F476672

General Info

Members Datasets Scaffolds Average Seq Length
709 391 542 765

Family's Representative Sequence

Representative Sequence 3300048909|Ga0496106_0000211|Ga0496106_0000211_36804_39347
Length 847
Sequence MQRRGTTAGQPGDDISRCTPDAGTEKYEIDRQRFFAMTTDTPPQRNTRDPLPKPVPQRASWTRWLTILFAALSGLYLLVGGIWLVSVRGSPYYVIAGIAMLAVAWLVFQRNRWALALYGLLLIGTLAWAVSESGFDFWALAPRIDVLVVFGVWLILPFIYRQFIGAIMPAALVIGIGLIASAAILVYAAYNDPQQINGTLSAEQSSPTPDSDPRAGDWPAYGRTQGGTRYSPLAQINEQNVKNLHVAWTFETGDHKGKSDPQEITDEVTPIKIGSMLYLCSPHQKLFALDAATGKEKWRFDPGLKTNPGFQHVTCRGVSYHETASASAATTPQAQAALPMCSRRVILPVNNGHLYELDAATGQRCAGFGNNGDLDLQHLEPVKTSGAYEPTSPPVVTDKVIVVAGSVTDNFSVSEPSGAIRGFDVETGKLLWAFDPGAHAPNAIPDDQHSFVANSPNSWAPAAYDPRLDLVYLPMGVSTPDIWGGRRTPDMERYASGLLALHASTGKLAWFYQTVHHDLWDMDLPAQPTLVDLKDANGNIVPAVYAPAKTGNIFVLDRRTGKLIVPAPEEPVPQGAAQGDRVSPTQPYSQLTFRPAQNLRGADMWGATMYDQLVCRVMFHRLRYEGPFTPPSERGTLVFPGNLGMFEWGGLAVDTDRHIAIANPIALPFVSRLIPRGPHNPMEPPEASQGAGQSGTGTEAGVQPQYGVPFGVTLNPFLSPLGLPCKEPAWGYVAAVDLTNNQIVWKKRIGTVRDSSPLPLPFRMGMPMLGGPMTTAGHVFFIGATADNYLRAFSTDTGRELWRARLPAGGQATPMTYEANGKQFVVIAAGGHGSFGTKLGDYVIAYA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
3 2506520008 Serratia plymuthica AS12 Isolate Unclassified
4 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
5 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
6 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
7 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
8 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
9 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
10 2547132181 Kosakonia sacchari SP1 Isolate Stem
11 2547132416 Enterobacter sp. MR1 Isolate Rhizoplane
12 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
13 2561511199 Enterobacter sp. R4-368 Isolate Nodule
14 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
15 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
16 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
17 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
18 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
19 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
20 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
21 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
22 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
23 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
24 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
25 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
26 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
27 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
28 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
29 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
30 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
31 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
32 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
33 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
34 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
35 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
36 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
37 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
38 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
39 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
40 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
41 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
42 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
43 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
44 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
45 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
46 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
47 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
48 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
49 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
50 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
51 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
52 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
53 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
54 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
55 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
56 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
57 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
58 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
59 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
60 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
61 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
62 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
63 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
64 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
65 2636415599 Klebsiella variicola DX120E Isolate Unclassified
66 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
67 2643221583 Caulobacter sp. Root655 Isolate Unclassified
68 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
69 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
70 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
71 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
72 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
73 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
74 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
75 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
76 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
77 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
78 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
79 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
80 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
81 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
82 2751185917 Enterobacter sp. HK169 Isolate Unclassified
83 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
84 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
85 2775507074 Klebsiella sp. D5A Isolate Unclassified
86 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
87 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
88 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
89 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
90 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
91 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
92 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
93 2818991457 Xanthomonas translucens 569 Isolate Unclassified
94 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
95 2821118458 Enterobacter asburiae 609 Isolate Unclassified
96 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
97 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
98 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
99 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
100 2847085930 Erwinia persicina B64 Isolate Bulb
101 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
102 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
103 2865014394 Pantoea sp. R-71966 Isolate Unclassified
104 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
105 2876601092 Pantoea endophytica 596 Isolate Unclassified
106 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
107 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
108 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
109 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
110 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
111 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
112 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
113 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
114 2904504865 Serratia marcescens 1822 Isolate Unclassified
115 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
116 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
117 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
118 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
119 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
120 2919150387 Rahnella aceris 1817 Isolate Unclassified
121 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
122 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
123 2927143783 Rahnella sp. 2050 Isolate Unclassified
124 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
125 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
126 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
127 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
128 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
129 2937539931 Pantoea sp. LS15 Isolate Unclassified
130 2937967321 Serratia sp. YC16 Isolate Unclassified
131 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
132 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
133 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
134 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
135 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
136 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
137 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
138 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
139 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
140 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
141 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
142 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
143 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
144 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
145 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
146 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
147 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
148 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
149 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
150 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
151 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
152 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
153 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
154 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
155 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
156 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
157 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
158 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
159 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
160 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
161 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
162 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
163 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
164 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
165 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
166 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
167 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
168 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
169 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
170 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
171 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
172 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
173 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
174 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
175 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
176 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
177 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
178 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
179 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
180 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
181 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
182 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
183 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
184 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
185 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
186 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
187 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
188 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
189 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
190 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
191 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
192 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
193 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
194 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
195 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
196 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
197 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
198 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
199 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
200 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
201 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
202 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
203 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
204 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
205 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
206 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
207 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
208 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
209 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
210 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
211 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
212 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
213 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
214 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
215 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
216 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
217 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
218 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
219 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
220 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
221 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
222 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
223 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
224 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
225 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
226 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
227 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
228 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
229 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
230 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
231 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
232 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
233 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
234 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
235 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
236 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
237 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
238 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
239 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
240 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
241 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
242 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
243 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
244 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
245 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
246 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
247 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
248 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
249 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
273 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
274 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
275 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
276 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
278 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
279 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
280 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
281 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
282 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
283 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
284 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
285 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
286 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
287 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
288 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
289 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
290 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
291 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
292 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
293 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
294 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
295 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
296 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
297 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
298 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
299 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
300 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
301 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
302 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
303 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
304 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
305 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
306 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
307 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
308 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
309 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
310 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
311 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
312 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
313 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
314 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
315 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
316 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
317 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
318 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
319 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
320 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
321 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
322 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
323 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
324 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
325 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
326 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
327 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
328 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
329 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
330 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
331 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
332 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
333 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
334 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
335 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
336 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
337 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
338 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
339 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
340 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
341 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
342 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
343 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
344 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
345 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
346 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
347 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
348 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
349 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
350 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
351 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
352 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
353 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
354 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
355 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
356 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
357 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
358 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
359 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
360 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
361 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
362 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
363 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
364 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
365 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
366 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
367 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
368 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
369 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
370 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
371 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
372 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
373 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
374 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
375 640753048 Serratia proteamaculans 568 Isolate Endosphere
376 641228493 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
377 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
378 643348555 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
379 8004592986 Serratia sp. S119 Isolate Unclassified
380 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
381 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
382 8018221730 Enterobacter sp. CM29 Isolate Unclassified
383 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
384 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
385 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
386 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
387 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
388 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
389 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
390 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
391 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 76.45
Metatranscriptomes 0
Isolates 23.55

