005666 | Ga0439452_005666_2235_3038 | 267 |
| 556 | 3300042014 | Ga0439457_014209 | Ga0439457_014209_796_1599 | 267 |
| 557 | 3300042015 | Ga0439462_0006248 | Ga0439462_0006248_866_1669 | 267 |
| 558 | 3300042125 | Ga0450923_002449 | Ga0450923_002449_322_1125 | 267 |
| 559 | 3300042134 | Ga0450898_002238 | Ga0450898_002238_507_1310 | 267 |
| 560 | 3300042135 | Ga0450899_003957 | Ga0450899_003957_731_1534 | 267 |
| 561 | 3300042435 | Ga0439434_0009312 | Ga0439434_0009312_876_1679 | 267 |
| 562 | 3300042435 | Ga0439434_0011581 | Ga0439434_0011581_767_1570 | 267 |
| 563 | 3300042531 | Ga0450918_000332 | Ga0450918_000332_3078_3881 | 267 |
| 564 | 3300042532 | Ga0450893_0013478 | Ga0450893_0013478_439_1242 | 267 |
| 565 | 3300044656 | Ga0466969_0017951 | Ga0466969_0017951_2689_3492 | 267 |
| 566 | 3300044656 | Ga0466969_0041865 | Ga0466969_0041865_623_1426 | 267 |
| 567 | 3300044683 | Ga0466965_0089505 | Ga0466965_0089505_397_1200 | 267 |
| 568 | 3300044684 | Ga0466966_0027942 | Ga0466966_0027942_1611_2414 | 267 |
| 569 | 3300044693 | Ga0466961_0029680 | Ga0466961_0029680_180_983 | 267 |
| 570 | 3300044712 | Ga0453684_0143830 | Ga0453684_0143830_1816_2622 | 267 |
| 571 | 3300045049 | Ga0466959_0004321 | Ga0466959_0004321_2048_2851 | 267 |
| 572 | 3300045049 | Ga0466959_0146256 | Ga0466959_0146256_619_1422 | 267 |
| 573 | 3300045051 | Ga0451576_0004945 | Ga0451576_0004945_14453_15280 | 267 |
| 574 | 3300045051 | Ga0451576_0216083 | Ga0451576_0216083_513_1316 | 267 |
| 575 | 3300045836 | Ga0466958_0000765 | Ga0466958_0000765_1936_2739 | 267 |
| 576 | 3300045836 | Ga0466958_0009225 | Ga0466958_0009225_2140_2943 | 267 |
| 577 | 3300046454 | Ga0495592_0000173 | Ga0495592_0000173_3522_4325 | 267 |
| 578 | 3300046459 | Ga0495629_0426395 | Ga0495629_0426395_65_868 | 267 |
| 579 | 3300046460 | Ga0495638_0153364 | Ga0495638_0153364_489_1292 | 267 |
| 580 | 3300046475 | Ga0495639_0022234 | Ga0495639_0022234_124_927 | 267 |
| 581 | 3300046507 | Ga0495606_0006456 | Ga0495606_0006456_8433_9236 | 267 |
| 582 | 3300046507 | Ga0495606_0082228 | Ga0495606_0082228_742_1545 | 267 |
| 583 | 3300046513 | Ga0495616_0020994 | Ga0495616_0020994_2083_2886 | 267 |
| 584 | 3300046518 | Ga0495631_0002066 | Ga0495631_0002066_4000_4803 | 267 |
| 585 | 3300046519 | Ga0495632_0003077 | Ga0495632_0003077_1509_2312 | 267 |
| 586 | 3300046529 | Ga0495652_0054302 | Ga0495652_0054302_1060_1863 | 267 |
| 587 | 3300046531 | Ga0495665_0060761 | Ga0495665_0060761_237_1040 | 267 |
| 588 | 3300046539 | Ga0495621_0080220 | Ga0495621_0080220_295_1098 | 267 |
| 589 | 3300046542 | Ga0495597_0024569 | Ga0495597_0024569_666_1478 | 267 |
| 590 | 3300046543 | Ga0495645_0008045 | Ga0495645_0008045_2316_3119 | 267 |
| 591 | 3300046543 | Ga0495645_0063703 | Ga0495645_0063703_85_888 | 267 |