Biome Distribution

Category Percentage (%)
Aerial Root 0.56
Bulb 0.14
Endosphere 8.32
Nodule 2.54
Rhizoplane 9.73
Rhizosphere 56.28
Stem 0.14
Stem Tuber 0
Unclassified 22.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1263081 2162886007 Bacteria 3984
2 SwRhRL2b_contig_791230 2162886007 Bacteria 3318
3 JGI24740J21852_10008449 3300001979 Bacteria 4102
4 JGI24739J22299_10000116 3300001989 Bacteria 25044
5 JGI24738J21930_10001231 3300002075 Bacteria 7193
6 JGI25162J39368_1000010 3300002737 Bacteria 389629
7 JGI25162J39368_1002232 3300002737 Bacteria 7934
8 JGI25163J39215_1000005 3300002771 Bacteria 128851
9 JGI25164J39214_1000003 3300002772 Bacteria 389390
10 JGI25152J39213_1000194 3300002773 Bacteria 41017
11 JGI25152J39213_1002116 3300002773 Bacteria 7786
12 JGI25159J45721_1000158 3300002987 Bacteria 31947
13 JGI25151J46595_10004852 3300003187 Bacteria 7028
14 rootH1_10017387 3300003316 Bacteria 40873
15 rootH2_10006301 3300003320 Bacteria 9096
16 rootL2_10001213 3300003322 Bacteria 13948
17 rootH1_10041198 3300003323 Bacteria 10543
18 JGI25160J50197_1000017 3300003354 Bacteria 246175
19 JGI25160J50197_1000026 3300003354 Bacteria 184693
20 JGI25161J50226_1000014 3300003374 Bacteria 191109
21 Ga0055538_1000009 3300003751 Bacteria 389629
22 Ga0055539_1000013 3300003752 Bacteria 389629
23 Ga0055533_1000017 3300003756 Bacteria 389629
24 Ga0055525_1000019 3300003759 Bacteria 389629
25 Ga0055528_1005383 3300003790 Bacteria 5970
26 Ga0055528_1009785 3300003790 Bacteria 3972
27 Ga0055540_1001691 3300003792 Bacteria 12722
28 Ga0055531_10001301 3300003794 Bacteria 18804
29 Ga0055541_1000010 3300003841 Bacteria 389629
30 Ga0058692_1000033 3300003856 Bacteria 174393
31 Ga0058692_1000096 3300003856 Bacteria 59941
32 Ga0058692_1000221 3300003856 Bacteria 33587
33 Ga0058692_1001342 3300003856 Bacteria 9181
34 Ga0058692_1001644 3300003856 Bacteria 8017
35 Ga0058692_1001756 3300003856 Bacteria 7700
36 Ga0058692_1004285 3300003856 Bacteria 4248
37 Ga0058692_1004293 3300003856 Bacteria 4244
38 Ga0055543_1000079 3300004625 Bacteria 84916
39 Ga0065165_1000073 3300005262 Bacteria 164910
40 Ga0065165_1000751 3300005262 Bacteria 44388
41 Ga0065704_10000982 3300005289 Bacteria 19498
42 Ga0065704_10001780 3300005289 Bacteria 9988
43 Ga0065704_10004009 3300005289 Bacteria 6070
44 Ga0065704_10070794 3300005289 Bacteria 16061
45 Ga0070658_10003669 3300005327 Bacteria 12571
46 Ga0070658_10005410 3300005327 Bacteria 10359
47 Ga0070658_10010729 3300005327 Bacteria 7342
48 Ga0070670_100007809 3300005331 Bacteria 9102
49 Ga0070666_10004464 3300005335 Bacteria 8521
50 Ga0070660_100001562 3300005339 Bacteria 15749
51 Ga0070668_100011814 3300005347 Bacteria 6503
52 Ga0070669_100029404 3300005353 Bacteria 3960
53 Ga0070671_100020359 3300005355 Bacteria 5409
54 Ga0070667_100030572 3300005367 Bacteria 4492
55 Ga0070663_100009620 3300005455 Bacteria 5993
56 Ga0070681_10027912 3300005458 Bacteria 5674
57 Ga0070699_100029582 3300005518 Bacteria 4724
58 Ga0070679_100004379 3300005530 Bacteria 13048
59 Ga0068853_100014777 3300005539 Bacteria 6407
60 Ga0068853_100019985 3300005539 Bacteria 5564
61 Ga0070696_100008769 3300005546 Bacteria 6765
62 Ga0070696_100011207 3300005546 Bacteria 6001
63 Ga0070665_100000749 3300005548 Bacteria 43085
64 Ga0070665_100019597 3300005548 Bacteria 6791
65 Ga0068855_100000079 3300005563 Bacteria 117264
66 Ga0068855_100003874 3300005563 Bacteria 18286
67 Ga0068855_100020431 3300005563 Bacteria 7942
68 Ga0068857_100000004 3300005577 Bacteria 171895
69 Ga0068854_100006895 3300005578 Bacteria 7247
70 Ga0068856_100006394 3300005614 Bacteria 11557
71 Ga0068863_100000102 3300005841 Bacteria 92290
72 Ga0068863_100007662 3300005841 Bacteria 10562
73 Ga0068860_100000118 3300005843 Bacteria 127169
74 Ga0068860_100006572 3300005843 Bacteria 11674
75 Ga0068862_100003598 3300005844 Bacteria 13266
76 Ga0075364_10002151 3300006051 Bacteria 11041
77 Ga0075364_10002674 3300006051 Bacteria 10002
78 Ga0075364_10003220 3300006051 Bacteria 9244
79 Ga0079104_1000238 3300006946 Bacteria 73159
80 Ga0079104_1000406 3300006946 Bacteria 49721
81 Ga0079104_1001044 3300006946 Bacteria 21144
82 Ga0079104_1001079 3300006946 Bacteria 20446
83 Ga0079104_1004384 3300006946 Bacteria 6083
84 Ga0105251_10000054 3300009011 Bacteria 105910
85 Ga0105251_10000203 3300009011 Bacteria 59939
86 Ga0105251_10000425 3300009011 Bacteria 41003
87 Ga0105251_10000594 3300009011 Bacteria 33199
88 Ga0105251_10001143 3300009011 Bacteria 23093
89 Ga0105251_10001239 3300009011 Bacteria 22107
90 Ga0105251_10002260 3300009011 Bacteria 15297
91 Ga0105251_10022412 3300009011 Bacteria 3280
92 Ga0105244_10000039 3300009036 Bacteria 158304
93 Ga0105244_10000256 3300009036 Bacteria 54425
94 Ga0105244_10000262 3300009036 Bacteria 53246
95 Ga0105244_10000972 3300009036 Bacteria 24082
96 Ga0105244_10001135 3300009036 Bacteria 22141
97 Ga0105244_10003875 3300009036 Bacteria 10525
98 Ga0105244_10004014 3300009036 Bacteria 10293
99 Ga0105244_10015395 3300009036 Bacteria 4387
100 Ga0105250_10000003 3300009092 Bacteria 547770
101 Ga0105250_10000324 3300009092 Bacteria 36745
102 Ga0105250_10000378 3300009092 Bacteria 33263
103 Ga0105250_10001159 3300009092 Bacteria 14825
104 Ga0105250_10002764 3300009092 Bacteria 8620
105 Ga0105250_10006600 3300009092 Bacteria 5053
106 Ga0105240_10016814 3300009093 Bacteria 9891
107 Ga0105247_10001981 3300009101 Bacteria 14218
108 Ga0105243_10002183 3300009148 Bacteria 16513
109 Ga0105241_10000001 3300009174 Bacteria 879793
110 Ga0105241_10005445 3300009174 Bacteria 9414
111 Ga0105237_10006003 3300009545 Bacteria 13592
112 Ga0105237_10027301 3300009545 Bacteria 5829
113 Ga0105237_10041079 3300009545 Bacteria 4665
114 Ga0105238_10006413 3300009551 Bacteria 11707
115 Ga0105239_10019954 3300010375 Bacteria 7397
116 Ga0105246_10022591 3300011119 Bacteria 4060
117 Ga0157373_10001471 3300013100 Bacteria 17966
118 Ga0157373_10014184 3300013100 Bacteria 5844
119 Ga0157371_10000261 3300013102 Bacteria 72525
120 Ga0157371_10000761 3300013102 Bacteria 37256
121 Ga0157371_10000944 3300013102 Bacteria 32450
122 Ga0157371_10002063 3300013102 Bacteria 19699
123 Ga0157370_10000120 3300013104 Bacteria 91793
124 Ga0157370_10022912 3300013104 Bacteria 6209
125 Ga0157369_10020801 3300013105 Bacteria 7334
126 Ga0163162_10008760 3300013306 Bacteria 9841
127 Ga0163162_10032124 3300013306 Bacteria 5212
128 Ga0157372_10002392 3300013307 Bacteria 20313
129 Ga0157372_10015000 3300013307 Bacteria 8293
130 Ga0182008_10006961 3300014497 Bacteria 6274
131 Ga0182008_10015010 3300014497 Bacteria 4050
132 Ga0157379_10060587 3300014968 Bacteria 3384
133 Ga0182006_1000045 3300015261 Bacteria 197248
134 Ga0182006_1000200 3300015261 Bacteria 61593
135 Ga0182007_10004663 3300015262 Bacteria 6184
136 Ga0182005_1001039 3300015265 Bacteria 11750
137 Ga0183366_1003 3300015679 Bacteria 453474
138 Ga0183370_1003 3300015680 Bacteria 454044
139 Ga0183369_1005 3300015685 Bacteria 453680
140 Ga0183368_1006 3300015687 Bacteria 551576
141 Ga0183361_10021 3300016635 Bacteria 114065
142 Ga0163161_10000001 3300017792 Bacteria 2041488
143 Ga0213876_10000026 3300021384 Bacteria 231892
144 Ga0209760_100038 3300025207 Bacteria 126360
145 Ga0209784_100012 3300025224 Bacteria 535823
146 Ga0209566_100010 3300025225 Bacteria 535823
147 Ga0209674_100023 3300025226 Bacteria 535823
148 Ga0209563_100027 3300025230 Bacteria 535823
149 Ga0207427_100017 3300025231 Bacteria 535823
150 Ga0209437_100029 3300025233 Bacteria 535823
151 Ga0209437_100100 3300025233 Bacteria 228479
152 Ga0209677_100014 3300025253 Bacteria 535823
153 Ga0209759_1003951 3300025256 Bacteria 5703
154 Ga0209129_1000008 3300025258 Bacteria 640959
155 Ga0209129_1000078 3300025258 Bacteria 192880
156 Ga0209565_1000183 3300025263 Bacteria 76983
157 Ga0209673_1001961 3300025273 Bacteria 16105
158 Ga0209130_1000219 3300025284 Bacteria 74906
159 Ga0209676_1000049 3300025292 Bacteria 403210
160 Ga0209025_1000165 3300025294 Bacteria 164692
161 Ga0209025_1005461 3300025294 Bacteria 10356
162 Ga0209564_1007182 3300025295 Bacteria 5806
163 Ga0209758_1000105 3300025297 Bacteria 221415
164 Ga0209758_1004255 3300025297 Bacteria 12107
165 Ga0207426_1000075 3300025302 Bacteria 321337
166 Ga0207426_1000107 3300025302 Bacteria 242623
167 Ga0209051_1000968 3300025303 Bacteria 28047
168 Ga0207696_1000001 3300025711 Bacteria 2579611
169 Ga0207696_1000004 3300025711 Bacteria 671626
170 Ga0207696_1000066 3300025711 Bacteria 231203
171 Ga0207696_1000196 3300025711 Bacteria 93398
172 Ga0207696_1000336 3300025711 Bacteria 48964
173 Ga0207696_1000744 3300025711 Bacteria 21746
174 Ga0207696_1000788 3300025711 Bacteria 20764
175 Ga0207696_1001814 3300025711 Bacteria 10997
176 Ga0207696_1002238 3300025711 Bacteria 9655
177 Ga0207696_1005314 3300025711 Bacteria 5361
178 Ga0207655_1000017 3300025728 Bacteria 544403
179 Ga0207655_1000024 3300025728 Bacteria 459774
180 Ga0207655_1000026 3300025728 Bacteria 445528
181 Ga0207655_1000071 3300025728 Bacteria 237394
182 Ga0207655_1000090 3300025728 Bacteria 203398
183 Ga0207655_1000428 3300025728 Bacteria 56615
184 Ga0207655_1000436 3300025728 Bacteria 55864
185 Ga0207655_1001219 3300025728 Bacteria 24788
186 Ga0207655_1001463 3300025728 Bacteria 21816
187 Ga0207655_1002123 3300025728 Bacteria 16572
188 Ga0207655_1003013 3300025728 Bacteria 12894
189 Ga0207655_1006908 3300025728 Bacteria 7445
190 Ga0207655_1016611 3300025728 Bacteria 4016
191 Ga0207713_1000007 3300025735 Bacteria 564979
192 Ga0207713_1000018 3300025735 Bacteria 362635
193 Ga0207713_1000022 3300025735 Bacteria 351775
194 Ga0207713_1000048 3300025735 Bacteria 228272
195 Ga0207713_1000057 3300025735 Bacteria 217090
196 Ga0207713_1000164 3300025735 Bacteria 98195
197 Ga0207713_1000825 3300025735 Bacteria 28675
198 Ga0207713_1005123 3300025735 Bacteria 8293
199 Ga0207713_1009786 3300025735 Bacteria 5370
200 Ga0207713_1011818 3300025735 Bacteria 4713
201 Ga0207692_10002792 3300025898 Bacteria 6743
202 Ga0207710_10000097 3300025900 Bacteria 116024
203 Ga0207680_10004707 3300025903 Bacteria 6486
204 Ga0207705_10000125 3300025909 Bacteria 84812
205 Ga0207705_10001945 3300025909 Bacteria 16150
206 Ga0207705_10004753 3300025909 Bacteria 10229
207 Ga0207705_10006069 3300025909 Bacteria 8989
208 Ga0207705_10021506 3300025909 Bacteria 4604
209 Ga0207654_10000004 3300025911 Bacteria 902334
210 Ga0207707_10073357 3300025912 Bacteria 2984
211 Ga0207695_10032500 3300025913 Bacteria 5709
212 Ga0207671_10056971 3300025914 Bacteria 2896
213 Ga0207657_10000167 3300025919 Bacteria 67075
214 Ga0207657_10000649 3300025919 Bacteria 36992
215 Ga0207657_10004398 3300025919 Bacteria 14907
216 Ga0207657_10006638 3300025919 Bacteria 11976
217 Ga0207652_10003204 3300025921 Bacteria 13599
218 Ga0207681_10053591 3300025923 Bacteria 2739
219 Ga0207694_10012457 3300025924 Bacteria 6411
220 Ga0207650_10018771 3300025925 Bacteria 4856
221 Ga0207644_10036485 3300025931 Bacteria 3452
222 Ga0207709_10001680 3300025935 Bacteria 14910
223 Ga0207667_10003701 3300025949 Bacteria 18852
224 Ga0207667_10039475 3300025949 Bacteria 5031
225 Ga0207667_10060046 3300025949 Bacteria 3980
226 Ga0207668_10001235 3300025972 Bacteria 15216
227 Ga0207640_10008631 3300025981 Bacteria 5664
228 Ga0207658_10005727 3300025986 Bacteria 8495
229 Ga0207658_10013945 3300025986 Bacteria 5500
230 Ga0207678_10001078 3300026067 Bacteria 24989
231 Ga0207678_10006331 3300026067 Bacteria 10511
232 Ga0207641_10000108 3300026088 Bacteria 121144
233 Ga0207641_10000778 3300026088 Bacteria 34089
234 Ga0207674_10000009 3300026116 Bacteria 202730
235 Ga0209281_1000003 3300027111 Bacteria 1260089
236 Ga0209281_1000058 3300027111 Bacteria 300244
237 Ga0209281_1000060 3300027111 Bacteria 295683
238 Ga0209281_1000137 3300027111 Bacteria 182134
239 Ga0209281_1000146 3300027111 Bacteria 169237
240 Ga0209281_1000298 3300027111 Bacteria 90323
241 Ga0209281_1000891 3300027111 Bacteria 25418
242 Ga0209281_1002689 3300027111 Bacteria 6715
243 Ga0209371_1000014 3300027312 Bacteria 661118
244 Ga0209371_1000030 3300027312 Bacteria 423605
245 Ga0209371_1000069 3300027312 Bacteria 207967
246 Ga0209371_1000083 3300027312 Bacteria 184176
247 Ga0209371_1000088 3300027312 Bacteria 174446
248 Ga0209371_1000203 3300027312 Bacteria 85883
249 Ga0209371_1000300 3300027312 Bacteria 55324
250 Ga0209371_1000358 3300027312 Bacteria 49256
251 Ga0209371_1001468 3300027312 Bacteria 15875
252 Ga0209371_1002057 3300027312 Bacteria 12021
253 Ga0209371_1002708 3300027312 Bacteria 9568
254 Ga0209371_1002824 3300027312 Bacteria 9233
255 Ga0209371_1005268 3300027312 Bacteria 5212
256 Ga0209371_1006184 3300027312 Bacteria 4515
257 Ga0209371_1007606 3300027312 Bacteria 3743
258 Ga0268266_10000307 3300028379 Bacteria 77625
259 Ga0268264_10000057 3300028381 Bacteria 309824
260 Ga0268264_10006959 3300028381 Bacteria 9494
261 Ga0307515_10010448 3300028794 Bacteria 17785
262 Ga0268256_1000012 3300030500 Bacteria 794553
263 Ga0268256_1000021 3300030500 Bacteria 542735
264 Ga0268256_1000025 3300030500 Bacteria 484317
265 Ga0268256_1000066 3300030500 Bacteria 199115
266 Ga0268256_1000074 3300030500 Bacteria 184102
267 Ga0268256_1000079 3300030500 Bacteria 174445