| 592 | 3300046615 | Ga0495656_0053999 | Ga0495656_0053999_814_1617 | 267 |
| 593 | 3300046616 | Ga0495668_0020719 | Ga0495668_0020719_2322_3125 | 267 |
| 594 | 3300046648 | Ga0495611_0130508 | Ga0495611_0130508_313_1116 | 267 |
| 595 | 3300046660 | Ga0495625_0000206 | Ga0495625_0000206_25275_26078 | 267 |
| 596 | 3300046660 | Ga0495625_0028232 | Ga0495625_0028232_2075_2878 | 267 |
| 597 | 3300046665 | Ga0495661_0001271 | Ga0495661_0001271_17757_18560 | 267 |
| 598 | 3300046665 | Ga0495661_0082960 | Ga0495661_0082960_592_1395 | 267 |
| 599 | 3300046674 | Ga0495588_0034670 | Ga0495588_0034670_32_835 | 267 |
| 600 | 3300046678 | Ga0495599_0098473 | Ga0495599_0098473_831_1634 | 267 |
| 601 | 3300046680 | Ga0495646_0003204 | Ga0495646_0003204_8668_9471 | 267 |
| 602 | 3300046680 | Ga0495646_0122555 | Ga0495646_0122555_508_1311 | 267 |
| 603 | 3300046690 | Ga0495624_0027527 | Ga0495624_0027527_715_1518 | 267 |
| 604 | 3300046690 | Ga0495624_0051090 | Ga0495624_0051090_857_1660 | 267 |
| 605 | 3300046691 | Ga0495670_0022247 | Ga0495670_0022247_1650_2453 | 267 |
| 606 | 3300046692 | Ga0495671_0020716 | Ga0495671_0020716_2166_2969 | 267 |
| 607 | 3300046692 | Ga0495671_0196104 | Ga0495671_0196104_132_935 | 267 |
| 608 | 3300046694 | Ga0495649_0004289 | Ga0495649_0004289_2685_3497 | 267 |
| 609 | 3300046694 | Ga0495649_0007271 | Ga0495649_0007271_3703_4506 | 267 |
| 610 | 3300046810 | Ga0495660_0166002 | Ga0495660_0166002_159_962 | 267 |
| 611 | 3300047323 | Ga0495683_0005760 | Ga0495683_0005760_4590_5393 | 267 |
| 612 | 3300047443 | Ga0495687_001027 | Ga0495687_001027_21176_21988 | 267 |
| 613 | 3300047443 | Ga0495687_029024 | Ga0495687_029024_790_1602 | 267 |
| 614 | 3300047443 | Ga0495687_081862 | Ga0495687_081862_383_1186 | 267 |
| 615 | 3300047673 | Ga0495593_0012279 | Ga0495593_0012279_1062_1865 | 267 |
| 616 | 3300047673 | Ga0495593_0250632 | Ga0495593_0250632_39_842 | 267 |
| 617 | 3300048089 | Ga0495614_0016572 | Ga0495614_0016572_133_936 | 267 |
| 618 | 3300048091 | Ga0495626_0048618 | Ga0495626_0048618_342_1154 | 267 |
| 619 | 3300048903 | Ga0496100_0027575 | Ga0496100_0027575_1563_2366 | 267 |
| 620 | 3300048903 | Ga0496100_0085758 | Ga0496100_0085758_826_1629 | 267 |
| 621 | 3300048904 | Ga0496101_0001978 | Ga0496101_0001978_9354_10157 | 267 |
| 622 | 3300048905 | Ga0496102_0002447 | Ga0496102_0002447_2405_3208 | 267 |
| 623 | 3300048905 | Ga0496102_0036739 | Ga0496102_0036739_1995_2798 | 267 |
| 624 | 3300048906 | Ga0496103_0035714 | Ga0496103_0035714_1465_2268 | 267 |
| 625 | 3300048907 | Ga0496104_0052112 | Ga0496104_0052112_2083_2886 | 267 |
| 626 | 3300048908 | Ga0496105_0005298 | Ga0496105_0005298_2339_3142 | 267 |
| 627 | 3300048908 | Ga0496105_0151897 | Ga0496105_0151897_836_1639 | 267 |