268 Ga0268256_1000304 3300030500 Bacteria 49256
269 Ga0268256_1000500 3300030500 Bacteria 33290
270 Ga0268256_1001251 3300030500 Bacteria 15875
271 Ga0268256_1001805 3300030500 Bacteria 12054
272 Ga0268256_1001832 3300030500 Bacteria 11916
273 Ga0268256_1002261 3300030500 Bacteria 10039
274 Ga0268256_1002409 3300030500 Bacteria 9568
275 Ga0268256_1005553 3300030500 Bacteria 4918
276 Ga0268256_1006374 3300030500 Bacteria 4402
277 Ga0307513_10091632 3300031456 Bacteria 3097
278 Ga0307408_100030669 3300031548 Bacteria 3736
279 Ga0307412_10000340 3300031911 Bacteria 29344
280 Ga0395899_0000523 3300037312 Bacteria 42229
281 Ga0395899_0016737 3300037312 Bacteria 5590
282 Ga0395900_0000547 3300037418 Bacteria 52367
283 Ga0395900_0016693 3300037418 Bacteria 7489
284 Ga0395900_0036454 3300037418 Bacteria 5071
285 Ga0395900_0039915 3300037418 Bacteria 4837
286 Ga0395900_0097984 3300037418 Bacteria 3012
287 Ga0395898_0009593 3300037466 Bacteria 10164
288 Ga0395898_0015058 3300037466 Bacteria 7939
289 Ga0395905_0000017 3300037471 Bacteria 376619
290 Ga0395905_0001088 3300037471 Bacteria 34174
291 Ga0395905_0014257 3300037471 Bacteria 7593
292 Ga0395905_0039187 3300037471 Bacteria 4445
293 Ga0436364_1266897 3300037853 Bacteria 4037
294 Ga0395901_0000390 3300038443 Bacteria 52341
295 Ga0395901_0000957 3300038443 Bacteria 31439
296 Ga0395901_0081727 3300038443 Bacteria 3375
297 Ga0436365_0084998 3300039437 Bacteria 507888
298 Ga0436361_0251636 3300039447 Bacteria 6103
299 Ga0439436_0000002 3300041404 Bacteria 248787
300 Ga0439438_003314 3300041405 Bacteria 6560
301 Ga0439447_006302 3300041407 Bacteria 3861
302 Ga0439466_0000002 3300041411 Bacteria 494198
303 Ga0439466_0011564 3300041411 Bacteria 3264
304 Ga0439465_0000242 3300041413 Bacteria 14969
305 Ga0451800_0435313 3300041459 Bacteria 6615
306 Ga0439432_002447 3300042006 Bacteria 6987
307 Ga0439452_000004 3300042010 Bacteria 764268
308 Ga0439452_000005 3300042010 Bacteria 646919
309 Ga0439452_000007 3300042010 Bacteria 613625
310 Ga0439452_000074 3300042010 Bacteria 88357
311 Ga0439452_000407 3300042010 Bacteria 25286
312 Ga0439463_001800 3300042016 Bacteria 5580
313 Ga0450907_000011 3300042146 Bacteria 90100
314 Ga0439458_0000027 3300042157 Bacteria 23048
315 Ga0466981_0000042 3300044669 Bacteria 40532
316 Ga0466970_0027846 3300044765 Bacteria 2967
317 Ga0466959_0002314 3300045049 Bacteria 12152
318 Ga0466958_0000376 3300045836 Bacteria 18142
319 Ga0495627_000080 3300046453 Bacteria 117310
320 Ga0495627_000654 3300046453 Bacteria 26690
321 Ga0495591_000010 3300046458 Bacteria 327794
322 Ga0495591_000047 3300046458 Bacteria 140371
323 Ga0495591_004634 3300046458 Bacteria 6623
324 Ga0495591_014790 3300046458 Bacteria 2787
325 Ga0495638_0000230 3300046460 Bacteria 76565
326 Ga0495638_0001674 3300046460 Bacteria 19617
327 Ga0495638_0002962 3300046460 Bacteria 13549
328 Ga0495638_0028672 3300046460 Bacteria 3592
329 Ga0495650_0000028 3300046471 Bacteria 473012
330 Ga0495650_0000033 3300046471 Bacteria 412188
331 Ga0495650_0000052 3300046471 Bacteria 318176
332 Ga0495650_0000076 3300046471 Bacteria 250205
333 Ga0495650_0000207 3300046471 Bacteria 127568
334 Ga0495650_0013321 3300046471 Bacteria 4355
335 Ga0495605_0000172 3300046474 Bacteria 81898
336 Ga0495605_0028918 3300046474 Bacteria 2857
337 Ga0495584_0001391 3300046491 Bacteria 14572
338 Ga0495596_0000117 3300046500 Bacteria 54473
339 Ga0495596_0000819 3300046500 Bacteria 18825
340 Ga0495596_0002833 3300046500 Bacteria 9062
341 Ga0495607_0000055 3300046501 Bacteria 113745
342 Ga0495607_0000843 3300046501 Bacteria 29011
343 Ga0495607_0019784 3300046501 Bacteria 4270
344 Ga0495607_0019909 3300046501 Bacteria 4252
345 Ga0495607_0020856 3300046501 Bacteria 4131
346 Ga0495583_0000025 3300046506 Bacteria 263775
347 Ga0495583_0002683 3300046506 Bacteria 14803
348 Ga0495606_0000408 3300046507 Bacteria 72620
349 Ga0495610_0000140 3300046512 Bacteria 80219
350 Ga0495610_0000909 3300046512 Bacteria 27543
351 Ga0495610_0009729 3300046512 Bacteria 6045
352 Ga0495610_0009855 3300046512 Bacteria 5983
353 Ga0495616_0000105 3300046513 Bacteria 72439
354 Ga0495616_0000472 3300046513 Bacteria 30546
355 Ga0495620_0000130 3300046515 Bacteria 60876
356 Ga0495628_0004371 3300046516 Bacteria 12536
357 Ga0495632_0008900 3300046519 Bacteria 6100
358 Ga0495637_0000021 3300046520 Bacteria 179141
359 Ga0495643_0026206 3300046522 Bacteria 3291
360 Ga0495648_0001149 3300046524 Bacteria 26782
361 Ga0495648_0007259 3300046524 Bacteria 8894
362 Ga0495648_0009800 3300046524 Bacteria 7370
363 Ga0495654_0000016 3300046530 Bacteria 306416
364 Ga0495654_0000036 3300046530 Bacteria 191434
365 Ga0495654_0000066 3300046530 Bacteria 126103
366 Ga0495654_0000269 3300046530 Bacteria 47182
367 Ga0495654_0000403 3300046530 Bacteria 36993
368 Ga0495654_0001424 3300046530 Bacteria 16488
369 Ga0495654_0003502 3300046530 Bacteria 9586
370 Ga0495609_0000214 3300046538 Bacteria 57759
371 Ga0495609_0001085 3300046538 Bacteria 18960
372 Ga0495609_0002990 3300046538 Bacteria 9990
373 Ga0495597_0000400 3300046542 Bacteria 37496
374 Ga0495668_0011826 3300046616 Bacteria 5202
375 Ga0495668_0034050 3300046616 Bacteria 2860
376 Ga0495625_0000242 3300046660 Bacteria 85764
377 Ga0495625_0001519 3300046660 Bacteria 27775
378 Ga0495625_0006044 3300046660 Bacteria 10871
379 Ga0495625_0031300 3300046660 Bacteria 3959
380 Ga0495661_0000001 3300046665 Bacteria 898372
381 Ga0495671_0001136 3300046692 Bacteria 18331
382 Ga0495649_0004124 3300046694 Bacteria 9543
383 Ga0495589_0000044 3300046794 Bacteria 125396
384 Ga0495589_0000982 3300046794 Bacteria 17349
385 Ga0495589_0004264 3300046794 Bacteria 7647
386 Ga0495660_0000006 3300046810 Bacteria 571713
387 Ga0495660_0000011 3300046810 Bacteria 361397
388 Ga0495660_0000214 3300046810 Bacteria 59333
389 Ga0495672_0000004 3300047320 Bacteria 631810
390 Ga0495672_0000049 3300047320 Bacteria 240851
391 Ga0495672_0000103 3300047320 Bacteria 136164
392 Ga0495672_0001651 3300047320 Bacteria 21680
393 Ga0495687_000005 3300047443 Bacteria 610401
394 Ga0495679_000131 3300047446 Bacteria 66495
395 Ga0495679_000446 3300047446 Bacteria 30495
396 Ga0495679_006138 3300047446 Bacteria 5230
397 Ga0495673_0000023 3300047469 Bacteria 539904
398 Ga0495673_0000047 3300047469 Bacteria 266522
399 Ga0495673_0000223 3300047469 Bacteria 84150
400 Ga0495673_0003725 3300047469 Bacteria 9903
401 Ga0495673_0009620 3300047469 Bacteria 5331
402 Ga0495681_0000730 3300047470 Bacteria 25245
403 Ga0495681_0010459 3300047470 Bacteria 5616
404 Ga0495686_0000002 3300047472 Bacteria 1050777
405 Ga0495686_0000062 3300047472 Bacteria 235234
406 Ga0495686_0033118 3300047472 Bacteria 3339
407 Ga0495602_0006433 3300048088 Bacteria 12313
408 Ga0495626_0000010 3300048091 Bacteria 270265
409 Ga0495626_0000044 3300048091 Bacteria 165533
410 Ga0496100_0000034 3300048903 Bacteria 98593
411 Ga0496101_0000097 3300048904 Bacteria 91033
412 Ga0496101_0000322 3300048904 Bacteria 33112
413 Ga0496102_0000581 3300048905 Bacteria 38737
414 Ga0496102_0003076 3300048905 Bacteria 14131
415 Ga0496102_0075337 3300048905 Bacteria 3102
416 Ga0496103_0000283 3300048906 Bacteria 47857
417 Ga0496104_0001075 3300048907 Bacteria 23321
418 Ga0496104_0011249 3300048907 Bacteria 8008
419 Ga0496105_0000759 3300048908 Bacteria 21932
420 Ga0496106_0000211 3300048909 Bacteria 40794
421 Ga0496112_0018189 3300048915 Bacteria 6614
422 Ga0496113_0001180 3300048916 Bacteria 14288
423 Ga0496116_0000001 3300048919 Bacteria 1501681
424 Ga0496116_0000020 3300048919 Bacteria 501307
425 Ga0496116_0000103 3300048919 Bacteria 193529
426 Ga0496116_0000313 3300048919 Bacteria 80682
427 Ga0496116_0003610 3300048919 Bacteria 15220
428 Ga0496117_0000078 3300048920 Bacteria 227068
429 Ga0496117_0000116 3300048920 Bacteria 178919
430 Ga0496117_0000240 3300048920 Bacteria 103752
431 Ga0496117_0000259 3300048920 Bacteria 99638
432 Ga0496117_0000753 3300048920 Bacteria 51060
433 Ga0496117_0002204 3300048920 Bacteria 25295
434 Ga0496117_0002602 3300048920 Bacteria 22435
435 Ga0496117_0005380 3300048920 Bacteria 13481
436 Ga0496117_0017288 3300048920 Bacteria 6030
437 Ga0496118_0000059 3300048921 Bacteria 226336
438 Ga0496118_0000143 3300048921 Bacteria 126057
439 Ga0496118_0000200 3300048921 Bacteria 105546
440 Ga0496118_0001665 3300048921 Bacteria 32618
441 Ga0496118_0003296 3300048921 Bacteria 20511
442 Ga0496118_0057086 3300048921 Bacteria 2929
443 Ga0496119_0000043 3300048922 Bacteria 192373
444 Ga0496119_0000118 3300048922 Bacteria 110788
445 Ga0496119_0000171 3300048922 Bacteria 91583
446 Ga0496119_0000195 3300048922 Bacteria 85376
447 Ga0496119_0000216 3300048922 Bacteria 82190
448 Ga0496119_0000460 3300048922 Bacteria 55698
449 Ga0496119_0001623 3300048922 Bacteria 26589
450 Ga0496119_0004405 3300048922 Bacteria 14038
451 Ga0496119_0005874 3300048922 Bacteria 11584
452 Ga0496119_0007240 3300048922 Bacteria 10041
453 Ga0496119_0008294 3300048922 Bacteria 9161
454 Ga0496119_0009873 3300048922 Bacteria 8108
455 Ga0496119_0023474 3300048922 Bacteria 4371
456 Ga0496119_0025850 3300048922 Bacteria 4088
457 Ga0496119_0032197 3300048922 Bacteria 3499
458 Ga0496120_0000009 3300048923 Bacteria 386727
459 Ga0496120_0000043 3300048923 Bacteria 195584
460 Ga0496120_0000068 3300048923 Bacteria 166108
461 Ga0496120_0000119 3300048923 Bacteria 132692
462 Ga0496120_0000158 3300048923 Bacteria 112600
463 Ga0496120_0000205 3300048923 Bacteria 101562
464 Ga0496120_0000303 3300048923 Bacteria 82190
465 Ga0496120_0005662 3300048923 Bacteria 9877
466 Ga0496120_0005982 3300048923 Bacteria 9478
467 Ga0496120_0006300 3300048923 Bacteria 9143
468 Ga0496120_0028960 3300048923 Bacteria 3386
469 Ga0496120_0032932 3300048923 Bacteria 3118
470 Ga0496120_0040333 3300048923 Bacteria 2744
471 Ga0496121_0000052 3300048924 Bacteria 313410
472 Ga0496121_0000180 3300048924 Bacteria 141128
473 Ga0496121_0001345 3300048924 Bacteria 41995
474 Ga0496121_0003375 3300048924 Bacteria 22882
475 Ga0496121_0004462 3300048924 Bacteria 18797
476 Ga0496121_0005686 3300048924 Bacteria 15852
477 Ga0496121_0018475 3300048924 Bacteria 7028
478 Ga0496121_0022093 3300048924 Bacteria 6192
479 Ga0496121_0025755 3300048924 Bacteria 5568
480 Ga0496121_0030181 3300048924 Bacteria 4985
481 Ga0496122_0000010 3300048925 Bacteria 547417
482 Ga0496122_0000172 3300048925 Bacteria 153862
483 Ga0496122_0000205 3300048925 Bacteria 131755
484 Ga0496122_0000419 3300048925 Bacteria 89990
485 Ga0496122_0001219 3300048925 Bacteria 43601
486 Ga0496122_0001490 3300048925 Bacteria 37513
487 Ga0496122_0003808 3300048925 Bacteria 19409
488 Ga0496122_0010077 3300048925 Bacteria 9810
489 Ga0496122_0053560 3300048925 Bacteria 3040
490 Ga0496123_0000025 3300048926 Bacteria 323956
491 Ga0496123_0000103 3300048926 Bacteria 168232
492 Ga0496123_0000132 3300048926 Bacteria 153568
493 Ga0496123_0000467 3300048926 Bacteria 70890
494 Ga0496123_0000746 3300048926 Bacteria 52614
495 Ga0496123_0001312 3300048926 Bacteria 35262
496 Ga0496123_0001433 3300048926 Bacteria 33269
497 Ga0496123_0001891 3300048926 Bacteria 27317
498 Ga0496123_0007291 3300048926 Bacteria 10493
499 Ga0496123_0012607 3300048926 Bacteria 7187
500 Ga0496123_0030588 3300048926 Bacteria 3938
501 Ga0496123_0047645 3300048926 Bacteria 2892
502 Ga0496124_0000008 3300048927 Bacteria 864372
503 Ga0496124_0000084 3300048927 Bacteria 204993
504 Ga0496124_0000142 3300048927 Bacteria 147311
505 Ga0496124_0002240 3300048927 Bacteria 25725
506 Ga0496124_0002318 3300048927 Bacteria 25111
507 Ga0496124_0009339 3300048927 Bacteria 10104
508 Ga0496124_0013508 3300048927 Bacteria 7966
509 Ga0496124_0014745 3300048927 Bacteria 7543
510 Ga0496124_0019582 3300048927 Bacteria 6289
511 Ga0496124_0022785 3300048927 Bacteria 5733
512 Ga0496124_0069402 3300048927 Bacteria 2926
513 Ga0496124_0070398 3300048927 Bacteria 2901
514 Ga0496125_0000071 3300048928 Bacteria 243580
515 Ga0496125_0000523 3300048928 Bacteria 66602
516 Ga0496125_0000879 3300048928 Bacteria 47630
517 Ga0496125_0002656 3300048928 Bacteria 22857
518 Ga0496125_0004036 3300048928 Bacteria 17210
519 Ga0496125_0016546 3300048928 Bacteria 7075
520 Ga0496125_0026964 3300048928 Bacteria 5216
521 Ga0496125_0057962 3300048928 Bacteria 3131
522 Ga0496126_0002156 3300048929 Bacteria 27382
523 Ga0496126_0002622 3300048929 Bacteria 23930
524 Ga0496126_0003996 3300048929 Bacteria 18008
525 Ga0496126_0031606 3300048929 Bacteria 4997
526 Ga0495678_000919 3300049459 Bacteria 25836
527 Ga0495678_001870 3300049459 Bacteria 15328
528 Ga0495678_002923 3300049459 Bacteria 10944
529 Ga0495678_004196 3300049459 Bacteria 8480
530 Ga0495682_0000004 3300049460 Bacteria 378337
531 Ga0495682_0000030 3300049460 Bacteria 139542
532 Ga0501033_0001127 3300049570 Bacteria 24200
533 Ga0501034_0001623 3300049571 Bacteria 29167
534 nmdc:mga00v17_1002_c1 3300050491 Bacteria 15107
535 Ga0500618_000022 3300053125 Bacteria 157907
536 Ga0500621_000001 3300053126 Bacteria 1049698
537 Ga0500658_0001096 3300053134 Bacteria 11076
538 Ga0500559_0000054 3300053136 Bacteria 90695
539 Ga0500577_0000488 3300053142 Bacteria 10188
540 Ga0500616_0001886 3300053153 Bacteria 18870
541 Ga0500645_003613 3300053730 Bacteria 6193
542 Ga0500609_000550 3300053731 Bacteria 5666

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2510917020 2511122324 605
2 3300037471 Ga0395905_0039187 Ga0395905_0039187_2371_4389 612
3 3300046522 Ga0495643_0026206 Ga0495643_0026206_1136_3157 614
4 3300046501 Ga0495607_0019784 Ga0495607_0019784_1355_3763 619
5 3300046501 Ga0495607_0020856 Ga0495607_0020856_1887_3923 619
6 3300048927 Ga0496124_0022785 Ga0496124_0022785_28_2052 635
7 iso_pu_bacteria 2921643360 2921648527 640
8 3300037471 Ga0395905_0001088 Ga0395905_0001088_4988_7318 645
9 3300005844 Ga0068862_100003598 Ga0068862_1000035984 658
10 3300002987 JGI25159J45721_1000158 JGI25159J45721_100015824 659
11 3300003354 JGI25160J50197_1000026 JGI25160J50197_100002638 659
12 3300003374 JGI25161J50226_1000014 JGI25161J50226_1000014152 659
13 3300004625 Ga0055543_1000079 Ga0055543_100007950 659
14 3300005262 Ga0065165_1000073 Ga0065165_1000073129 659
15 3300025284 Ga0209130_1000219 Ga0209130_100021946 659
16 3300025302 Ga0207426_1000075 Ga0207426_1000075168 659
17 3300048905 Ga0496102_0003076 Ga0496102_0003076_27_2135 663
18 3300048929 Ga0496126_0003996 Ga0496126_0003996_5199_7544 663
19 3300048927 Ga0496124_0009339 Ga0496124_0009339_2717_5062 666
20 3300053142 Ga0500577_0000488 Ga0500577_0000488_5087_7498 670
21 3300005335 Ga0070666_10004464 Ga0070666_100044645 671
22 3300005355 Ga0070671_100020359 Ga0070671_1000203592 671
23 3300005367 Ga0070667_100030572 Ga0070667_1000305722 671
24 3300005455 Ga0070663_100009620 Ga0070663_1000096202 671
25 3300005539 Ga0068853_100014777 Ga0068853_1000147773 671
26 3300005563 Ga0068855_100020431 Ga0068855_1000204313 671
27 3300005614 Ga0068856_100006394 Ga0068856_1000063943 671
28 3300005841 Ga0068863_100000102 Ga0068863_10000010212 671
29 3300005841 Ga0068863_100007662 Ga0068863_1000076623 671
30 3300005843 Ga0068860_100000118 Ga0068860_10000011812 671
31 3300005843 Ga0068860_100006572 Ga0068860_1000065723 671
32 3300009093 Ga0105240_10016814 Ga0105240_100168143 671
33 3300009174 Ga0105241_10005445 Ga0105241_100054452 671
34 3300009545 Ga0105237_10006003 Ga0105237_100060032 671
35 3300009551 Ga0105238_10006413 Ga0105238_100064133 671
36 3300010375 Ga0105239_10019954 Ga0105239_100199543 671
37 3300014968 Ga0157379_10060587 Ga0157379_100605872 671
38 3300025903 Ga0207680_10004707 Ga0207680_100047073 671
39 3300025913 Ga0207695_10032500 Ga0207695_100325003 671
40 3300025924 Ga0207694_10012457 Ga0207694_100124573 671
41 3300025931 Ga0207644_10036485 Ga0207644_100364852 671
42 3300025949 Ga0207667_10039475 Ga0207667_100394752 671
43 3300025986 Ga0207658_10005727 Ga0207658_100057273 671
44 3300025986 Ga0207658_10013945 Ga0207658_100139453 671
45 3300026067 Ga0207678_10006331 Ga0207678_100063313 671
46 3300026088 Ga0207641_10000108 Ga0207641_1000010893 671
47 3300026088 Ga0207641_10000778 Ga0207641_1000077824 671
48 3300028381 Ga0268264_10000057 Ga0268264_10000057257 671
49 3300028381 Ga0268264_10006959 Ga0268264_100069596 671
50 3300046500 Ga0495596_0000117 Ga0495596_0000117_37603_39996 675
51 3300046519 Ga0495632_0008900 Ga0495632_0008900_2196_4589 675
52 3300046538 Ga0495609_0002990 Ga0495609_0002990_4123_6516 675
53 3300046501 Ga0495607_0000843 Ga0495607_0000843_22238_24538 678
54 3300002773 JGI25152J39213_1002116 JGI25152J39213_10021163 681
55 3300003187 JGI25151J46595_10004852 JGI25151J46595_100048524 681
56 3300005327 Ga0070658_10003669 Ga0070658_100036693 681
57 3300005331 Ga0070670_100007809 Ga0070670_1000078092 681
58 3300005563 Ga0068855_100000079 Ga0068855_10000007958 681
59 3300025258 Ga0209129_1000078 Ga0209129_1000078171 681
60 3300025294 Ga0209025_1000165 Ga0209025_1000165122 681
61 3300025909 Ga0207705_10000125 Ga0207705_100001259 681
62 3300025919 Ga0207657_10000167 Ga0207657_1000016756 681
63 3300025925 Ga0207650_10018771 Ga0207650_100187713 681
64 3300025949 Ga0207667_10003701 Ga0207667_1000370111 681
65 3300013102 Ga0157371_10000261 Ga0157371_1000026157 682
66 3300013104 Ga0157370_10022912 Ga0157370_100229124 682
67 3300005347 Ga0070668_100011814 Ga0070668_1000118143 685
68 3300005353 Ga0070669_100029404 Ga0070669_1000294041 685
69 3300009545 Ga0105237_10041079 Ga0105237_100410793 685
70 3300014497 Ga0182008_10006961 Ga0182008_100069613 685
71 3300015261 Ga0182006_1000200 Ga0182006_100020045 685
72 3300025923 Ga0207681_10053591 Ga0207681_100535911 685
73 3300025972 Ga0207668_10001235 Ga0207668_100012356 685
74 3300041404 Ga0439436_0000002 Ga0439436_0000002_88364_90709 685
75 3300046512 Ga0495610_0000909 Ga0495610_0000909_17109_19454 685
76 3300048922 Ga0496119_0032197 Ga0496119_0032197_72_2417 685
77 3300049571 Ga0501034_0001623 Ga0501034_0001623_14883_17291 685
78 3300025728 Ga0207655_1016611 Ga0207655_10166112 687
79 3300046506 Ga0495583_0002683 Ga0495583_0002683_6333_8669 687
80 3300048920 Ga0496117_0002204 Ga0496117_0002204_18257_20602 687
81 3300048923 Ga0496120_0006300 Ga0496120_0006300_54_2219 687
82 3300048925 Ga0496122_0000205 Ga0496122_0000205_117981_120326 687
83 3300048926 Ga0496123_0000103 Ga0496123_0000103_117981_120326 687
84 3300048928 Ga0496125_0000879 Ga0496125_0000879_14408_16753 687
85 3300048928 Ga0496125_0057962 Ga0496125_0057962_27_2192 687
86 3300009036 Ga0105244_10003875 Ga0105244_1000387510 688
87 3300049459 Ga0495678_002923 Ga0495678_002923_7377_9800 688
88 3300028794 Ga0307515_10010448 Ga0307515_100104481 689
89 3300044765 Ga0466970_0027846 Ga0466970_0027846_234_2600 690
90 3300049459 Ga0495678_004196 Ga0495678_004196_933_3359 690
91 3300041413 Ga0439465_0000242 Ga0439465_0000242_4464_6788 691
92 3300046538 Ga0495609_0001085 Ga0495609_0001085_9622_12015 691
93 3300046810 Ga0495660_0000214 Ga0495660_0000214_9615_12008 691
94 3300031456 Ga0307513_10091632 Ga0307513_100916322 693
95 3300042157 Ga0439458_0000027 Ga0439458_0000027_499_2883 693
96 3300002075 JGI24738J21930_10001231 JGI24738J21930_100012315 694
97 3300031911 Ga0307412_10000340 Ga0307412_100003406 694
98 3300046530 Ga0495654_0000269 Ga0495654_0000269_34586_36979 694
99 3300046453 Ga0495627_000654 Ga0495627_000654_10778_13189 695
100 3300046516 Ga0495628_0004371 Ga0495628_0004371_151_2562 695
101 3300046794 Ga0495589_0000982 Ga0495589_0000982_11727_14138 695
102 3300048925 Ga0496122_0000172 Ga0496122_0000172_7707_10049 695
103 3300048926 Ga0496123_0000132 Ga0496123_0000132_7755_10097 695
104 3300048927 Ga0496124_0069402 Ga0496124_0069402_520_2862 695
105 3300006051 Ga0075364_10002151 Ga0075364_100021513 697
106 3300025297 Ga0209758_1000105 Ga0209758_1000105125 697
107 3300046460 Ga0495638_0000230 Ga0495638_0000230_49757_52120 697
108 3300047470 Ga0495681_0010459 Ga0495681_0010459_587_2935 698
109 3300048924 Ga0496121_0000180 Ga0496121_0000180_101566_103935 698
110 3300003790 Ga0055528_1005383 Ga0055528_10053834 699
111 3300025294 Ga0209025_1005461 Ga0209025_10054618 699
112 3300045836 Ga0466958_0000376 Ga0466958_0000376_11356_13704 699
113 3300046460 Ga0495638_0002962 Ga0495638_0002962_7409_9772 699
114 3300046513 Ga0495616_0000105 Ga0495616_0000105_62857_65220 699
115 3300050491 nmdc:mga00v17_1002_c1 nmdc:mga00v17_1002_c1_11839_14217 699
116 3300006946 Ga0079104_1000406 Ga0079104_100040610 700
117 3300027111 Ga0209281_1000060 Ga0209281_100006035 700
118 3300003323 rootH1_10041198 rootH1_100411982 701
119 3300013306 Ga0163162_10008760 Ga0163162_1000876010 701
120 3300046530 Ga0495654_0001424 Ga0495654_0001424_1367_3775 701
121 3300047469 Ga0495673_0000223 Ga0495673_0000223_23923_26280 701
122 3300047472 Ga0495686_0000002 Ga0495686_0000002_805278_807641 701
123 3300003792 Ga0055540_1001691 Ga0055540_10016917 702
124 iso_pu_bacteria 2842918807 2842921292 702
125 3300003790 Ga0055528_1009785 Ga0055528_10097852 703
126 3300003856 Ga0058692_1000033 Ga0058692_100003333 703
127 3300025263 Ga0209565_1000183 Ga0209565_100018315 703
128 3300025273 Ga0209673_1001961 Ga0209673_10019612 703
129 3300025292 Ga0209676_1000049 Ga0209676_1000049154 703
130 3300025297 Ga0209758_1004255 Ga0209758_10042558 703
131 3300027312 Ga0209371_1000088 Ga0209371_1000088103 703
132 3300030500 Ga0268256_1000079 Ga0268256_100007934 703
133 3300048925 Ga0496122_0053560 Ga0496122_0053560_469_2877 703
134 3300047472 Ga0495686_0000062 Ga0495686_0000062_56566_58980 704
135 3300049570 Ga0501033_0001127 Ga0501033_0001127_7685_10090 705
136 3300025728 Ga0207655_1000024 Ga0207655_1000024316 706
137 3300009036 Ga0105244_10015395 Ga0105244_100153953 707
138 3300046458 Ga0495591_004634 Ga0495591_004634_3968_6358 707
139 3300046471 Ga0495650_0000033 Ga0495650_0000033_111154_113544 707
140 3300046501 Ga0495607_0019909 Ga0495607_0019909_841_3231 707
141 3300046507 Ga0495606_0000408 Ga0495606_0000408_66167_68557 707
142 3300046530 Ga0495654_0000066 Ga0495654_0000066_97460_99835 707
143 3300046530 Ga0495654_0000403 Ga0495654_0000403_31561_33951 707
144 3300046692 Ga0495671_0001136 Ga0495671_0001136_11800_14190 707
145 3300046794 Ga0495589_0000044 Ga0495589_0000044_87111_89486 707
146 3300046794 Ga0495589_0004264 Ga0495589_0004264_2544_4934 707
147 3300046810 Ga0495660_0000011 Ga0495660_0000011_312762_315152 707
148 3300047320 Ga0495672_0000004 Ga0495672_0000004_266812_269202 707
149 3300047469 Ga0495673_0000023 Ga0495673_0000023_182198_184588 707
150 3300048922 Ga0496119_0004405 Ga0496119_0004405_5336_7738 707
151 3300048923 Ga0496120_0005662 Ga0496120_0005662_2291_4693 707
152 3300048926 Ga0496123_0012607 Ga0496123_0012607_4400_6802 707
153 3300048927 Ga0496124_0013508 Ga0496124_0013508_2249_4693 707
154 3300049459 Ga0495678_001870 Ga0495678_001870_750_3140 707
155 3300049460 Ga0495682_0000004 Ga0495682_0000004_309813_312203 707
156 3300049460 Ga0495682_0000030 Ga0495682_0000030_60372_62774 707
157 3300053126 Ga0500621_000001 Ga0500621_000001_396803_399193 707
158 3300037418 Ga0395900_0097984 Ga0395900_0097984_103_2430 708
159 3300046460 Ga0495638_0001674 Ga0495638_0001674_12281_14644 708
160 3300046512 Ga0495610_0000140 Ga0495610_0000140_74551_76914 708
161 3300046660 Ga0495625_0006044 Ga0495625_0006044_4159_6522 708
162 3300047320 Ga0495672_0001651 Ga0495672_0001651_1971_4334 708
163 3300047469 Ga0495673_0003725 Ga0495673_0003725_1695_4058 708
164 3300053134 Ga0500658_0001096 Ga0500658_0001096_127_2490 708
165 3300053730 Ga0500645_003613 Ga0500645_003613_2553_4916 708
166 3300053731 Ga0500609_000550 Ga0500609_000550_3160_5523 708
167 3300003794 Ga0055531_10001301 Ga0055531_1000130111 709
168 3300025303 Ga0209051_1000968 Ga0209051_100096820 709
169 3300025909 Ga0207705_10001945 Ga0207705_1000194510 709
170 3300025909 Ga0207705_10004753 Ga0207705_100047537 709
171 3300048091 Ga0495626_0000044 Ga0495626_0000044_99417_101855 709
172 3300037418 Ga0395900_0039915 Ga0395900_0039915_2490_4820 710
173 3300037466 Ga0395898_0009593 Ga0395898_0009593_5462_7792 710
174 3300046501 Ga0495607_0000055 Ga0495607_0000055_50017_52419 710
175 3300046512 Ga0495610_0009855 Ga0495610_0009855_1002_3416 710
176 3300046515 Ga0495620_0000130 Ga0495620_0000130_50940_53342 710
177 3300048922 Ga0496119_0000118 Ga0496119_0000118_90888_93260 710
178 3300048922 Ga0496119_0000195 Ga0496119_0000195_59462_61834 710
179 3300048923 Ga0496120_0000119 Ga0496120_0000119_91068_93440 710
180 3300048923 Ga0496120_0000205 Ga0496120_0000205_53586_55958 710
181 3300048927 Ga0496124_0000008 Ga0496124_0000008_802539_804911 710
182 3300005546 Ga0070696_100011207 Ga0070696_1000112074 711
183 3300015265 Ga0182005_1001039 Ga0182005_10010393 711
184 3300037312 Ga0395899_0016737 Ga0395899_0016737_285_2726 711
185 3300037418 Ga0395900_0016693 Ga0395900_0016693_4465_6906 711
186 3300037466 Ga0395898_0015058 Ga0395898_0015058_265_2706 711
187 3300038443 Ga0395901_0081727 Ga0395901_0081727_293_2734 711
188 3300001989 JGI24739J22299_10000116 JGI24739J22299_100001163 712
189 3300005578 Ga0068854_100006895 Ga0068854_1000068954 712
190 3300025949 Ga0207667_10060046 Ga0207667_100600462 712
191 3300025981 Ga0207640_10008631 Ga0207640_100086313 712
192 3300037312 Ga0395899_0000523 Ga0395899_0000523_37191_39521 712
193 3300048926 Ga0496123_0007291 Ga0496123_0007291_6520_8922 712
194 3300048927 Ga0496124_0002240 Ga0496124_0002240_18873_21275 712
195 3300048927 Ga0496124_0019582 Ga0496124_0019582_1052_3454 712
196 iso_pu_bacteria 2953994433 2953996535 712
197 3300048927 Ga0496124_0070398 Ga0496124_0070398_60_2303 713
198 3300046520 Ga0495637_0000021 Ga0495637_0000021_49364_51766 714
199 3300047443 Ga0495687_000005 Ga0495687_000005_211879_214296 714
200 3300005327 Ga0070658_10005410 Ga0070658_100054107 715
201 3300025909 Ga0207705_10021506 Ga0207705_100215062 715
202 3300025919 Ga0207657_10004398 Ga0207657_100043988 715
203 3300037418 Ga0395900_0000547 Ga0395900_0000547_40366_42741 715
204 3300038443 Ga0395901_0000390 Ga0395901_0000390_9601_11976 715
205 3300046530 Ga0495654_0003502 Ga0495654_0003502_4395_6806 715
206 3300046660 Ga0495625_0001519 Ga0495625_0001519_6768_9179 715
207 3300047446 Ga0495679_000131 Ga0495679_000131_14828_17239 715
208 3300048922 Ga0496119_0000216 Ga0496119_0000216_40403_42793 715
209 3300048923 Ga0496120_0000303 Ga0496120_0000303_40403_42793 715
210 3300005518 Ga0070699_100029582 Ga0070699_1000295822 716
211 3300005546 Ga0070696_100008769 Ga0070696_1000087694 716
212 3300009011 Ga0105251_10001143 Ga0105251_100011432 716
213 3300025898 Ga0207692_10002792 Ga0207692_100027922 716
214 3300031548 Ga0307408_100030669 Ga0307408_1000306693 716
215 3300048919 Ga0496116_0000313 Ga0496116_0000313_69003_71384 716
216 3300048922 Ga0496119_0000043 Ga0496119_0000043_128038_130419 716
217 3300048922 Ga0496119_0000460 Ga0496119_0000460_10681_13062 716
218 3300048923 Ga0496120_0000009 Ga0496120_0000009_270416_272797 716
219 3300048923 Ga0496120_0000043 Ga0496120_0000043_119477_121858 716
220 3300048926 Ga0496123_0001891 Ga0496123_0001891_7641_10109 716
221 3300009011 Ga0105251_10000203 Ga0105251_1000020329 717
222 3300009036 Ga0105244_10000262 Ga0105244_100002627 717
223 3300025735 Ga0207713_1000825 Ga0207713_10008254 717
224 3300027312 Ga0209371_1002057 Ga0209371_10020575 717
225 3300030500 Ga0268256_1001832 Ga0268256_10018325 717
226 3300046460 Ga0495638_0028672 Ga0495638_0028672_1178_3571 717
227 3300046471 Ga0495650_0013321 Ga0495650_0013321_1438_3831 717
228 3300046474 Ga0495605_0000172 Ga0495605_0000172_6083_8476 717
229 3300046491 Ga0495584_0001391 Ga0495584_0001391_1323_3719 717
230 3300046513 Ga0495616_0000472 Ga0495616_0000472_21271_23667 717
231 3300046616 Ga0495668_0011826 Ga0495668_0011826_1142_3538 717
232 3300046665 Ga0495661_0000001 Ga0495661_0000001_104186_106582 717
233 3300047469 Ga0495673_0009620 Ga0495673_0009620_2653_5049 717
234 3300047470 Ga0495681_0000730 Ga0495681_0000730_19570_21966 717
235 3300053153 Ga0500616_0001886 Ga0500616_0001886_2436_4835 717
236 3300003856 Ga0058692_1001342 Ga0058692_10013422 718
237 3300009011 Ga0105251_10000594 Ga0105251_100005941 718
238 3300009092 Ga0105250_10002764 Ga0105250_100027642 718
239 3300009101 Ga0105247_10001981 Ga0105247_100019818 718
240 3300013100 Ga0157373_10014184 Ga0157373_100141842 718
241 3300017792 Ga0163161_10000001 Ga0163161_100000011954 718
242 3300025711 Ga0207696_1000001 Ga0207696_10000012014 718
243 3300025735 Ga0207713_1000022 Ga0207713_1000022284 718
244 3300025900 Ga0207710_10000097 Ga0207710_1000009773 718
245 3300027312 Ga0209371_1002824 Ga0209371_10028246 718
246 3300030500 Ga0268256_1000500 Ga0268256_100050034 718
247 3300046453 Ga0495627_000080 Ga0495627_000080_112031_114406 718
248 3300048919 Ga0496116_0000001 Ga0496116_0000001_1446022_1448397 718
249 3300048920 Ga0496117_0017288 Ga0496117_0017288_3036_5411 718
250 3300048922 Ga0496119_0023474 Ga0496119_0023474_938_3313 718
251 3300049459 Ga0495678_000919 Ga0495678_000919_12818_15214 718
252 iso_pu_bacteria 2643221545 2643750377 718
253 iso_pu_bacteria 2643221583 2643926944 718
254 iso_pu_bacteria 2643221691 2644507266 718
255 3300009092 Ga0105250_10000003 Ga0105250_10000003380 719
256 3300025711 Ga0207696_1000004 Ga0207696_1000004253 719
257 3300025711 Ga0207696_1000336 Ga0207696_100033617 719
258 iso_pu_bacteria 2891373044 2891376501 719
259 3300009011 Ga0105251_10000425 Ga0105251_1000042520 720
260 3300009036 Ga0105244_10001135 Ga0105244_100011356 720
261 3300009092 Ga0105250_10006600 Ga0105250_100066002 720
262 3300013100 Ga0157373_10001471 Ga0157373_100014716 720
263 3300013102 Ga0157371_10000944 Ga0157371_1000094418 720
264 3300013102 Ga0157371_10002063 Ga0157371_1000206312 720
265 3300013104 Ga0157370_10000120 Ga0157370_1000012023 720
266 3300025728 Ga0207655_1006908 Ga0207655_10069082 720
267 3300025735 Ga0207713_1005123 Ga0207713_10051232 720
268 3300037471 Ga0395905_0014257 Ga0395905_0014257_4872_7289 720
269 3300042006 Ga0439432_002447 Ga0439432_002447_3933_6323 720
270 3300042010 Ga0439452_000004 Ga0439452_000004_100899_103289 720
271 3300046458 Ga0495591_000010 Ga0495591_000010_158144_160651 720
272 3300046500 Ga0495596_0000819 Ga0495596_0000819_10202_12592 720
273 3300046530 Ga0495654_0000036 Ga0495654_0000036_91976_94483 720
274 3300046616 Ga0495668_0034050 Ga0495668_0034050_82_2589 720
275 3300048904 Ga0496101_0000097 Ga0496101_0000097_74631_77045 720
276 3300048919 Ga0496116_0000103 Ga0496116_0000103_89982_92372 720
277 3300048920 Ga0496117_0000259 Ga0496117_0000259_40654_43044 720
278 3300048921 Ga0496118_0003296 Ga0496118_0003296_1835_4225 720
279 3300048922 Ga0496119_0005874 Ga0496119_0005874_6063_8477 720
280 3300048923 Ga0496120_0000068 Ga0496120_0000068_154381_156795 720
281 3300048925 Ga0496122_0010077 Ga0496122_0010077_707_3121 720
282 3300048926 Ga0496123_0047645 Ga0496123_0047645_15_2429 720
283 3300048927 Ga0496124_0014745 Ga0496124_0014745_773_3163 720
284 3300041459 Ga0451800_0435313 Ga0451800_0435313_3912_6413 721
285 3300046471 Ga0495650_0000207 Ga0495650_0000207_73597_76014 721
286 3300046530 Ga0495654_0000016 Ga0495654_0000016_230589_233006 721
287 3300046660 Ga0495625_0031300 Ga0495625_0031300_746_3163 721
288 3300053136 Ga0500559_0000054 Ga0500559_0000054_28337_30748 721
289 3300046506 Ga0495583_0000025 Ga0495583_0000025_241715_244129 722
290 3300047446 Ga0495679_006138 Ga0495679_006138_2667_5081 722
291 3300053125 Ga0500618_000022 Ga0500618_000022_18019_20433 722
292 iso_pu_bacteria 2510917026 2511174367 722
293 iso_pu_bacteria 2585427633 2585997318 722
294 3300025914 Ga0207671_10056971 Ga0207671_100569712 723
295 iso_pu_bacteria 2585427591 2585828063 723
296 iso_pu_bacteria 8054844752 8054845652 723
297 3300002737 JGI25162J39368_1000010 JGI25162J39368_1000010296 724
298 3300002771 JGI25163J39215_1000005 JGI25163J39215_100000568 724
299 3300002772 JGI25164J39214_1000003 JGI25164J39214_100000369 724
300 3300003751 Ga0055538_1000009 Ga0055538_1000009296 724
301 3300003752 Ga0055539_1000013 Ga0055539_1000013296 724
302 3300003756 Ga0055533_1000017 Ga0055533_1000017296 724
303 3300003759 Ga0055525_1000019 Ga0055525_1000019296 724
304 3300003841 Ga0055541_1000010 Ga0055541_1000010296 724
305 3300005289 Ga0065704_10000982 Ga0065704_100009822 724
306 3300009092 Ga0105250_10001159 Ga0105250_100011599 724
307 3300013102 Ga0157371_10000761 Ga0157371_1000076114 724
308 3300025207 Ga0209760_100038 Ga0209760_10003826 724
309 3300025224 Ga0209784_100012 Ga0209784_100012291 724
310 3300025225 Ga0209566_100010 Ga0209566_100010291 724
311 3300025226 Ga0209674_100023 Ga0209674_100023291 724
312 3300025230 Ga0209563_100027 Ga0209563_100027291 724
313 3300025231 Ga0207427_100017 Ga0207427_100017291 724
314 3300025233 Ga0209437_100029 Ga0209437_100029291 724
315 3300025253 Ga0209677_100014 Ga0209677_100014291 724
316 3300025711 Ga0207696_1000788 Ga0207696_10007882 724
317 3300025728 Ga0207655_1000071 Ga0207655_100007137 724
318 3300025728 Ga0207655_1000428 Ga0207655_100042854 724
319 3300046471 Ga0495650_0000052 Ga0495650_0000052_296659_299058 724
320 3300046810 Ga0495660_0000006 Ga0495660_0000006_288715_291114 724
321 3300048907 Ga0496104_0011249 Ga0496104_0011249_2717_5116 724
322 3300048919 Ga0496116_0000020 Ga0496116_0000020_304674_307073 724
323 3300048921 Ga0496118_0057086 Ga0496118_0057086_108_2507 724
324 3300048922 Ga0496119_0025850 Ga0496119_0025850_1486_3885 724
325 3300048923 Ga0496120_0040333 Ga0496120_0040333_42_2441 724
326 3300048925 Ga0496122_0000010 Ga0496122_0000010_516904_519303 724
327 3300048926 Ga0496123_0000025 Ga0496123_0000025_21204_23603 724
328 3300048927 Ga0496124_0000084 Ga0496124_0000084_196644_199043 724
329 3300048928 Ga0496125_0000071 Ga0496125_0000071_206890_209289 724
330 3300025909 Ga0207705_10006069 Ga0207705_100060693 725
331 3300038443 Ga0395901_0000957 Ga0395901_0000957_26248_28626 725
332 3300005539 Ga0068853_100019985 Ga0068853_1000199853 726
333 3300048088 Ga0495602_0006433 Ga0495602_0006433_9877_12297 726
334 3300001979 JGI24740J21852_10008449 JGI24740J21852_100084491 727
335 3300005339 Ga0070660_100001562 Ga0070660_10000156213 727
336 3300005458 Ga0070681_10027912 Ga0070681_100279122 727
337 3300005530 Ga0070679_100004379 Ga0070679_10000437910 727
338 3300005563 Ga0068855_100003874 Ga0068855_10000387410 727
339 3300009011 Ga0105251_10000054 Ga0105251_1000005458 727
340 3300009174 Ga0105241_10000001 Ga0105241_10000001456 727
341 3300013307 Ga0157372_10015000 Ga0157372_100150004 727
342 3300014497 Ga0182008_10015010 Ga0182008_100150102 727
343 3300025735 Ga0207713_1000018 Ga0207713_1000018189 727
344 3300025911 Ga0207654_10000004 Ga0207654_10000004484 727
345 3300025912 Ga0207707_10073357 Ga0207707_100733572 727
346 3300025919 Ga0207657_10000649 Ga0207657_100006495 727
347 3300025921 Ga0207652_10003204 Ga0207652_100032046 727
348 3300026067 Ga0207678_10001078 Ga0207678_1000107820 727
349 3300027111 Ga0209281_1000003 Ga0209281_10000031134 727
350 3300041405 Ga0439438_003314 Ga0439438_003314_2216_4609 727
351 3300041407 Ga0439447_006302 Ga0439447_006302_875_3268 727
352 3300041411 Ga0439466_0011564 Ga0439466_0011564_162_2624 727
353 3300046474 Ga0495605_0028918 Ga0495605_0028918_47_2383 727
354 3300015261 Ga0182006_1000045 Ga0182006_100004570 728
355 3300027312 Ga0209371_1005268 Ga0209371_10052683 729
356 3300042010 Ga0439452_000007 Ga0439452_000007_77914_80304 729
357 3300046471 Ga0495650_0000076 Ga0495650_0000076_113658_116060 729
358 3300046500 Ga0495596_0002833 Ga0495596_0002833_1845_4247 729
359 3300046512 Ga0495610_0009729 Ga0495610_0009729_3050_5452 729
360 3300046524 Ga0495648_0007259 Ga0495648_0007259_2773_5175 729
361 3300046538 Ga0495609_0000214 Ga0495609_0000214_23381_25783 729
362 3300046660 Ga0495625_0000242 Ga0495625_0000242_24936_27338 729
363 3300047446 Ga0495679_000446 Ga0495679_000446_20290_22692 729
364 3300047472 Ga0495686_0033118 Ga0495686_0033118_566_2968 729
365 3300048091 Ga0495626_0000010 Ga0495626_0000010_260467_262869 729
366 iso_pu_bacteria 2818991457 2819660934 729
367 iso_pu_bacteria 2852684882 2852686811 729
368 iso_pu_bacteria 2919130084 2919133995 729
369 iso_pu_bacteria 2929195423 2929196645 729
370 iso_pu_bacteria 641228493 641334497 729
371 iso_pu_bacteria 643348555 643390999 729
372 3300003856 Ga0058692_1000221 Ga0058692_100022111 730
373 3300003856 Ga0058692_1001756 Ga0058692_10017563 730
374 3300006946 Ga0079104_1001044 Ga0079104_100104415 730
375 3300006946 Ga0079104_1001079 Ga0079104_100107915 730
376 3300027111 Ga0209281_1000137 Ga0209281_100013798 730
377 3300027111 Ga0209281_1000298 Ga0209281_100029815 730
378 3300027312 Ga0209371_1000203 Ga0209371_100020345 730
379 3300027312 Ga0209371_1000300 Ga0209371_100030036 730
380 3300027312 Ga0209371_1006184 Ga0209371_10061841 730
381 3300030500 Ga0268256_1000012 Ga0268256_1000012703 730
382 3300030500 Ga0268256_1002261 Ga0268256_10022616 730
383 3300030500 Ga0268256_1005553 Ga0268256_10055533 730
384 3300002773 JGI25152J39213_1000194 JGI25152J39213_100019423 731
385 3300009036 Ga0105244_10000039 Ga0105244_1000003948 731
386 3300013105 Ga0157369_10020801 Ga0157369_100208011 731
387 3300013307 Ga0157372_10002392 Ga0157372_1000239212 731
388 3300025258 Ga0209129_1000008 Ga0209129_1000008510 731
389 3300025728 Ga0207655_1000090 Ga0207655_100009080 731
390 3300027312 Ga0209371_1000014 Ga0209371_100001468 731
391 3300027312 Ga0209371_1007606 Ga0209371_10076062 731
392 3300030500 Ga0268256_1000021 Ga0268256_100002162 731
393 3300030500 Ga0268256_1006374 Ga0268256_10063741 731
394 3300042010 Ga0439452_000005 Ga0439452_000005_71782_74187 731
395 3300048920 Ga0496117_0005380 Ga0496117_0005380_2390_4795 731
396 3300048922 Ga0496119_0000171 Ga0496119_0000171_17256_19661 731
397 3300048923 Ga0496120_0028960 Ga0496120_0028960_971_3376 731
398 3300048927 Ga0496124_0000142 Ga0496124_0000142_136738_139143 731
399 3300048928 Ga0496125_0016546 Ga0496125_0016546_550_2955 731
400 iso_pu_bacteria 2747842501 2748016759 731
401 3300009092 Ga0105250_10000378 Ga0105250_1000037817 732
402 3300025711 Ga0207696_1000066 Ga0207696_1000066122 732
403 3300048916 Ga0496113_0001180 Ga0496113_0001180_11353_13689 732
404 2162886007 SwRhRL2b_contig_791230 SwRhRL2b_0413.00004350 733
405 3300005289 Ga0065704_10070794 Ga0065704_1007079412 733
406 3300048920 Ga0496117_0002602 Ga0496117_0002602_18955_21423 733
407 3300027312 Ga0209371_1000069 Ga0209371_100006993 734
408 3300030500 Ga0268256_1000066 Ga0268256_100006696 734
409 3300048915 Ga0496112_0018189 Ga0496112_0018189_3809_6238 734
410 3300048924 Ga0496121_0003375 Ga0496121_0003375_11078_13534 734
411 3300003322 rootL2_10001213 rootL2_1000121313 735
412 3300003856 Ga0058692_1000096 Ga0058692_100009630 735
413 3300005548 Ga0070665_100019597 Ga0070665_1000195973 735
414 3300009545 Ga0105237_10027301 Ga0105237_100273012 735
415 3300013306 Ga0163162_10032124 Ga0163162_100321243 735
416 3300015262 Ga0182007_10004663 Ga0182007_100046633 735
417 3300025295 Ga0209564_1007182 Ga0209564_10071824 735
418 3300025711 Ga0207696_1005314 Ga0207696_10053142 735
419 3300025728 Ga0207655_1002123 Ga0207655_10021239 735
420 3300027312 Ga0209371_1000083 Ga0209371_100008384 735
421 3300027312 Ga0209371_1000358 Ga0209371_100035813 735
422 3300030500 Ga0268256_1000074 Ga0268256_100007489 735
423 3300030500 Ga0268256_1000304 Ga0268256_100030428 735
424 3300030500 Ga0268256_1001805 Ga0268256_10018052 735
425 3300041411 Ga0439466_0000002 Ga0439466_0000002_102152_104542 735
426 3300042016 Ga0439463_001800 Ga0439463_001800_116_2506 735
427 3300042146 Ga0450907_000011 Ga0450907_000011_67574_69964 735
428 3300046458 Ga0495591_014790 Ga0495591_014790_219_2609 735
429 3300046524 Ga0495648_0001149 Ga0495648_0001149_1825_4215 735
430 3300047320 Ga0495672_0000103 Ga0495672_0000103_20664_23054 735
431 3300048905 Ga0496102_0075337 Ga0496102_0075337_534_2924 735
432 3300048908 Ga0496105_0000759 Ga0496105_0000759_15459_17849 735
433 3300048920 Ga0496117_0000116 Ga0496117_0000116_71928_74318 735
434 3300048921 Ga0496118_0000143 Ga0496118_0000143_19073_21463 735
435 3300048922 Ga0496119_0001623 Ga0496119_0001623_2851_5241 735
436 3300048923 Ga0496120_0000158 Ga0496120_0000158_86025_88415 735
437 3300048924 Ga0496121_0000052 Ga0496121_0000052_238500_240890 735
438 3300048928 Ga0496125_0004036 Ga0496125_0004036_12130_14520 735
439 3300048929 Ga0496126_0031606 Ga0496126_0031606_661_3051 735
440 3300002737 JGI25162J39368_1002232 JGI25162J39368_10022322 736
441 3300003856 Ga0058692_1001644 Ga0058692_10016443 736
442 3300006946 Ga0079104_1000238 Ga0079104_100023843 736
443 3300025233 Ga0209437_100100 Ga0209437_10010091 736
444 3300025728 Ga0207655_1001463 Ga0207655_100146310 736
445 3300025735 Ga0207713_1000007 Ga0207713_1000007414 736
446 3300027111 Ga0209281_1000058 Ga0209281_1000058208 736
447 3300048920 Ga0496117_0000078 Ga0496117_0000078_124499_126889 736
448 3300048921 Ga0496118_0000059 Ga0496118_0000059_100180_102570 736
449 3300048925 Ga0496122_0001490 Ga0496122_0001490_10295_12685 736
450 3300048926 Ga0496123_0001312 Ga0496123_0001312_10428_12818 736
451 3300009036 Ga0105244_10000256 Ga0105244_1000025636 737
452 3300025711 Ga0207696_1000744 Ga0207696_10007447 737
453 3300025728 Ga0207655_1000436 Ga0207655_100043636 737
454 3300037471 Ga0395905_0000017 Ga0395905_0000017_74303_76729 737
455 3300039447 Ga0436361_0251636 Ga0436361_0251636_1700_4045 737
456 3300048927 Ga0496124_0002318 Ga0496124_0002318_16610_19009 737
457 3300009036 Ga0105244_10004014 Ga0105244_100040142 738
458 3300046542 Ga0495597_0000400 Ga0495597_0000400_2833_5244 738
459 3300003354 JGI25160J50197_1000017 JGI25160J50197_100001750 740
460 3300005262 Ga0065165_1000751 Ga0065165_100075121 740
461 3300009092 Ga0105250_10000324 Ga0105250_1000032418 740
462 3300025302 Ga0207426_1000107 Ga0207426_1000107128 740
463 3300025711 Ga0207696_1000196 Ga0207696_100019668 740
464 3300027312 Ga0209371_1002708 Ga0209371_10027087 740
465 3300030500 Ga0268256_1002409 Ga0268256_10024097 740
466 3300037853 Ga0436364_1266897 Ga0436364_1266897_1423_3792 740
467 3300045049 Ga0466959_0002314 Ga0466959_0002314_9492_11891 740
468 3300048903 Ga0496100_0000034 Ga0496100_0000034_78146_80572 740
469 3300048904 Ga0496101_0000322 Ga0496101_0000322_16532_18958 740
470 3300048905 Ga0496102_0000581 Ga0496102_0000581_23438_25864 740
471 3300048906 Ga0496103_0000283 Ga0496103_0000283_28125_30551 740
472 3300048920 Ga0496117_0000240 Ga0496117_0000240_78148_80574 740
473 3300048921 Ga0496118_0000200 Ga0496118_0000200_79410_81836 740
474 3300048924 Ga0496121_0001345 Ga0496121_0001345_21913_24339 740
475 3300048928 Ga0496125_0000523 Ga0496125_0000523_47281_49683 740
476 3300025256 Ga0209759_1003951 Ga0209759_10039516 741
477 iso_pu_bacteria 2599185359 2600227079 742
478 iso_pu_bacteria 2772190666 2772439694 742
479 iso_pu_bacteria 2818991466 2819715470 742
480 iso_pu_bacteria 2888366609 2888369765 742
481 iso_pu_bacteria 2928526807 2928530899 742
482 iso_pu_bacteria 2928968154 2928971025 742
483 iso_pu_bacteria 2937967321 2937968333 742
484 iso_pu_bacteria 8004592986 8004596665 742
485 iso_pu_bacteria 8015394850 8015398431 742
486 3300005327 Ga0070658_10010729 Ga0070658_100107293 743
487 3300025919 Ga0207657_10006638 Ga0207657_100066389 743
488 3300037418 Ga0395900_0036454 Ga0395900_0036454_2313_4688 743
489 3300046694 Ga0495649_0004124 Ga0495649_0004124_1422_3812 743
490 3300047320 Ga0495672_0000049 Ga0495672_0000049_166004_168415 743
491 3300048926 Ga0496123_0030588 Ga0496123_0030588_30_2384 743
492 iso_pu_bacteria 2506520007 2506579246 743
493 iso_pu_bacteria 2506520008 2506584385 743
494 iso_pu_bacteria 2508501071 2508853155 743
495 iso_pu_bacteria 2654587920 2656279958 743
496 iso_pu_bacteria 2687453601 2689445703 743
497 iso_pu_bacteria 2806310673 2807180067 743
498 iso_pu_bacteria 2869551831 2869555172 743
499 iso_pu_bacteria 640753048 640938640 743
500 iso_pu_bacteria 2847085930 2847088611 744
501 3300003316 rootH1_10017387 rootH1_100173875 745
502 iso_pu_bacteria 2908669403 2908671101 745
503 3300046524 Ga0495648_0009800 Ga0495648_0009800_3264_5720 746
504 3300048909 Ga0496106_0000211 Ga0496106_0000211_36804_39347 746
505 3300048924 Ga0496121_0022093 Ga0496121_0022093_1495_4038 746
506 iso_pu_bacteria 2904504865 2904505580 746
507 iso_pu_bacteria 2939602548 2939605534 746
508 3300003320 rootH2_10006301 rootH2_100063016 747
509 3300048926 Ga0496123_0000467 Ga0496123_0000467_17927_20314 747
510 iso_pu_bacteria 2511231025 2511380354 747
511 iso_pu_bacteria 2511231035 2511434598 747
512 iso_pu_bacteria 2585427591 2585827143 747
513 iso_pu_bacteria 2585427592 2585833198 747
514 iso_pu_bacteria 2599185299 2599927789 747
515 iso_pu_bacteria 2608642108 2608670808 747
516 iso_pu_bacteria 2648501693 2650898598 747
517 iso_pu_bacteria 2667528173 2671107723 747
518 iso_pu_bacteria 2684622997 2686354777 747
519 iso_pu_bacteria 2808606414 2809125768 747
520 iso_pu_bacteria 2844528606 2844531389 747
521 iso_pu_bacteria 2847797336 2847801737 747
522 iso_pu_bacteria 2865014394 2865016148 747
523 iso_pu_bacteria 2876601092 2876605979 747
524 iso_pu_bacteria 2881609920 2881610127 747
525 iso_pu_bacteria 2904474040 2904476724 747
526 iso_pu_bacteria 2919150387 2919152893 747
527 iso_pu_bacteria 2927143783 2927146854 747
528 iso_pu_bacteria 2945951305 2945954606 747
529 iso_pu_bacteria 2978975091 2978977096 747
530 iso_pu_bacteria 2984494565 2984498493 747
531 iso_pu_bacteria 2990261002 2990263593 747
532 iso_pu_bacteria 8016733728 8016737523 747
533 iso_pu_bacteria 8019499862 8019502746 747
534 iso_pu_bacteria 2888373701 2888378220 748
535 iso_pu_bacteria 642555112 642597281 748
536 3300015679 Ga0183366_1003 Ga0183366_100379 749
537 3300015680 Ga0183370_1003 Ga0183370_1003341 749
538 3300015685 Ga0183369_1005 Ga0183369_1005341 749
539 3300015687 Ga0183368_1006 Ga0183368_100678 749
540 3300048922 Ga0496119_0009873 Ga0496119_0009873_3197_5587 749
541 iso_pu_bacteria 2791355137 2792839323 749
542 iso_pu_bacteria 2904434214 2904436001 749
543 iso_pu_bacteria 2904615490 2904622296 749
544 3300003856 Ga0058692_1004285 Ga0058692_10042852 750
545 3300027312 Ga0209371_1000030 Ga0209371_100003014 750
546 3300030500 Ga0268256_1000025 Ga0268256_100002567 750
547 3300042010 Ga0439452_000407 Ga0439452_000407_5018_7408 750
548 3300044669 Ga0466981_0000042 Ga0466981_0000042_21600_23990 750
549 3300048929 Ga0496126_0002156 Ga0496126_0002156_18134_20524 750
550 iso_pu_bacteria 2513237166 2514048962 750
551 iso_pu_bacteria 2562617112 2563056145 750
552 iso_pu_bacteria 2711768613 2713481747 750
553 iso_pu_bacteria 3000376612 3000380433 750
554 3300005289 Ga0065704_10001780 Ga0065704_100017801 751
555 3300005548 Ga0070665_100000749 Ga0070665_1000007492 751
556 3300006051 Ga0075364_10002674 Ga0075364_100026742 751
557 3300009011 Ga0105251_10002260 Ga0105251_100022607 751
558 3300009011 Ga0105251_10022412 Ga0105251_100224122 751
559 3300009036 Ga0105244_10000972 Ga0105244_100009723 751
560 3300009148 Ga0105243_10002183 Ga0105243_100021837 751
561 3300021384 Ga0213876_10000026 Ga0213876_10000026136 751
562 3300025711 Ga0207696_1002238 Ga0207696_100223810 751
563 3300025728 Ga0207655_1003013 Ga0207655_10030137 751
564 3300025735 Ga0207713_1000048 Ga0207713_100004886 751
565 3300025735 Ga0207713_1009786 Ga0207713_10097861 751
566 3300025935 Ga0207709_10001680 Ga0207709_100016806 751
567 3300027111 Ga0209281_1002689 Ga0209281_10026897 751
568 3300028379 Ga0268266_10000307 Ga0268266_1000030723 751
569 3300039437 Ga0436365_0084998 Ga0436365_0084998_70771_73158 751
570 3300042010 Ga0439452_000074 Ga0439452_000074_14678_17068 751
571 3300046471 Ga0495650_0000028 Ga0495650_0000028_51387_53777 751
572 3300048919 Ga0496116_0003610 Ga0496116_0003610_2259_4649 751
573 3300048920 Ga0496117_0000753 Ga0496117_0000753_38778_41168 751
574 3300048921 Ga0496118_0001665 Ga0496118_0001665_25321_27711 751
575 3300048922 Ga0496119_0008294 Ga0496119_0008294_4004_6394 751
576 3300048923 Ga0496120_0005982 Ga0496120_0005982_6547_8937 751
577 3300048924 Ga0496121_0005686 Ga0496121_0005686_10776_13166 751
578 3300048924 Ga0496121_0030181 Ga0496121_0030181_296_2686 751
579 3300048925 Ga0496122_0001219 Ga0496122_0001219_38842_41232 751
580 3300048926 Ga0496123_0001433 Ga0496123_0001433_16714_19104 751
581 iso_pu_bacteria 2609459761 2609911848 751
582 iso_pu_bacteria 2671180115 2671587834 751
583 iso_pu_bacteria 2711768156 2712470815 751
584 iso_pu_bacteria 2891670763 2891671910 751
585 iso_pu_bacteria 2939607340 2939609372 751
586 iso_pu_bacteria 2945874760 2945879671 751
587 iso_pu_bacteria 8054844752 8054846391 751
588 iso_pu_bacteria 8054849141 8054853805 751
589 iso_pu_bacteria 8055097453 8055100574 751
590 3300016635 Ga0183361_10021 Ga0183361_1002139 752
591 iso_pu_bacteria 2547132181 2547696656 752
592 iso_pu_bacteria 2547132416 2548651522 752
593 iso_pu_bacteria 2554235234 2555261878 752
594 iso_pu_bacteria 2561511199 2562466017 752
595 iso_pu_bacteria 2599185169 2599412240 752
596 iso_pu_bacteria 2600255254 2601525430 752
597 iso_pu_bacteria 2600255255 2601530597 752
598 iso_pu_bacteria 2600255256 2601534066 752
599 iso_pu_bacteria 2600255257 2601540234 752
600 iso_pu_bacteria 2600255280 2601617551 752
601 iso_pu_bacteria 2600255281 2601622585 752
602 iso_pu_bacteria 2600255287 2601644507 752
603 iso_pu_bacteria 2600255288 2601650859 752
604 iso_pu_bacteria 2600255289 2601655909 752
605 iso_pu_bacteria 2600255290 2601660811 752
606 iso_pu_bacteria 2600255291 2601664672 752
607 iso_pu_bacteria 2600255298 2601697460 752
608 iso_pu_bacteria 2600255299 2601702848 752
609 iso_pu_bacteria 2600255300 2601708675 752
610 iso_pu_bacteria 2600255301 2601713533 752
611 iso_pu_bacteria 2600255302 2601718758 752
612 iso_pu_bacteria 2600255303 2601722493 752
613 iso_pu_bacteria 2600255304 2601728761 752
614 iso_pu_bacteria 2600255305 2601733684 752
615 iso_pu_bacteria 2600255306 2601738659 752
616 iso_pu_bacteria 2600255307 2601743009 752
617 iso_pu_bacteria 2600255309 2601753803 752
618 iso_pu_bacteria 2600255310 2601758783 752
619 iso_pu_bacteria 2600255311 2601762866 752
620 iso_pu_bacteria 2600255392 2602020667 752
621 iso_pu_bacteria 2602042046 2603640719 752
622 iso_pu_bacteria 2602042047 2603644500 752
623 iso_pu_bacteria 2602042052 2603663011 752
624 iso_pu_bacteria 2602042053 2603667909 752
625 iso_pu_bacteria 2602042066 2603700354 752
626 iso_pu_bacteria 2602042067 2603706039 752
627 iso_pu_bacteria 2602042103 2603841228 752
628 iso_pu_bacteria 2602042104 2603846300 752
629 iso_pu_bacteria 2602042105 2603851375 752
630 iso_pu_bacteria 2602042106 2603856442 752
631 iso_pu_bacteria 2602042109 2603868668 752
632 iso_pu_bacteria 2602042110 2603874022 752
633 iso_pu_bacteria 2602042111 2603878717 752
634 iso_pu_bacteria 2603880178 2606051202 752
635 iso_pu_bacteria 2603880184 2606072161 752
636 iso_pu_bacteria 2603880202 2606148867 752
637 iso_pu_bacteria 2603880211 2606179093 752
638 iso_pu_bacteria 2636415599 2637227040 752
639 iso_pu_bacteria 2667528172 2671103602 752
640 iso_pu_bacteria 2675903046 2676409472 752
641 iso_pu_bacteria 2681812866 2681996948 752
642 iso_pu_bacteria 2681812869 2682008734 752
643 iso_pu_bacteria 2751185917 2753854666 752
644 iso_pu_bacteria 2775506706 2775540914 752
645 iso_pu_bacteria 2775507074 2777021438 752
646 iso_pu_bacteria 2791355010 2792313432 752
647 iso_pu_bacteria 2791355275 2793406799 752
648 iso_pu_bacteria 2811995292 2813730519 752
649 iso_pu_bacteria 2814123068 2814698127 752
650 iso_pu_bacteria 2821118458 2821121529 752
651 iso_pu_bacteria 2823373977 2823377348 752
652 iso_pu_bacteria 2844425489 2844426220 752
653 iso_pu_bacteria 2884086401 2884090378 752
654 iso_pu_bacteria 2904513164 2904516239 752
655 iso_pu_bacteria 2919108558 2919112554 752
656 iso_pu_bacteria 2923634449 2923638067 752
657 iso_pu_bacteria 2927833300 2927835501 752
658 iso_pu_bacteria 2935625433 2935628022 752
659 iso_pu_bacteria 2937539931 2937544527 752
660 iso_pu_bacteria 2939568625 2939571482 752
661 iso_pu_bacteria 2939617950 2939619559 752
662 iso_pu_bacteria 2939642701 2939646109 752
663 iso_pu_bacteria 2969079654 2969084051 752
664 iso_pu_bacteria 2971820967 2971825529 752
665 iso_pu_bacteria 2974310843 2974313534 752
666 iso_pu_bacteria 2974435778 2974437049 752
667 iso_pu_bacteria 2984559226 2984561128 752
668 iso_pu_bacteria 2984595703 2984599201 752
669 iso_pu_bacteria 8018221730 8018223572 752
670 iso_pu_bacteria 8018405270 8018410122 752
671 iso_pu_bacteria 8019504834 8019506920 752
672 iso_pu_bacteria 8055087960 8055092508 752
673 iso_pu_bacteria 8055092621 8055092934 752
674 iso_pu_bacteria 8057304971 8057307242 752
675 3300005577 Ga0068857_100000004 Ga0068857_10000000484 755
676 3300025728 Ga0207655_1000026 Ga0207655_1000026417 755
677 3300025728 Ga0207655_1001219 Ga0207655_10012197 755
678 3300026116 Ga0207674_10000009 Ga0207674_10000009108 755
679 3300027111 Ga0209281_1000891 Ga0209281_100089114 755
680 3300048907 Ga0496104_0001075 Ga0496104_0001075_16470_18860 755
681 3300048922 Ga0496119_0007240 Ga0496119_0007240_1072_3462 755
682 3300048924 Ga0496121_0018475 Ga0496121_0018475_4342_6732 755
683 3300048925 Ga0496122_0003808 Ga0496122_0003808_15546_17936 755
684 3300048928 Ga0496125_0002656 Ga0496125_0002656_13822_16212 755
685 3300048928 Ga0496125_0026964 Ga0496125_0026964_1111_3501 755
686 3300048929 Ga0496126_0002622 Ga0496126_0002622_6927_9317 755
687 2162886007 SwRhRL2b_contig_1263081 SwRhRL2b_0792.00001760 756
688 3300003856 Ga0058692_1004293 Ga0058692_10042932 756
689 3300005289 Ga0065704_10004009 Ga0065704_100040093 756
690 3300006051 Ga0075364_10003220 Ga0075364_100032202 756
691 3300006946 Ga0079104_1004384 Ga0079104_10043843 756
692 3300009011 Ga0105251_10001239 Ga0105251_1000123914 756
693 3300011119 Ga0105246_10022591 Ga0105246_100225912 756
694 3300025711 Ga0207696_1001814 Ga0207696_100181411 756
695 3300025728 Ga0207655_1000017 Ga0207655_1000017426 756
696 3300025735 Ga0207713_1000057 Ga0207713_100005784 756
697 3300025735 Ga0207713_1000164 Ga0207713_100016476 756
698 3300025735 Ga0207713_1011818 Ga0207713_10118182 756
699 3300027111 Ga0209281_1000146 Ga0209281_100014690 756
700 3300027312 Ga0209371_1001468 Ga0209371_100146810 756
701 3300030500 Ga0268256_1001251 Ga0268256_10012517 756
702 3300046458 Ga0495591_000047 Ga0495591_000047_71444_73834 756
703 3300047469 Ga0495673_0000047 Ga0495673_0000047_192624_195014 756
704 3300048923 Ga0496120_0032932 Ga0496120_0032932_293_2683 756
705 3300048924 Ga0496121_0004462 Ga0496121_0004462_1190_3580 756
706 3300048924 Ga0496121_0025755 Ga0496121_0025755_511_2901 756
707 3300048925 Ga0496122_0000419 Ga0496122_0000419_16132_18522 756
708 3300048926 Ga0496123_0000746 Ga0496123_0000746_11000_13390 756
709 iso_pu_bacteria 2939573065 2939576153 756

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01011

PQQ

PQQ enzyme repeat

779

816

0.92

PF01011

PQQ

PQQ enzyme repeat

276

311

0.91

PF01011

PQQ

PQQ enzyme repeat

722

759

0.91

PF01011

PQQ

PQQ enzyme repeat

408

446

0.85

PF13360

PQQ_2

PQQ-like domain

729

836

0.75

PF13360

PQQ_2

PQQ-like domain

241

435

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
2yms-assembly1.cif.gz_B structure and assembly of a b-propeller with nine blades and a new conserved repetitive sequence motif 0.8308 283 374
7eq5-assembly1.cif.gz_A plant growth-promoting factor yxal mutant from bacillus velezensis - t175w/w215g 0.7789 140 752
7dxn-assembly2.cif.gz_B-2 plant growth-promoting factor yxal from bacillus velezensis 0.7776 140 748
1kb0-assembly1.cif.gz_A crystal structure of quinohemoprotein alcohol dehydrogenase from comamonas testosteroni 0.7685 160 756
4xga-assembly1.cif.gz_A crystal structure of bamb and bama p3-5 complex from e.coli 0.7679 175 749
ID Description Score Start End Superfamily
af_P15877_153_794_2.140.10.10 Mainly Beta;8 Propeller;Methanol Dehydrogenase; Chain A;Quinoprotein alcohol dehydrogenase-like superfamily 0.976 147 754 2.140.10.10
af_P15877_1_152_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9605 1 146 1.20.1250.20
af_P15877_153_794_2.140.10.10 Mainly Beta;8 Propeller;Methanol Dehydrogenase; Chain A;Quinoprotein alcohol dehydrogenase-like superfamily 0.9238 147 754 2.140.10.10
af_P15877_1_152_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9171 1 146 1.20.1250.20
af_A0A0P0WS15_683_864_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8568 282 495 2.130.10.10
ID Description Score Start End GO Terms
AF-W1Y1V3-F1-model_v4 Quinoprotein glucose dehydrogenase 0.9975 448 533
AF-A0A6D0ENP3-F1-model_v4 deleted 0.9907 327 495
AF-A0A377TKP2-F1-model_v4 Glucose dehydrogenase (EC 1.1.5.2) 0.9883 329 568 GO:0008876
GO:0030288
AF-W1Y1V3-F1-model_v4 Quinoprotein glucose dehydrogenase 0.986 448 533
AF-A0A2N4YUV4-F1-model_v4 Membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family (EC 1.1.5.2) 0.9855 70 610 GO:0005886
GO:0008876
GO:0030288
GO:0048038

Feature Viewer

pLDDT pTM Quality
89.62 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map