| 628 | 3300048911 | Ga0496108_0208093 | Ga0496108_0208093_218_1021 | 267 |
| 629 | 3300048911 | Ga0496108_0312914 | Ga0496108_0312914_223_1026 | 267 |
| 630 | 3300048913 | Ga0496110_0036920 | Ga0496110_0036920_2717_3520 | 267 |
| 631 | 3300048914 | Ga0496111_0092371 | Ga0496111_0092371_1208_2011 | 267 |
| 632 | 3300048915 | Ga0496112_0472561 | Ga0496112_0472561_46_849 | 267 |
| 633 | 3300048917 | Ga0496114_0046200 | Ga0496114_0046200_1570_2373 | 267 |
| 634 | 3300048919 | Ga0496116_0023452 | Ga0496116_0023452_663_1466 | 267 |
| 635 | 3300048919 | Ga0496116_0043537 | Ga0496116_0043537_1303_2106 | 267 |
| 636 | 3300048920 | Ga0496117_0000186 | Ga0496117_0000186_122959_123762 | 267 |
| 637 | 3300048920 | Ga0496117_0047932 | Ga0496117_0047932_1078_1881 | 267 |
| 638 | 3300048920 | Ga0496117_0073591 | Ga0496117_0073591_188_991 | 267 |
| 639 | 3300048921 | Ga0496118_0000003 | Ga0496118_0000003_315550_316353 | 267 |
| 640 | 3300048921 | Ga0496118_0018486 | Ga0496118_0018486_953_1756 | 267 |
| 641 | 3300048921 | Ga0496118_0021335 | Ga0496118_0021335_1281_2084 | 267 |
| 642 | 3300048921 | Ga0496118_0146734 | Ga0496118_0146734_425_1228 | 267 |
| 643 | 3300048922 | Ga0496119_0001832 | Ga0496119_0001832_14000_14803 | 267 |
| 644 | 3300048922 | Ga0496119_0008384 | Ga0496119_0008384_2037_2840 | 267 |
| 645 | 3300048922 | Ga0496119_0061827 | Ga0496119_0061827_986_1789 | 267 |
| 646 | 3300048923 | Ga0496120_0000232 | Ga0496120_0000232_19665_20468 | 267 |
| 647 | 3300048923 | Ga0496120_0049700 | Ga0496120_0049700_915_1718 | 267 |
| 648 | 3300048924 | Ga0496121_0035691 | Ga0496121_0035691_1082_1885 | 267 |
| 649 | 3300048924 | Ga0496121_0103970 | Ga0496121_0103970_1285_2088 | 267 |
| 650 | 3300048924 | Ga0496121_0110605 | Ga0496121_0110605_197_1000 | 267 |
| 651 | 3300048926 | Ga0496123_0051703 | Ga0496123_0051703_1235_2038 | 267 |
| 652 | 3300048927 | Ga0496124_0124820 | Ga0496124_0124820_845_1648 | 267 |
| 653 | 3300048927 | Ga0496124_0144746 | Ga0496124_0144746_474_1277 | 267 |
| 654 | 3300048927 | Ga0496124_0296875 | Ga0496124_0296875_104_907 | 267 |
| 655 | 3300048928 | Ga0496125_0001701 | Ga0496125_0001701_4690_5493 | 267 |
| 656 | 3300048928 | Ga0496125_0002867 | Ga0496125_0002867_7214_8017 | 267 |
| 657 | 3300048928 | Ga0496125_0023671 | Ga0496125_0023671_3503_4306 | 267 |
| 658 | 3300048928 | Ga0496125_0113828 | Ga0496125_0113828_221_1024 | 267 |
| 659 | 3300048928 | Ga0496125_0213023 | Ga0496125_0213023_309_1112 | 267 |
| 660 | 3300048929 | Ga0496126_0000065 | Ga0496126_0000065_215530_216333 | 267 |
| 661 | 3300048929 | Ga0496126_0101915 | Ga0496126_0101915_1423_2226 | 267 |
| 662 | 3300048929 | Ga0496126_0198129 | Ga0496126_0198129_149_952 | 267 |
| 663 | 3300049580 | Ga0501046_0000110 | Ga0501046_0000110_5709_6512 | 267 |
| 664 | 3300049581 | Ga0501047_0000143 | Ga0501047_0000143_6081_6884 | 267 |
| 665 | 3300049582 | Ga0501048_0000601 | Ga0501048_0000601_19154_19957 | 267 |
| 666 | 3300049759 | Ga0501262_002539 | Ga0501262_002539_766_1569 | 267 |
| 667 | 3300049822 | Ga0501035_0147525 | Ga0501035_0147525_1193_2008 | 267 |
| 668 | 3300049822 | Ga0501035_0487444 | Ga0501035_0487444_17_820 | 267 |
| 669 | 3300049823 | Ga0501044_0000185 | Ga0501044_0000185_63628_64443 | 267 |
| 670 | 3300049824 | Ga0501045_0008311 | Ga0501045_0008311_5835_6638 | 267 |
| 671 | 3300050489 | nmdc:mga03683_35960_c1 | nmdc:mga03683_35960_c1_729_1541 | 267 |
| 672 | 3300050489 | nmdc:mga03683_3773_c1 | nmdc:mga03683_3773_c1_2593_3396 | 267 |
| 673 | 3300050489 | nmdc:mga03683_8851_c1 | nmdc:mga03683_8851_c1_2569_3381 | 267 |
| 674 | 3300050490 | nmdc:mga03n38_57457_c1 | nmdc:mga03n38_57457_c1_194_1006 | 267 |
| 675 | 3300050490 | nmdc:mga03n38_9973_c1 | nmdc:mga03n38_9973_c1_1791_2594 | 267 |
| 676 | 3300050491 | nmdc:mga00v17_103478_c1 | nmdc:mga00v17_103478_c1_612_1424 | 267 |
| 677 | 3300050492 | nmdc:mga0yw44_100333_c1 | nmdc:mga0yw44_100333_c1_822_1625 | 267 |
| 678 | 3300050492 | nmdc:mga0yw44_220168_c1 | nmdc:mga0yw44_220168_c1_146_961 | 267 |
| 679 | 3300050493 | nmdc:mga0k408_152164_c1 | nmdc:mga0k408_152164_c1_352_1158 | 267 |
| 680 | 3300050493 | nmdc:mga0k408_245729_c1 | nmdc:mga0k408_245729_c1_44_847 | 267 |
| 681 | 3300050493 | nmdc:mga0k408_42363_c1 | nmdc:mga0k408_42363_c1_602_1405 | 267 |
| 682 | 3300050493 | nmdc:mga0k408_603_c1 | nmdc:mga0k408_603_c1_2611_3423 | 267 |
| 683 | 3300050493 | nmdc:mga0k408_739_c1 | nmdc:mga0k408_739_c1_1584_2387 | 267 |
| 684 | 3300050493 | nmdc:mga0k408_9492_c1 | nmdc:mga0k408_9492_c1_1355_2167 | 267 |
| 685 | 3300050494 | nmdc:mga06z11_110524_c1 | nmdc:mga06z11_110524_c1_237_1049 | 267 |
| 686 | 3300050494 | nmdc:mga06z11_12360_c1 | nmdc:mga06z11_12360_c1_482_1294 | 267 |
| 687 | 3300050494 | nmdc:mga06z11_16246_c1 | nmdc:mga06z11_16246_c1_2230_3045 | 267 |
| 688 | 3300050494 | nmdc:mga06z11_27112_c1 | nmdc:mga06z11_27112_c1_561_1373 | 267 |
| 689 | 3300050496 | nmdc:mga07m45_11742_c1 | nmdc:mga07m45_11742_c1_1764_2567 | 267 |
| 690 | 3300050496 | nmdc:mga07m45_123932_c1 | nmdc:mga07m45_123932_c1_181_993 | 267 |
| 691 | 3300050496 | nmdc:mga07m45_14528_c1 | nmdc:mga07m45_14528_c1_2229_3032 | 267 |
| 692 | 3300050496 | nmdc:mga07m45_14555_c1 | nmdc:mga07m45_14555_c1_3169_3972 | 267 |
| 693 | 3300050496 | nmdc:mga07m45_2153_c1 | nmdc:mga07m45_2153_c1_336_1148 | 267 |
| 694 | 3300050496 | nmdc:mga07m45_24472_c1 | nmdc:mga07m45_24472_c1_359_1171 | 267 |
| 695 | 3300050496 | nmdc:mga07m45_482_c1 | nmdc:mga07m45_482_c1_6117_6920 | 267 |
| 696 | 3300050496 | nmdc:mga07m45_49154_c1 | nmdc:mga07m45_49154_c1_570_1373 | 267 |
| 697 | 3300050496 | nmdc:mga07m45_655_c2 | nmdc:mga07m45_655_c2_2087_2899 | 267 |
| 698 | 3300050496 | nmdc:mga07m45_9697_c1 | nmdc:mga07m45_9697_c1_302_1114 | 267 |
| 699 | 3300053093 | Ga0500651_0028268 | Ga0500651_0028268_737_1540 | 267 |
| 700 | 3300053117 | Ga0500593_008854 | Ga0500593_008854_3080_3883 | 267 |
| 701 | 3300053118 | Ga0500594_0003653 | Ga0500594_0003653_2360_3163 | 267 |
| 702 | 3300053121 | Ga0500607_009331 | Ga0500607_009331_3511_4314 | 267 |
| 703 | 3300053122 | Ga0500608_013476 | Ga0500608_013476_738_1541 | 267 |
| 704 | 3300053130 | Ga0500642_0001951 | Ga0500642_0001951_1078_1884 | 267 |
| 705 | 3300053134 | Ga0500658_0002586 | Ga0500658_0002586_1052_1864 | 267 |
| 706 | 3300053136 | Ga0500559_0000195 | Ga0500559_0000195_25286_26089 | 267 |
| 707 | 3300053141 | Ga0500574_007516 | Ga0500574_007516_471_1274 | 267 |
| 708 | 3300053156 | Ga0500622_0007666 | Ga0500622_0007666_665_1468 | 267 |
| 709 | 3300053156 | Ga0500622_0035467 | Ga0500622_0035467_384_1187 | 267 |
| 710 | 3300053158 | Ga0500627_0005089 | Ga0500627_0005089_3140_3943 | 267 |
| 711 | 3300053177 | Ga0500636_0051722 | Ga0500636_0051722_229_1032 | 267 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2eb6-assembly1.cif.gz_A | crystal structure of hpcg complexed with mg ion | 0.9855 | 1 | 267 |
| 2eb6-assembly1.cif.gz_D-2 | crystal structure of hpcg complexed with mg ion | 0.9855 | 1 | 267 |
| 2eb6-assembly1.cif.gz_D-2 | crystal structure of hpcg complexed with mg ion | 0.9819 | 1 | 267 |
| 2eb5-assembly1.cif.gz_E-2 | crystal structure of hpcg complexed with oxalate | 0.9798 | 1 | 267 |
| 2eb5-assembly1.cif.gz_B-2 | crystal structure of hpcg complexed with oxalate | 0.9779 | 1 | 267 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I6XHH5_1_260_3.90.850.10 | Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain | 0.9664 | 1 | 266 | 3.90.850.10 |
| 2eb4C00 | Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain | 0.9659 | 1 | 267 | 3.90.850.10 |
| af_I6XHH5_1_260_3.90.850.10 | Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain | 0.9627 | 1 | 266 | 3.90.850.10 |
| 2eb4C00 | Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain | 0.9623 | 1 | 267 | 3.90.850.10 |
| 5d2kB00 | Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain | 0.9612 | 1 | 267 | 3.90.850.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A447U5C0-F1-model_v4 | 2-oxo-hepta-3-ene-1,7-dioic acid hydratase (EC 4.2.-.-, EC 4.2.1.80) | 0.9975 | 183 | 267 |
GO:0005737
GO:0008684 |
| AF-A0A727S3R6-F1-model_v4 | 2-oxo-hepta-3-ene-1,7-dioic acid hydratase | 0.9964 | 177 | 267 |
GO:0005737
GO:0008684 |
| AF-A0A7W7EBG9-F1-model_v4 | deleted | 0.9961 | 1 | 267 |
|
| AF-A0A2C9AK24-F1-model_v4 | deleted | 0.9959 | 1 | 267 |
|
| AF-A0A1N6LNE5-F1-model_v4 | deleted | 0.9958 | 1 | 267 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar