F476643
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 709 | 347 | 1418 | 250 |
Family's Representative Sequence
| Representative Sequence | 3300005539|Ga0068853_100043702|Ga0068853_1000437022 |
| Length | 290 |
| Sequence | VPSDPLHPRKQNPDFDPDRRQSCLSGAPHLPGAPRLAKRIIACLDVDAGRVVKGVQFQQLRDAGDPAELAVAHASAGADEIVLLDVTATNEGRETLAETVRRAARDLFVPFTVGGGIRTLADAAKVFDAGADKVSINSAALANPKLISEIAGRFGSQAVIVAIDARRGTGPADTAEVFVSGGRTATGKKALQWACEAQERGAGEILLTSMDRDGTGLGFDCELTSAVASSVSIPVIASGGAGNAQHFVDVFSSGHADAALAASIFHFGTHAVADLKQTLLRAGVPMRWPC |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 2 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 3 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 4 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 5 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 41 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 43 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 44 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 45 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 46 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 47 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 48 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 49 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 50 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 51 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 52 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 53 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 54 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 55 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 56 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 57 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 58 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 59 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 64 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 65 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 66 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 67 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 69 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 97 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 99 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 100 | 3300022730 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 | Metagenome | Rhizosphere |
| 101 | 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 | Metagenome | Rhizosphere |
| 102 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 164 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 168 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 169 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 170 | 3300031010 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 171 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 172 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 173 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 174 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 175 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 176 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 177 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 178 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 179 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 180 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 181 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 182 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 183 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 184 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 185 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 186 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 187 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 188 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 189 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 190 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 191 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 192 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 193 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 194 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 195 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 196 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 197 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 198 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 199 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 200 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 201 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 202 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 203 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 204 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 205 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 206 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 207 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 208 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 209 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 210 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 211 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 212 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 213 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 279 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 280 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 281 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 282 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 283 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 284 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 285 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 286 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 287 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 288 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 289 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 290 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 291 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 292 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 293 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 294 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 295 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 296 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 297 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 334 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 335 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 338 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 339 | 2522125168 | Dyadobacter beijingensis DSM 21582 | Isolate | Rhizosphere |
| 340 | 2721755487 | Sphingobacterium sp. B29 | Isolate | Rhizosphere |
| 341 | 2884215851 | Edaphobacter sp. 12200R-103 | Isolate | Rhizosphere |
| 342 | 2887375801 | Parapusillimonas sp. SGNA-6 | Isolate | Rhizosphere |
| 343 | 2896344016 | Sphingobacterium sp. SGL-16 | Isolate | Rhizosphere |
| 344 | 2902048731 | Pedobacter ureilyticus THG-T11 | Isolate | Rhizosphere |
| 345 | 2904780799 | Sphingobacterium sp. 1304 | Isolate | Rhizosphere |
| 346 | 2911138879 | Spirosoma sp. KUDC1026 | Isolate | Rhizosphere |
| 347 | 2919177583 | Sphingobacterium sp. 2149 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.88 |
| Metatranscriptomes | 0.85 |
| Isolates | 1.27 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.27 |
| Nodule | 0 |
| Rhizoplane | 4.51 |
| Rhizosphere | 91.54 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.41 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068853_100043702 | 3300005539 | Bacteria | 3833 |
| 2 | rootH1_10106452 | 3300003316 | Bacteria | 2104 |
| 3 | rootH2_10009426 | 3300003320 | Bacteria | 39179 |
| 4 | rootH2_10223217 | 3300003320 | Bacteria | 1214 |
| 5 | Ga0065165_1000639 | 3300005262 | Bacteria | 50701 |
| 6 | Ga0065704_10002415 | 3300005289 | Bacteria | 5278 |
| 7 | Ga0070658_10000121 | 3300005327 | Bacteria | 70439 |
| 8 | Ga0070658_10021582 | 3300005327 | Bacteria | 5160 |
| 9 | Ga0070658_10079725 | 3300005327 | Bacteria | 2689 |
| 10 | Ga0070683_100002041 | 3300005329 | Bacteria | 15901 |
| 11 | Ga0070683_100034019 | 3300005329 | Bacteria | 4652 |
| 12 | Ga0070683_100053355 | 3300005329 | Bacteria | 3746 |
| 13 | Ga0070670_100048822 | 3300005331 | Bacteria | 3641 |
| 14 | Ga0068869_100026222 | 3300005334 | Bacteria | 4054 |
| 15 | Ga0070680_100000986 | 3300005336 | Bacteria | 20202 |
| 16 | Ga0070680_100205572 | 3300005336 | Bacteria | 1661 |
| 17 | Ga0070680_100247038 | 3300005336 | Bacteria | 1508 |
| 18 | Ga0070680_100294798 | 3300005336 | Bacteria | 1375 |
| 19 | Ga0070682_100128071 | 3300005337 | Unclassified | 1714 |
| 20 | Ga0068868_100000066 | 3300005338 | Bacteria | 59945 |
| 21 | Ga0068868_100009078 | 3300005338 | Bacteria | 7140 |
| 22 | Ga0068868_100065060 | 3300005338 | Bacteria | 2896 |
| 23 | Ga0068868_100081115 | 3300005338 | Bacteria | 2600 |
| 24 | Ga0068868_100327777 | 3300005338 | Bacteria | 1306 |
| 25 | Ga0070660_100029979 | 3300005339 | Bacteria | 4079 |
| 26 | Ga0070660_100052984 | 3300005339 | Bacteria | 3129 |
| 27 | Ga0070661_100129713 | 3300005344 | Bacteria | 1893 |
| 28 | Ga0070661_100488462 | 3300005344 | Bacteria | 984 |
| 29 | Ga0070668_100272594 | 3300005347 | Bacteria | 1411 |
| 30 | Ga0070668_100282585 | 3300005347 | Bacteria | 1387 |
| 31 | Ga0070669_100037481 | 3300005353 | Bacteria | 3517 |
| 32 | Ga0070669_100163152 | 3300005353 | Bacteria | 1733 |
| 33 | Ga0070675_100015083 | 3300005354 | Bacteria | 6103 |
| 34 | Ga0070675_100100900 | 3300005354 | Bacteria | 2431 |
| 35 | Ga0070671_100019026 | 3300005355 | Bacteria | 5586 |
| 36 | Ga0070674_100003653 | 3300005356 | Bacteria | 8667 |
| 37 | Ga0070674_100005539 | 3300005356 | Bacteria | 7301 |
| 38 | Ga0070674_100007368 | 3300005356 | Bacteria | 6488 |
| 39 | Ga0070659_100004580 | 3300005366 | Bacteria | 9889 |
| 40 | Ga0070667_100046288 | 3300005367 | Bacteria | 3659 |
| 41 | Ga0070667_100355272 | 3300005367 | Bacteria | 1327 |
| 42 | Ga0070709_10088765 | 3300005434 | Bacteria | 2034 |
| 43 | Ga0070714_100223952 | 3300005435 | Unclassified | 1730 |
| 44 | Ga0070713_100018623 | 3300005436 | Bacteria | 5277 |
| 45 | Ga0070713_100139431 | 3300005436 | Bacteria | 2146 |
| 46 | Ga0070713_100302543 | 3300005436 | Bacteria | 1472 |
| 47 | Ga0070710_10007431 | 3300005437 | Bacteria | 5307 |
| 48 | Ga0070711_100004729 | 3300005439 | Bacteria | 8065 |
| 49 | Ga0070711_100010327 | 3300005439 | Bacteria | 5776 |
| 50 | Ga0070711_100115600 | 3300005439 | Bacteria | 1976 |
| 51 | Ga0070700_100022140 | 3300005441 | Bacteria | 3702 |
| 52 | Ga0070708_100132156 | 3300005445 | Bacteria | 2310 |
| 53 | Ga0070663_100299139 | 3300005455 | Bacteria | 1287 |
| 54 | Ga0070663_100377747 | 3300005455 | Bacteria | 1153 |
| 55 | Ga0070678_100013774 | 3300005456 | Bacteria | 5080 |
| 56 | Ga0070678_100040742 | 3300005456 | Bacteria | 3288 |
| 57 | Ga0070678_100172880 | 3300005456 | Bacteria | 1761 |
| 58 | Ga0070678_100215546 | 3300005456 | Bacteria | 1593 |
| 59 | Ga0070681_10028439 | 3300005458 | Bacteria | 5620 |
| 60 | Ga0070681_10051676 | 3300005458 | Bacteria | 4099 |
| 61 | Ga0070681_10059995 | 3300005458 | Unclassified | 3782 |
| 62 | Ga0070681_10072900 | 3300005458 | Bacteria | 3396 |
| 63 | Ga0070685_10004403 | 3300005466 | Bacteria | 7113 |
| 64 | Ga0070685_10373645 | 3300005466 | Bacteria | 980 |
| 65 | Ga0070706_100009858 | 3300005467 | Bacteria | 8876 |
| 66 | Ga0070706_100192849 | 3300005467 | Unclassified | 1904 |
| 67 | Ga0070707_100001684 | 3300005468 | Bacteria | 21318 |
| 68 | Ga0070679_100000968 | 3300005530 | Bacteria | 24975 |
| 69 | Ga0070679_100002610 | 3300005530 | Bacteria | 16386 |
| 70 | Ga0070679_100003993 | 3300005530 | Bacteria | 13587 |
| 71 | Ga0070679_100092454 | 3300005530 | Bacteria | 3012 |
| 72 | Ga0070679_100111123 | 3300005530 | Bacteria | 2727 |
| 73 | Ga0070684_100043409 | 3300005535 | Bacteria | 3882 |
| 74 | Ga0070684_100107048 | 3300005535 | Bacteria | 2504 |
| 75 | Ga0070684_100430167 | 3300005535 | Bacteria | 1219 |
| 76 | Ga0070684_100433660 | 3300005535 | Bacteria | 1214 |
| 77 | Ga0068853_100000367 | 3300005539 | Bacteria | 31060 |
| 78 | Ga0068853_100107800 | 3300005539 | Bacteria | 2470 |
| 79 | Ga0070686_100014710 | 3300005544 | Bacteria | 4516 |
| 80 | Ga0070665_100013537 | 3300005548 | Bacteria | 8205 |
| 81 | Ga0070665_100035648 | 3300005548 | Bacteria | 5003 |
| 82 | Ga0070665_100155561 | 3300005548 | Bacteria | 2288 |
| 83 | Ga0070704_100184123 | 3300005549 | Bacteria | 1673 |
| 84 | Ga0068855_100010384 | 3300005563 | Bacteria | 11233 |
| 85 | Ga0068855_100011915 | 3300005563 | Bacteria | 10511 |
| 86 | Ga0068855_100035334 | 3300005563 | Bacteria | 5953 |
| 87 | Ga0068855_100127193 | 3300005563 | Bacteria | 2912 |
| 88 | Ga0068855_100180615 | 3300005563 | Bacteria | 2386 |
| 89 | Ga0068855_100182459 | 3300005563 | Bacteria | 2372 |
| 90 | Ga0070664_100080620 | 3300005564 | Bacteria | 2803 |
| 91 | Ga0070664_100233250 | 3300005564 | Bacteria | 1650 |
| 92 | Ga0068857_100003191 | 3300005577 | Bacteria | 13595 |
| 93 | Ga0068857_100338048 | 3300005577 | Bacteria | 1393 |
| 94 | Ga0068857_100344814 | 3300005577 | Bacteria | 1378 |
| 95 | Ga0068854_100000019 | 3300005578 | Bacteria | 134145 |
| 96 | Ga0068854_100006821 | 3300005578 | Bacteria | 7282 |
| 97 | Ga0068854_100123734 | 3300005578 | Bacteria | 1967 |
| 98 | Ga0068854_100284393 | 3300005578 | Bacteria | 1333 |
| 99 | Ga0068854_100485092 | 3300005578 | Bacteria | 1038 |
| 100 | Ga0068854_100560236 | 3300005578 | Bacteria | 971 |
| 101 | Ga0068856_100033069 | 3300005614 | Bacteria | 5063 |
| 102 | Ga0068856_100057606 | 3300005614 | Bacteria | 3836 |
| 103 | Ga0068856_100062110 | 3300005614 | Bacteria | 3690 |
| 104 | Ga0068852_100097697 | 3300005616 | Bacteria | 2642 |
| 105 | Ga0068852_100103163 | 3300005616 | Bacteria | 2579 |
| 106 | Ga0068852_100280517 | 3300005616 | Bacteria | 1606 |
| 107 | Ga0068852_100981180 | 3300005616 | Bacteria | 863 |
| 108 | Ga0068859_100210649 | 3300005617 | Bacteria | 2030 |
| 109 | Ga0068864_100000625 | 3300005618 | Bacteria | 29830 |
| 110 | Ga0068864_100032027 | 3300005618 | Bacteria | 4464 |
| 111 | Ga0068864_100086854 | 3300005618 | Bacteria | 2753 |
| 112 | Ga0068866_10025185 | 3300005718 | Bacteria | 2794 |
| 113 | Ga0068866_10057060 | 3300005718 | Bacteria | 2010 |
| 114 | Ga0068861_100065980 | 3300005719 | Bacteria | 2789 |
| 115 | Ga0068861_100634606 | 3300005719 | Bacteria | 985 |
| 116 | Ga0068851_10016393 | 3300005834 | Bacteria | 3544 |
| 117 | Ga0068870_10016531 | 3300005840 | Bacteria | 3527 |
| 118 | Ga0068870_10027751 | 3300005840 | Bacteria | 2835 |
| 119 | Ga0068863_100001753 | 3300005841 | Bacteria | 21524 |
| 120 | Ga0068863_100001814 | 3300005841 | Bacteria | 21208 |
| 121 | Ga0068858_100014586 | 3300005842 | Bacteria | 7404 |
| 122 | Ga0068858_100077602 | 3300005842 | Bacteria | 3086 |
| 123 | Ga0068860_100000689 | 3300005843 | Bacteria | 38878 |
| 124 | Ga0068862_100329594 | 3300005844 | Bacteria | 1411 |
| 125 | Ga0081455_10051839 | 3300005937 | Bacteria | 3517 |
| 126 | Ga0081455_10407649 | 3300005937 | Bacteria | 941 |
| 127 | Ga0081538_10000465 | 3300005981 | Bacteria | 45439 |
| 128 | Ga0081540_1004351 | 3300005983 | Bacteria | 10839 |
| 129 | Ga0070717_10127876 | 3300006028 | Bacteria | 2183 |
| 130 | Ga0070716_100000287 | 3300006173 | Bacteria | 20418 |
| 131 | Ga0070712_100002632 | 3300006175 | Bacteria | 11078 |
| 132 | Ga0070712_100024471 | 3300006175 | Bacteria | 4003 |
| 133 | Ga0070712_100222772 | 3300006175 | Bacteria | 1494 |
| 134 | Ga0070712_100292956 | 3300006175 | Bacteria | 1315 |
| 135 | Ga0097621_100000116 | 3300006237 | Bacteria | 45553 |
| 136 | Ga0097621_100000349 | 3300006237 | Bacteria | 31779 |
| 137 | Ga0097621_100241191 | 3300006237 | Bacteria | 1580 |
| 138 | Ga0068871_100002325 | 3300006358 | Bacteria | 12946 |
| 139 | Ga0075428_100015743 | 3300006844 | Bacteria | 8378 |
| 140 | Ga0068865_100013860 | 3300006881 | Bacteria | 5110 |
| 141 | Ga0075436_100009109 | 3300006914 | Bacteria | 6792 |
| 142 | Ga0097620_100210642 | 3300006931 | Bacteria | 2030 |
| 143 | Ga0075435_100131543 | 3300007076 | Bacteria | 2094 |
| 144 | Ga0105240_10000001 | 3300009093 | Bacteria | 2887840 |
| 145 | Ga0105240_10000372 | 3300009093 | Bacteria | 84325 |
| 146 | Ga0105240_10009346 | 3300009093 | Bacteria | 13895 |
| 147 | Ga0105240_10010838 | 3300009093 | Bacteria | 12767 |
| 148 | Ga0105240_10046039 | 3300009093 | Bacteria | 5530 |
| 149 | Ga0105240_10122860 | 3300009093 | Bacteria | 3124 |
| 150 | Ga0105240_10299137 | 3300009093 | Bacteria | 1841 |
| 151 | Ga0105240_10312296 | 3300009093 | Bacteria | 1794 |
| 152 | Ga0111539_10427708 | 3300009094 | Bacteria | 1542 |
| 153 | Ga0105245_10000486 | 3300009098 | Bacteria | 36378 |
| 154 | Ga0105245_10021587 | 3300009098 | Bacteria | 5650 |
| 155 | Ga0105245_10283198 | 3300009098 | Bacteria | 1621 |
| 156 | Ga0105245_10581286 | 3300009098 | Bacteria | 1145 |
| 157 | Ga0105245_10788506 | 3300009098 | Bacteria | 988 |
| 158 | Ga0105247_10002346 | 3300009101 | Bacteria | 12922 |
| 159 | Ga0114129_10403567 | 3300009147 | Bacteria | 1801 |
| 160 | Ga0105243_10000043 | 3300009148 | Bacteria | 158809 |
| 161 | Ga0105243_10006595 | 3300009148 | Bacteria | 8966 |
| 162 | Ga0105243_10008481 | 3300009148 | Bacteria | 7889 |
| 163 | Ga0105243_10010773 | 3300009148 | Bacteria | 6920 |
| 164 | Ga0105241_10002032 | 3300009174 | Bacteria | 15308 |
| 165 | Ga0105241_10050871 | 3300009174 | Bacteria | 3158 |
| 166 | Ga0105242_10004704 | 3300009176 | Bacteria | 10568 |
| 167 | Ga0105248_10000019 | 3300009177 | Bacteria | 285766 |
| 168 | Ga0105248_10016372 | 3300009177 | Bacteria | 8160 |
| 169 | Ga0105248_10029618 | 3300009177 | Bacteria | 6107 |
| 170 | Ga0105248_10108464 | 3300009177 | Bacteria | 3131 |
| 171 | Ga0105248_10321320 | 3300009177 | Bacteria | 1743 |
| 172 | Ga0105237_10006331 | 3300009545 | Bacteria | 13155 |
| 173 | Ga0105237_10055825 | 3300009545 | Bacteria | 3955 |
| 174 | Ga0105237_10317658 | 3300009545 | Bacteria | 1561 |
| 175 | Ga0105238_10000509 | 3300009551 | Bacteria | 40868 |
| 176 | Ga0105238_10026652 | 3300009551 | Bacteria | 5892 |
| 177 | Ga0105238_10078759 | 3300009551 | Bacteria | 3286 |
| 178 | Ga0105238_10155125 | 3300009551 | Bacteria | 2265 |
| 179 | Ga0105238_10286222 | 3300009551 | Bacteria | 1630 |
| 180 | Ga0105249_10003449 | 3300009553 | Bacteria | 13698 |
| 181 | Ga0105249_10027405 | 3300009553 | Bacteria | 5140 |
| 182 | Ga0105239_10129889 | 3300010375 | Bacteria | 2801 |
| 183 | Ga0105246_10001192 | 3300011119 | Bacteria | 15150 |
| 184 | Ga0105246_10011295 | 3300011119 | Bacteria | 5541 |
| 185 | Ga0157371_10152599 | 3300013102 | Bacteria | 1648 |
| 186 | Ga0157370_10010879 | 3300013104 | Bacteria | 9556 |
| 187 | Ga0157370_10013763 | 3300013104 | Bacteria | 8313 |
| 188 | Ga0157370_10046758 | 3300013104 | Unclassified | 4149 |
| 189 | Ga0157370_10056931 | 3300013104 | Bacteria | 3720 |
| 190 | Ga0157370_10358073 | 3300013104 | Bacteria | 1345 |
| 191 | Ga0157370_10368441 | 3300013104 | Bacteria | 1324 |
| 192 | Ga0157370_10448778 | 3300013104 | Bacteria | 1186 |
| 193 | Ga0157370_10448784 | 3300013104 | Bacteria | 1186 |
| 194 | Ga0157369_10009218 | 3300013105 | Bacteria | 11289 |
| 195 | Ga0157369_10010533 | 3300013105 | Bacteria | 10523 |
| 196 | Ga0157369_10012659 | 3300013105 | Bacteria | 9566 |
| 197 | Ga0157369_10044962 | 3300013105 | Bacteria | 4804 |
| 198 | Ga0157369_10048503 | 3300013105 | Bacteria | 4608 |
| 199 | Ga0157369_10127916 | 3300013105 | Bacteria | 2692 |
| 200 | Ga0157369_10168089 | 3300013105 | Bacteria | 2312 |
| 201 | Ga0157369_10218919 | 3300013105 | Bacteria | 1993 |
| 202 | Ga0157369_10719337 | 3300013105 | Bacteria | 1028 |
| 203 | Ga0157374_10023020 | 3300013296 | Bacteria | 5565 |
| 204 | Ga0157374_10035016 | 3300013296 | Bacteria | 4591 |
| 205 | Ga0157374_10192351 | 3300013296 | Bacteria | 1996 |
| 206 | Ga0157378_10000108 | 3300013297 | Bacteria | 78677 |
| 207 | Ga0157378_10117504 | 3300013297 | Bacteria | 2447 |
| 208 | Ga0157378_10131240 | 3300013297 | Bacteria | 2319 |
| 209 | Ga0157378_10139810 | 3300013297 | Bacteria | 2248 |
| 210 | Ga0163162_10022177 | 3300013306 | Bacteria | 6259 |
| 211 | Ga0163162_10045378 | 3300013306 | Bacteria | 4403 |
| 212 | Ga0157372_10010870 | 3300013307 | Bacteria | 9688 |
| 213 | Ga0157372_10312122 | 3300013307 | Bacteria | 1830 |
| 214 | Ga0157375_10005984 | 3300013308 | Bacteria | 10610 |
| 215 | Ga0163163_10001161 | 3300014325 | Bacteria | 22403 |
| 216 | Ga0163163_10005969 | 3300014325 | Bacteria | 10594 |
| 217 | Ga0163163_10192750 | 3300014325 | Bacteria | 2086 |
| 218 | Ga0157380_10157679 | 3300014326 | Bacteria | 1969 |
| 219 | Ga0157377_10016037 | 3300014745 | Bacteria | 3846 |
| 220 | Ga0157379_10002312 | 3300014968 | Bacteria | 15882 |
| 221 | Ga0157376_10023888 | 3300014969 | Bacteria | 4793 |
| 222 | Ga0157376_10032166 | 3300014969 | Bacteria | 4209 |
| 223 | Ga0157376_10033667 | 3300014969 | Bacteria | 4128 |
| 224 | Ga0157376_10243031 | 3300014969 | Bacteria | 1678 |
| 225 | Ga0157376_10321136 | 3300014969 | Bacteria | 1472 |
| 226 | Ga0182006_1000068 | 3300015261 | Bacteria | 144823 |
| 227 | Ga0163161_10310295 | 3300017792 | Bacteria | 1244 |
| 228 | Ga0213874_10049873 | 3300021377 | Bacteria | 1281 |
| 229 | Ga0213876_10167759 | 3300021384 | Bacteria | 1168 |
| 230 | Ga0224570_100026 | 3300022730 | Bacteria | 6889 |
| 231 | Ga0224569_101932 | 3300022732 | Bacteria | 1712 |
| 232 | Ga0209437_110555 | 3300025233 | Bacteria | 1408 |
| 233 | Ga0209233_1001442 | 3300025261 | Bacteria | 9385 |
| 234 | Ga0209233_1002363 | 3300025261 | Bacteria | 7019 |
| 235 | Ga0209676_1000488 | 3300025292 | Bacteria | 64408 |
| 236 | Ga0207692_10004786 | 3300025898 | Bacteria | 5379 |
| 237 | Ga0207642_10065207 | 3300025899 | Bacteria | 1710 |
| 238 | Ga0207710_10036272 | 3300025900 | Bacteria | 2173 |
| 239 | Ga0207688_10102097 | 3300025901 | Bacteria | 1657 |
| 240 | Ga0207680_10030474 | 3300025903 | Bacteria | 3043 |
| 241 | Ga0207647_10014872 | 3300025904 | Bacteria | 5351 |
| 242 | Ga0207647_10272235 | 3300025904 | Bacteria | 968 |
| 243 | Ga0207699_10079051 | 3300025906 | Bacteria | 2034 |
| 244 | Ga0207643_10003224 | 3300025908 | Bacteria | 8793 |
| 245 | Ga0207643_10008421 | 3300025908 | Bacteria | 5534 |
| 246 | Ga0207705_10000021 | 3300025909 | Bacteria | 309436 |
| 247 | Ga0207705_10002125 | 3300025909 | Bacteria | 15376 |
| 248 | Ga0207705_10027435 | 3300025909 | Bacteria | 4060 |
| 249 | Ga0207705_10032912 | 3300025909 | Bacteria | 3705 |
| 250 | Ga0207705_10142618 | 3300025909 | Bacteria | 1790 |
| 251 | Ga0207684_10020316 | 3300025910 | Bacteria | 5674 |
| 252 | Ga0207654_10000808 | 3300025911 | Bacteria | 17242 |
| 253 | Ga0207707_10005331 | 3300025912 | Bacteria | 11237 |
| 254 | Ga0207707_10020540 | 3300025912 | Bacteria | 5767 |
| 255 | Ga0207695_10000001 | 3300025913 | Bacteria | 2888630 |
| 256 | Ga0207695_10000113 | 3300025913 | Bacteria | 247240 |
| 257 | Ga0207695_10000263 | 3300025913 | Bacteria | 132894 |
| 258 | Ga0207695_10033351 | 3300025913 | Bacteria | 5617 |
| 259 | Ga0207695_10072087 | 3300025913 | Bacteria | 3526 |
| 260 | Ga0207695_10101137 | 3300025913 | Bacteria | 2877 |
| 261 | Ga0207671_10000065 | 3300025914 | Bacteria | 166743 |
| 262 | Ga0207671_10000139 | 3300025914 | Bacteria | 111786 |
| 263 | Ga0207671_10188288 | 3300025914 | Bacteria | 1608 |
| 264 | Ga0207693_10006209 | 3300025915 | Bacteria | 9910 |
| 265 | Ga0207693_10021959 | 3300025915 | Bacteria | 5074 |
| 266 | Ga0207693_10214783 | 3300025915 | Bacteria | 1511 |
| 267 | Ga0207663_10016545 | 3300025916 | Bacteria | 4093 |
| 268 | Ga0207663_10045093 | 3300025916 | Bacteria | 2710 |
| 269 | Ga0207663_10244447 | 3300025916 | Bacteria | 1318 |
| 270 | Ga0207660_10005756 | 3300025917 | Bacteria | 8041 |
| 271 | Ga0207660_10047824 | 3300025917 | Bacteria | 3026 |
| 272 | Ga0207660_10146224 | 3300025917 | Bacteria | 1812 |
| 273 | Ga0207660_10154371 | 3300025917 | Bacteria | 1766 |
| 274 | Ga0207660_10440590 | 3300025917 | Bacteria | 1053 |
| 275 | Ga0207657_10022299 | 3300025919 | Bacteria | 5931 |
| 276 | Ga0207657_10058470 | 3300025919 | Bacteria | 3317 |
| 277 | Ga0207657_10123818 | 3300025919 | Bacteria | 2125 |
| 278 | Ga0207649_10069614 | 3300025920 | Bacteria | 2241 |
| 279 | Ga0207649_10077505 | 3300025920 | Bacteria | 2142 |
| 280 | Ga0207652_10002459 | 3300025921 | Bacteria | 15619 |
| 281 | Ga0207652_10005848 | 3300025921 | Bacteria | 9964 |
| 282 | Ga0207652_10015711 | 3300025921 | Bacteria | 6166 |
| 283 | Ga0207652_10036402 | 3300025921 | Bacteria | 4160 |
| 284 | Ga0207652_10217083 | 3300025921 | Bacteria | 1723 |
| 285 | Ga0207646_10021685 | 3300025922 | Bacteria | 5930 |
| 286 | Ga0207681_10155992 | 3300025923 | Bacteria | 1716 |
| 287 | Ga0207681_10177994 | 3300025923 | Bacteria | 1617 |
| 288 | Ga0207694_10000711 | 3300025924 | Bacteria | 29920 |
| 289 | Ga0207694_10048093 | 3300025924 | Bacteria | 3300 |
| 290 | Ga0207694_10121290 | 3300025924 | Bacteria | 2088 |
| 291 | Ga0207694_10163997 | 3300025924 | Bacteria | 1796 |
| 292 | Ga0207694_10359142 | 3300025924 | Bacteria | 1207 |
| 293 | Ga0207650_10136689 | 3300025925 | Bacteria | 1923 |
| 294 | Ga0207650_10141600 | 3300025925 | Bacteria | 1891 |
| 295 | Ga0207659_10289514 | 3300025926 | Bacteria | 1342 |
| 296 | Ga0207687_10000978 | 3300025927 | Bacteria | 19404 |
| 297 | Ga0207687_10002372 | 3300025927 | Bacteria | 12792 |
| 298 | Ga0207687_10563744 | 3300025927 | Bacteria | 957 |
| 299 | Ga0207700_10003745 | 3300025928 | Bacteria | 8878 |
| 300 | Ga0207700_10163747 | 3300025928 | Bacteria | 1849 |
| 301 | Ga0207664_10319666 | 3300025929 | Unclassified | 1369 |
| 302 | Ga0207644_10004420 | 3300025931 | Bacteria | 9123 |
| 303 | Ga0207644_10222547 | 3300025931 | Bacteria | 1496 |
| 304 | Ga0207690_10128659 | 3300025932 | Bacteria | 1850 |
| 305 | Ga0207690_10213666 | 3300025932 | Bacteria | 1472 |
| 306 | Ga0207709_10000021 | 3300025935 | Bacteria | 386722 |
| 307 | Ga0207709_10017040 | 3300025935 | Bacteria | 4050 |
| 308 | Ga0207709_10068957 | 3300025935 | Bacteria | 2237 |
| 309 | Ga0207670_10088192 | 3300025936 | Bacteria | 2187 |
| 310 | Ga0207669_10003949 | 3300025937 | Bacteria | 6470 |
| 311 | Ga0207669_10009825 | 3300025937 | Bacteria | 4576 |
| 312 | Ga0207669_10038680 | 3300025937 | Bacteria | 2749 |
| 313 | Ga0207704_10004960 | 3300025938 | Bacteria | 6121 |
| 314 | Ga0207704_10353180 | 3300025938 | Bacteria | 1145 |
| 315 | Ga0207665_10000046 | 3300025939 | Bacteria | 78992 |
| 316 | Ga0207665_10006547 | 3300025939 | Bacteria | 7723 |
| 317 | Ga0207691_10150871 | 3300025940 | Bacteria | 2043 |
| 318 | Ga0207711_10000014 | 3300025941 | Bacteria | 506753 |
| 319 | Ga0207711_10043809 | 3300025941 | Bacteria | 3819 |
| 320 | Ga0207711_10044398 | 3300025941 | Bacteria | 3794 |
| 321 | Ga0207711_10661291 | 3300025941 | Bacteria | 974 |
| 322 | Ga0207689_10000724 | 3300025942 | Bacteria | 31641 |
| 323 | Ga0207689_10016491 | 3300025942 | Bacteria | 6253 |
| 324 | Ga0207661_10001283 | 3300025944 | Bacteria | 16799 |
| 325 | Ga0207661_10055641 | 3300025944 | Bacteria | 3174 |
| 326 | Ga0207661_10059682 | 3300025944 | Bacteria | 3075 |
| 327 | Ga0207661_10070648 | 3300025944 | Bacteria | 2851 |
| 328 | Ga0207679_10132282 | 3300025945 | Bacteria | 2003 |
| 329 | Ga0207679_10171034 | 3300025945 | Bacteria | 1789 |
| 330 | Ga0207667_10007633 | 3300025949 | Bacteria | 12958 |
| 331 | Ga0207667_10012818 | 3300025949 | Bacteria | 9632 |
| 332 | Ga0207667_10025432 | 3300025949 | Bacteria | 6479 |
| 333 | Ga0207667_10060137 | 3300025949 | Bacteria | 3978 |
| 334 | Ga0207667_10264572 | 3300025949 | Bacteria | 1759 |
| 335 | Ga0207667_10714850 | 3300025949 | Bacteria | 1003 |
| 336 | Ga0207651_10056279 | 3300025960 | Bacteria | 2706 |
| 337 | Ga0207712_10101716 | 3300025961 | Bacteria | 2138 |
| 338 | Ga0207640_10000028 | 3300025981 | Bacteria | 135727 |
| 339 | Ga0207640_10008968 | 3300025981 | Bacteria | 5574 |
| 340 | Ga0207640_10472361 | 3300025981 | Bacteria | 1038 |
| 341 | Ga0207658_10003428 | 3300025986 | Bacteria | 11222 |
| 342 | Ga0207677_10000143 | 3300026023 | Bacteria | 58337 |
| 343 | Ga0207677_10232946 | 3300026023 | Bacteria | 1485 |
| 344 | Ga0207677_10261237 | 3300026023 | Bacteria | 1411 |
| 345 | Ga0207703_10004820 | 3300026035 | Bacteria | 10980 |
| 346 | Ga0207703_10097231 | 3300026035 | Bacteria | 2487 |
| 347 | Ga0207703_10272109 | 3300026035 | Bacteria | 1535 |
| 348 | Ga0207639_10000371 | 3300026041 | Bacteria | 31074 |
| 349 | Ga0207639_10016992 | 3300026041 | Bacteria | 5155 |
| 350 | Ga0207639_10490959 | 3300026041 | Bacteria | 1120 |
| 351 | Ga0207678_10017744 | 3300026067 | Bacteria | 6250 |
| 352 | Ga0207678_10056161 | 3300026067 | Bacteria | 3390 |
| 353 | Ga0207678_10149736 | 3300026067 | Bacteria | 1992 |
| 354 | Ga0207678_10264377 | 3300026067 | Bacteria | 1475 |
| 355 | Ga0207678_10440288 | 3300026067 | Bacteria | 1132 |
| 356 | Ga0207678_10442909 | 3300026067 | Bacteria | 1128 |
| 357 | Ga0207708_10005523 | 3300026075 | Bacteria | 9332 |
| 358 | Ga0207702_10017932 | 3300026078 | Bacteria | 5856 |
| 359 | Ga0207641_10168679 | 3300026088 | Bacteria | 1996 |
| 360 | Ga0207641_10342717 | 3300026088 | Bacteria | 1422 |
| 361 | Ga0207648_10167251 | 3300026089 | Bacteria | 1943 |
| 362 | Ga0207648_10564244 | 3300026089 | Bacteria | 1047 |
| 363 | Ga0207676_10002595 | 3300026095 | Bacteria | 12891 |
| 364 | Ga0207676_10052862 | 3300026095 | Bacteria | 3177 |
| 365 | Ga0207676_10074181 | 3300026095 | Bacteria | 2740 |
| 366 | Ga0207674_10000669 | 3300026116 | Bacteria | 44573 |
| 367 | Ga0207674_10222951 | 3300026116 | Bacteria | 1834 |
| 368 | Ga0207675_100029257 | 3300026118 | Bacteria | 5132 |
| 369 | Ga0207675_100200693 | 3300026118 | Bacteria | 1916 |
| 370 | Ga0207683_10043496 | 3300026121 | Bacteria | 3926 |
| 371 | Ga0207683_10079034 | 3300026121 | Bacteria | 2915 |
| 372 | Ga0207683_10233183 | 3300026121 | Bacteria | 1679 |
| 373 | Ga0207698_10105923 | 3300026142 | Bacteria | 2344 |
| 374 | Ga0207698_10220280 | 3300026142 | Bacteria | 1714 |
| 375 | Ga0265356_1000126 | 3300028017 | Bacteria | 13295 |
| 376 | Ga0268266_10005265 | 3300028379 | Bacteria | 12146 |
| 377 | Ga0268266_10006399 | 3300028379 | Bacteria | 10792 |
| 378 | Ga0268266_10274050 | 3300028379 | Bacteria | 1567 |
| 379 | Ga0268265_10205563 | 3300028380 | Bacteria | 1711 |
| 380 | Ga0268265_10316591 | 3300028380 | Bacteria | 1411 |
| 381 | Ga0268265_10500825 | 3300028380 | Bacteria | 1144 |
| 382 | Ga0268264_10000598 | 3300028381 | Bacteria | 43640 |
| 383 | Ga0265338_10040619 | 3300028800 | Bacteria | 4367 |
| 384 | Ga0265762_1000808 | 3300030760 | Bacteria | 5592 |
| 385 | Ga0265762_1010022 | 3300030760 | Bacteria | 1692 |
| 386 | Ga0265770_1002060 | 3300030878 | Unclassified | 2737 |
| 387 | Ga0265771_1001140 | 3300031010 | Bacteria | 1203 |
| 388 | Ga0265760_10000082 | 3300031090 | Bacteria | 24708 |
| 389 | Ga0265760_10001348 | 3300031090 | Bacteria | 7206 |
| 390 | Ga0307408_100000660 | 3300031548 | Bacteria | 28737 |
| 391 | Ga0316579_10046140 | 3300031691 | Bacteria | 2032 |
| 392 | Ga0265314_10019749 | 3300031711 | Bacteria | 5212 |
| 393 | Ga0316576_10006145 | 3300031727 | Bacteria | 7440 |
| 394 | Ga0316576_10151991 | 3300031727 | Bacteria | 1744 |
| 395 | Ga0316577_10060552 | 3300031733 | Unclassified | 2113 |
| 396 | Ga0307413_10170289 | 3300031824 | Bacteria | 1541 |
| 397 | Ga0307410_10361754 | 3300031852 | Bacteria | 1162 |
| 398 | Ga0307412_10082906 | 3300031911 | Bacteria | 2221 |
| 399 | Ga0307414_10026677 | 3300032004 | Bacteria | 3721 |
| 400 | Ga0307414_10084135 | 3300032004 | Bacteria | 2339 |
| 401 | Ga0307414_10212787 | 3300032004 | Bacteria | 1581 |
| 402 | Ga0307411_10050620 | 3300032005 | Bacteria | 2706 |
| 403 | Ga0316585_10084904 | 3300032137 | Bacteria | 1033 |
| 404 | Ga0316580_10005346 | 3300032139 | Bacteria | 3744 |
| 405 | Ga0307510_10010774 | 3300033180 | Bacteria | 10874 |
| 406 | Ga0307510_10071107 | 3300033180 | Bacteria | 3468 |
| 407 | Ga0307510_10094785 | 3300033180 | Bacteria | 2808 |
| 408 | Ga0373923_0048364 | 3300035111 | Bacteria | 1775 |
| 409 | Ga0373936_0015094 | 3300035113 | Bacteria | 2959 |
| 410 | Ga0373936_0052042 | 3300035113 | Bacteria | 1658 |
| 411 | Ga0373945_0014521 | 3300035116 | Bacteria | 2640 |
| 412 | Ga0373956_0021847 | 3300035119 | Bacteria | 2732 |
| 413 | Ga0373924_0116751 | 3300035410 | Bacteria | 1156 |
| 414 | Ga0373935_0009673 | 3300035692 | Bacteria | 5769 |
| 415 | Ga0373935_0040726 | 3300035692 | Bacteria | 2916 |
| 416 | Ga0373927_0156967 | 3300035695 | Bacteria | 1490 |
| 417 | Ga0373927_0170653 | 3300035695 | Bacteria | 1426 |
| 418 | Ga0373947_0001682 | 3300035725 | Bacteria | 13546 |
| 419 | Ga0373947_0007151 | 3300035725 | Bacteria | 6471 |
| 420 | Ga0373947_0044923 | 3300035725 | Bacteria | 2643 |
| 421 | Ga0373947_0085542 | 3300035725 | Bacteria | 1958 |
| 422 | Ga0373937_0000199 | 3300036401 | Bacteria | 58972 |
| 423 | Ga0373937_0019961 | 3300036401 | Bacteria | 6002 |
| 424 | Ga0373937_0029447 | 3300036401 | Bacteria | 4973 |
| 425 | Ga0316584_0172474 | 3300036712 | Bacteria | 1603 |
| 426 | Ga0373925_0011183 | 3300037068 | Bacteria | 6510 |
| 427 | Ga0373925_0012072 | 3300037068 | Bacteria | 6255 |
| 428 | Ga0373925_0035446 | 3300037068 | Bacteria | 3681 |
| 429 | Ga0373925_0057418 | 3300037068 | Bacteria | 2916 |
| 430 | Ga0395900_0025848 | 3300037418 | Bacteria | 6011 |
| 431 | Ga0395900_0046312 | 3300037418 | Bacteria | 4478 |
| 432 | Ga0395900_0465767 | 3300037418 | Bacteria | 1218 |
| 433 | Ga0395905_0492983 | 3300037471 | Bacteria | 1125 |
| 434 | Ga0395901_0476043 | 3300038443 | Bacteria | 1274 |
| 435 | Ga0400489_71328 | 3300039093 | Bacteria | 2332 |
| 436 | Ga0436365_1607100 | 3300039437 | Bacteria | 1720 |
| 437 | Ga0436363_0684479 | 3300039450 | Unclassified | 3001 |
| 438 | Ga0439457_010856 | 3300042014 | Bacteria | 2083 |
| 439 | Ga0466969_0149492 | 3300044656 | Bacteria | 1076 |
| 440 | Ga0466965_0004348 | 3300044683 | Bacteria | 6297 |
| 441 | Ga0466966_0164880 | 3300044684 | Bacteria | 1348 |
| 442 | Ga0466961_0001506 | 3300044693 | Bacteria | 14458 |
| 443 | Ga0466971_0001983 | 3300044719 | Bacteria | 8660 |
| 444 | Ga0466970_0050725 | 3300044765 | Bacteria | 2214 |
| 445 | Ga0466957_0000702 | 3300044842 | Bacteria | 17095 |
| 446 | Ga0466957_0712715 | 3300044842 | Bacteria | 709 |
| 447 | Ga0466959_0003421 | 3300045049 | Bacteria | 10378 |
| 448 | Ga0466958_0115891 | 3300045836 | Bacteria | 1674 |
| 449 | Ga0466967_0034277 | 3300045976 | Bacteria | 4307 |
| 450 | Ga0495627_004479 | 3300046453 | Bacteria | 5842 |
| 451 | Ga0495592_0047500 | 3300046454 | Bacteria | 3197 |
| 452 | Ga0495603_0009924 | 3300046455 | Bacteria | 5763 |
| 453 | Ga0495603_0048079 | 3300046455 | Bacteria | 2540 |
| 454 | Ga0495603_0126847 | 3300046455 | Bacteria | 1487 |
| 455 | Ga0495603_0262828 | 3300046455 | Bacteria | 993 |
| 456 | Ga0495629_0011020 | 3300046459 | Bacteria | 6567 |
| 457 | Ga0495629_0049585 | 3300046459 | Bacteria | 2942 |
| 458 | Ga0495629_0075929 | 3300046459 | Bacteria | 2346 |
| 459 | Ga0495641_0000681 | 3300046461 | Bacteria | 28646 |
| 460 | Ga0495651_0067062 | 3300046462 | Bacteria | 2738 |
| 461 | Ga0495651_0070949 | 3300046462 | Bacteria | 2649 |
| 462 | Ga0495651_0163141 | 3300046462 | Bacteria | 1595 |
| 463 | Ga0495651_0266601 | 3300046462 | Bacteria | 1163 |
| 464 | Ga0495653_0010749 | 3300046463 | Bacteria | 7495 |
| 465 | Ga0495653_0089319 | 3300046463 | Bacteria | 2258 |
| 466 | Ga0495650_0000038 | 3300046471 | Bacteria | 377530 |
| 467 | Ga0495650_0000087 | 3300046471 | Bacteria | 234870 |
| 468 | Ga0495650_0002342 | 3300046471 | Bacteria | 15659 |
| 469 | Ga0495580_0005628 | 3300046472 | Bacteria | 10312 |
| 470 | Ga0495580_0034332 | 3300046472 | Bacteria | 3652 |
| 471 | Ga0495580_0041316 | 3300046472 | Bacteria | 3289 |
| 472 | Ga0495580_0058878 | 3300046472 | Bacteria | 2701 |
| 473 | Ga0495580_0103353 | 3300046472 | Bacteria | 1980 |
| 474 | Ga0495582_0000643 | 3300046473 | Bacteria | 19225 |
| 475 | Ga0495582_0001853 | 3300046473 | Bacteria | 11921 |
| 476 | Ga0495582_0067225 | 3300046473 | Bacteria | 1980 |
| 477 | Ga0495582_0080396 | 3300046473 | Bacteria | 1810 |
| 478 | Ga0495639_0002049 | 3300046475 | Bacteria | 8922 |
| 479 | Ga0495639_0004538 | 3300046475 | Bacteria | 5952 |
| 480 | Ga0495662_0001214 | 3300046476 | Bacteria | 12678 |
| 481 | Ga0495664_0001348 | 3300046477 | Bacteria | 12929 |
| 482 | Ga0495664_0036690 | 3300046477 | Bacteria | 2890 |
| 483 | Ga0495664_0049296 | 3300046477 | Bacteria | 2500 |
| 484 | Ga0495584_0058377 | 3300046491 | Bacteria | 1941 |
| 485 | Ga0495585_0000286 | 3300046492 | Bacteria | 50524 |
| 486 | Ga0495585_0025037 | 3300046492 | Bacteria | 3420 |
| 487 | Ga0495594_0001190 | 3300046499 | Bacteria | 13614 |
| 488 | Ga0495594_0004431 | 3300046499 | Bacteria | 7222 |
| 489 | Ga0495594_0017006 | 3300046499 | Bacteria | 3839 |
| 490 | Ga0495594_0043704 | 3300046499 | Bacteria | 2456 |
| 491 | Ga0495594_0056792 | 3300046499 | Bacteria | 2161 |
| 492 | Ga0495583_0050307 | 3300046506 | Bacteria | 1905 |
| 493 | Ga0495606_0000052 | 3300046507 | Bacteria | 201529 |
| 494 | Ga0495606_0076509 | 3300046507 | Bacteria | 2092 |
| 495 | Ga0495606_0089617 | 3300046507 | Bacteria | 1895 |
| 496 | Ga0495608_0171818 | 3300046511 | Bacteria | 1374 |
| 497 | Ga0495610_0087725 | 3300046512 | Bacteria | 1415 |
| 498 | Ga0495616_0005196 | 3300046513 | Bacteria | 8053 |
| 499 | Ga0495618_0037508 | 3300046514 | Bacteria | 3044 |
| 500 | Ga0495618_0081798 | 3300046514 | Bacteria | 2063 |
| 501 | Ga0495628_0015738 | 3300046516 | Bacteria | 6314 |
| 502 | Ga0495628_0033438 | 3300046516 | Bacteria | 4145 |
| 503 | Ga0495628_0199156 | 3300046516 | Bacteria | 1509 |
| 504 | Ga0495630_0169403 | 3300046517 | Bacteria | 1663 |
| 505 | Ga0495630_0188567 | 3300046517 | Bacteria | 1573 |
| 506 | Ga0495631_0010490 | 3300046518 | Bacteria | 4581 |
| 507 | Ga0495644_0000048 | 3300046523 | Bacteria | 57696 |
| 508 | Ga0495666_0024917 | 3300046526 | Bacteria | 2955 |
| 509 | Ga0495652_0006640 | 3300046529 | Bacteria | 10742 |
| 510 | Ga0495652_0020823 | 3300046529 | Bacteria | 5827 |
| 511 | Ga0495652_0263793 | 3300046529 | Bacteria | 1270 |
| 512 | Ga0495665_0009651 | 3300046531 | Bacteria | 5228 |
| 513 | Ga0495665_0037967 | 3300046531 | Bacteria | 2569 |
| 514 | Ga0495665_0047858 | 3300046531 | Bacteria | 2268 |
| 515 | Ga0495665_0186240 | 3300046531 | Bacteria | 1078 |
| 516 | Ga0495640_0004801 | 3300046533 | Bacteria | 10760 |
| 517 | Ga0495640_0027681 | 3300046533 | Bacteria | 4086 |
| 518 | Ga0495586_0019711 | 3300046535 | Bacteria | 3591 |
| 519 | Ga0495586_0052639 | 3300046535 | Bacteria | 2204 |
| 520 | Ga0495587_0007267 | 3300046536 | Bacteria | 7183 |
| 521 | Ga0495587_0016961 | 3300046536 | Bacteria | 4529 |
| 522 | Ga0495587_0251359 | 3300046536 | Bacteria | 994 |
| 523 | Ga0495645_0004272 | 3300046543 | Bacteria | 9760 |
| 524 | Ga0495645_0039222 | 3300046543 | Bacteria | 3455 |
| 525 | Ga0495645_0120435 | 3300046543 | Bacteria | 1848 |
| 526 | Ga0495645_0206604 | 3300046543 | Bacteria | 1328 |
| 527 | Ga0495645_0244933 | 3300046543 | Bacteria | 1194 |
| 528 | Ga0495633_0013243 | 3300046558 | Bacteria | 4354 |
| 529 | Ga0495667_0027898 | 3300046559 | Bacteria | 3801 |
| 530 | Ga0495667_0039064 | 3300046559 | Bacteria | 3158 |
| 531 | Ga0495667_0347438 | 3300046559 | Bacteria | 937 |
| 532 | Ga0495668_0053449 | 3300046616 | Bacteria | 2233 |
| 533 | Ga0495634_0006225 | 3300046642 | Bacteria | 9093 |
| 534 | Ga0495611_0005877 | 3300046648 | Bacteria | 5236 |
| 535 | Ga0495625_0000036 | 3300046660 | Bacteria | 221680 |
| 536 | Ga0495625_0000985 | 3300046660 | Bacteria | 37750 |
| 537 | Ga0495625_0017473 | 3300046660 | Bacteria | 5617 |
| 538 | Ga0495625_0026175 | 3300046660 | Bacteria | 4411 |
| 539 | Ga0495625_0034121 | 3300046660 | Bacteria | 3757 |
| 540 | Ga0495625_0263232 | 3300046660 | Bacteria | 1115 |
| 541 | Ga0495635_0001587 | 3300046663 | Bacteria | 15288 |
| 542 | Ga0495635_0002836 | 3300046663 | Bacteria | 11904 |
| 543 | Ga0495635_0127751 | 3300046663 | Bacteria | 1733 |
| 544 | Ga0495635_0172193 | 3300046663 | Bacteria | 1472 |
| 545 | Ga0495661_0015900 | 3300046665 | Bacteria | 5009 |
| 546 | Ga0495588_0068626 | 3300046674 | Bacteria | 1842 |
| 547 | Ga0495657_0329562 | 3300046675 | Bacteria | 906 |
| 548 | Ga0495599_0037006 | 3300046678 | Bacteria | 3066 |
| 549 | Ga0495599_0048151 | 3300046678 | Bacteria | 2672 |
| 550 | Ga0495599_0106580 | 3300046678 | Bacteria | 1746 |
| 551 | Ga0495623_0071905 | 3300046679 | Bacteria | 2151 |
| 552 | Ga0495623_0073201 | 3300046679 | Bacteria | 2130 |
| 553 | Ga0495623_0151262 | 3300046679 | Bacteria | 1372 |
| 554 | Ga0495646_0013211 | 3300046680 | Bacteria | 5247 |
| 555 | Ga0495646_0032680 | 3300046680 | Bacteria | 3237 |
| 556 | Ga0495658_0000432 | 3300046683 | Bacteria | 23385 |
| 557 | Ga0495658_0157788 | 3300046683 | Bacteria | 1397 |
| 558 | Ga0495658_0159853 | 3300046683 | Bacteria | 1389 |
| 559 | Ga0495613_0003966 | 3300046689 | Bacteria | 11081 |
| 560 | Ga0495624_0007524 | 3300046690 | Bacteria | 7641 |
| 561 | Ga0495624_0016847 | 3300046690 | Bacteria | 4917 |
| 562 | Ga0495671_0072938 | 3300046692 | Bacteria | 1685 |
| 563 | Ga0495649_0000017 | 3300046694 | Bacteria | 221685 |
| 564 | Ga0495649_0023327 | 3300046694 | Bacteria | 3458 |
| 565 | Ga0495600_0012858 | 3300046809 | Bacteria | 5243 |
| 566 | Ga0495600_0014306 | 3300046809 | Bacteria | 4999 |
| 567 | Ga0495600_0037962 | 3300046809 | Bacteria | 3133 |
| 568 | Ga0495581_0001976 | 3300047315 | Bacteria | 11495 |
| 569 | Ga0495581_0002893 | 3300047315 | Bacteria | 9823 |
| 570 | Ga0495581_0044298 | 3300047315 | Bacteria | 2573 |
| 571 | Ga0495581_0084345 | 3300047315 | Bacteria | 1841 |
| 572 | Ga0495604_0032429 | 3300047317 | Bacteria | 4140 |
| 573 | Ga0495604_0073803 | 3300047317 | Bacteria | 2573 |
| 574 | Ga0495604_0089870 | 3300047317 | Bacteria | 2282 |
| 575 | Ga0495674_0011368 | 3300047319 | Bacteria | 8401 |
| 576 | Ga0495674_0014334 | 3300047319 | Bacteria | 7423 |
| 577 | Ga0495676_0001661 | 3300047321 | Bacteria | 19426 |
| 578 | Ga0495676_0008961 | 3300047321 | Bacteria | 9134 |
| 579 | Ga0495676_0429286 | 3300047321 | Bacteria | 874 |
| 580 | Ga0495680_0005808 | 3300047322 | Bacteria | 11550 |
| 581 | Ga0495680_0017467 | 3300047322 | Bacteria | 6127 |
| 582 | Ga0495687_041841 | 3300047443 | Bacteria | 2007 |
| 583 | Ga0495675_0227374 | 3300047444 | Bacteria | 1127 |
| 584 | Ga0495675_0249437 | 3300047444 | Bacteria | 1067 |
| 585 | Ga0495673_0090672 | 3300047469 | Bacteria | 1250 |
| 586 | Ga0495684_0009819 | 3300047471 | Bacteria | 7386 |
| 587 | Ga0495684_0010690 | 3300047471 | Bacteria | 7096 |
| 588 | Ga0495686_0000178 | 3300047472 | Bacteria | 121468 |
| 589 | Ga0495686_0001621 | 3300047472 | Bacteria | 23566 |
| 590 | Ga0495686_0008419 | 3300047472 | Bacteria | 7568 |
| 591 | Ga0495686_0031962 | 3300047472 | Bacteria | 3409 |
| 592 | Ga0495686_0058154 | 3300047472 | Bacteria | 2411 |
| 593 | Ga0495686_0126738 | 3300047472 | Bacteria | 1517 |
| 594 | Ga0495593_0001102 | 3300047673 | Bacteria | 15762 |
| 595 | Ga0495593_0061551 | 3300047673 | Bacteria | 1963 |
| 596 | Ga0495602_0355123 | 3300048088 | Bacteria | 1057 |
| 597 | Ga0495614_0000972 | 3300048089 | Bacteria | 12208 |
| 598 | Ga0495614_0068526 | 3300048089 | Bacteria | 1528 |
| 599 | Ga0496100_0005780 | 3300048903 | Bacteria | 6692 |
| 600 | Ga0496100_0106136 | 3300048903 | Unclassified | 1944 |
| 601 | Ga0496101_0042419 | 3300048904 | Bacteria | 3247 |
| 602 | Ga0496101_0203968 | 3300048904 | Bacteria | 1529 |
| 603 | Ga0496101_0330005 | 3300048904 | Bacteria | 1197 |
| 604 | Ga0496102_0048627 | 3300048905 | Bacteria | 3856 |
| 605 | Ga0496104_0000053 | 3300048907 | Bacteria | 135895 |
| 606 | Ga0496104_0056645 | 3300048907 | Bacteria | 3708 |
| 607 | Ga0496104_0112862 | 3300048907 | Bacteria | 2606 |
| 608 | Ga0496105_0001615 | 3300048908 | Bacteria | 15999 |
| 609 | Ga0496105_0005740 | 3300048908 | Bacteria | 9452 |
| 610 | Ga0496105_0063911 | 3300048908 | Bacteria | 3037 |
| 611 | Ga0496106_0078284 | 3300048909 | Bacteria | 2536 |
| 612 | Ga0496108_0071573 | 3300048911 | Bacteria | 2926 |
| 613 | Ga0496108_0181015 | 3300048911 | Bacteria | 1825 |
| 614 | Ga0496108_0495528 | 3300048911 | Bacteria | 1067 |
| 615 | Ga0496109_0195218 | 3300048912 | Bacteria | 1902 |
| 616 | Ga0496110_0079754 | 3300048913 | Bacteria | 2915 |
| 617 | Ga0496110_0584967 | 3300048913 | Bacteria | 1013 |
| 618 | Ga0496111_0043001 | 3300048914 | Bacteria | 3246 |
| 619 | Ga0496112_0103201 | 3300048915 | Bacteria | 2821 |
| 620 | Ga0496112_0131339 | 3300048915 | Bacteria | 2475 |
| 621 | Ga0496112_0162231 | 3300048915 | Bacteria | 2202 |
| 622 | Ga0496112_0192441 | 3300048915 | Bacteria | 2001 |
| 623 | Ga0496113_0001193 | 3300048916 | Bacteria | 14220 |
| 624 | Ga0496113_0285461 | 3300048916 | Bacteria | 1320 |
| 625 | Ga0496114_0005321 | 3300048917 | Bacteria | 10057 |
| 626 | Ga0496114_0415038 | 3300048917 | Bacteria | 1192 |
| 627 | Ga0496115_0003110 | 3300048918 | Bacteria | 11925 |
| 628 | Ga0496115_0085005 | 3300048918 | Bacteria | 2580 |
| 629 | Ga0496115_0159540 | 3300048918 | Bacteria | 1864 |
| 630 | Ga0496115_0210018 | 3300048918 | Bacteria | 1608 |
| 631 | Ga0496116_0001728 | 3300048919 | Bacteria | 23852 |
| 632 | Ga0496117_0003269 | 3300048920 | Bacteria | 19047 |
| 633 | Ga0496122_0006115 | 3300048925 | Bacteria | 14014 |
| 634 | Ga0496123_0003787 | 3300048926 | Bacteria | 16562 |
| 635 | Ga0496126_0000014 | 3300048929 | Bacteria | 686881 |
| 636 | Ga0496126_0000100 | 3300048929 | Bacteria | 203706 |
| 637 | Ga0496126_0000154 | 3300048929 | Bacteria | 159983 |
| 638 | Ga0496126_0273933 | 3300048929 | Bacteria | 1400 |
| 639 | Ga0501032_0001912 | 3300049569 | Bacteria | 16446 |
| 640 | Ga0501033_0028282 | 3300049570 | Bacteria | 4213 |
| 641 | Ga0501033_0165396 | 3300049570 | Bacteria | 1590 |
| 642 | Ga0501034_0169330 | 3300049571 | Bacteria | 2152 |
| 643 | Ga0501036_0019400 | 3300049572 | Bacteria | 5708 |
| 644 | Ga0501036_0081969 | 3300049572 | Bacteria | 2726 |
| 645 | Ga0501037_0084065 | 3300049573 | Bacteria | 2305 |
| 646 | Ga0501038_0048143 | 3300049574 | Bacteria | 3690 |
| 647 | Ga0501038_0067879 | 3300049574 | Bacteria | 3033 |
| 648 | Ga0501038_0275352 | 3300049574 | Bacteria | 1326 |
| 649 | Ga0501039_0079801 | 3300049575 | Bacteria | 2546 |
| 650 | Ga0501040_0199735 | 3300049576 | Bacteria | 1419 |
| 651 | Ga0501041_0107506 | 3300049577 | Bacteria | 1729 |
| 652 | Ga0501042_0001950 | 3300049578 | Bacteria | 12427 |
| 653 | Ga0501042_0271022 | 3300049578 | Bacteria | 1226 |
| 654 | Ga0501043_0003983 | 3300049579 | Bacteria | 12094 |
| 655 | Ga0501046_0000056 | 3300049580 | Bacteria | 129342 |
| 656 | Ga0501046_0333955 | 3300049580 | Bacteria | 1103 |
| 657 | Ga0501047_0008947 | 3300049581 | Bacteria | 9454 |
| 658 | Ga0501048_0025123 | 3300049582 | Bacteria | 4343 |
| 659 | Ga0501067_0120289 | 3300049583 | Bacteria | 1461 |
| 660 | Ga0501068_0027744 | 3300049584 | Bacteria | 3345 |
| 661 | Ga0501071_0003551 | 3300049587 | Bacteria | 9762 |
| 662 | Ga0501072_0003556 | 3300049588 | Bacteria | 11728 |
| 663 | Ga0501072_0205735 | 3300049588 | Bacteria | 1569 |
| 664 | Ga0501074_0056654 | 3300049590 | Bacteria | 2825 |
| 665 | Ga0501074_0182161 | 3300049590 | Bacteria | 1498 |
| 666 | Ga0501074_0498123 | 3300049590 | Bacteria | 863 |
| 667 | Ga0501075_0012301 | 3300049591 | Bacteria | 6079 |
| 668 | Ga0501076_0074854 | 3300049592 | Bacteria | 2713 |
| 669 | Ga0501076_0427197 | 3300049592 | Bacteria | 1090 |
| 670 | Ga0501077_0026976 | 3300049593 | Bacteria | 3647 |
| 671 | Ga0501079_0018432 | 3300049741 | Bacteria | 5333 |
| 672 | Ga0501079_0332195 | 3300049741 | Bacteria | 1190 |
| 673 | Ga0501080_0014166 | 3300049742 | Bacteria | 7339 |
| 674 | Ga0501080_0320944 | 3300049742 | Bacteria | 1402 |
| 675 | Ga0501081_0006567 | 3300049743 | Bacteria | 7557 |
| 676 | Ga0501083_0099076 | 3300049744 | Bacteria | 1922 |
| 677 | Ga0501083_0475114 | 3300049744 | Bacteria | 814 |
| 678 | Ga0501035_0044540 | 3300049822 | Bacteria | 3995 |
| 679 | Ga0501035_0222235 | 3300049822 | Bacteria | 1612 |
| 680 | Ga0501044_0027240 | 3300049823 | Bacteria | 6042 |
| 681 | Ga0501044_0095095 | 3300049823 | Bacteria | 3003 |
| 682 | Ga0501044_0361355 | 3300049823 | Bacteria | 1370 |
| 683 | Ga0501045_0161385 | 3300049824 | Bacteria | 1668 |
| 684 | nmdc:mga05p37_506693_c1 | 3300050507 | Bacteria | 1384 |
| 685 | nmdc:mga09592_10254_c1 | 3300050508 | Bacteria | 7626 |
| 686 | nmdc:mga08y16_103557_c1 | 3300050511 | Bacteria | 2963 |
| 687 | nmdc:mga08x19_17719_c1 | 3300050514 | Bacteria | 4361 |
| 688 | Ga0495601_0113830 | 3300053077 | Bacteria | 1753 |
| 689 | Ga0495601_0118423 | 3300053077 | Bacteria | 1719 |
| 690 | Ga0495612_0230001 | 3300053078 | Bacteria | 822 |
| 691 | Ga0495619_0002309 | 3300053085 | Bacteria | 12568 |
| 692 | Ga0500651_0000005 | 3300053093 | Bacteria | 384761 |
| 693 | Ga0500595_000004 | 3300053119 | Bacteria | 410922 |
| 694 | Ga0500595_007997 | 3300053119 | Bacteria | 4343 |
| 695 | Ga0500595_051334 | 3300053119 | Bacteria | 1277 |
| 696 | Ga0501084_0006738 | 3300054114 | Bacteria | 9444 |
| 697 | Ga0501084_0443166 | 3300054114 | Bacteria | 1098 |
| 698 | Ga0501082_0020279 | 3300060353 | Bacteria | 5731 |
| 699 | Ga0466962_0000121 | 3300061719 | Bacteria | 31836 |
| 700 | Ga0530510_0001091 | 3300061734 | Bacteria | 17991 |
| 701 | 2522549306 | 2522125168 | Bacteria | 7376607 |
| 702 | 2722726345 | 2721755487 | Bacteria | 6357185 |
| 703 | 2884217802 | 2884215851 | Bacteria | 4554841 |
| 704 | 2887380526 | 2887375801 | Bacteria | 5334027 |
| 705 | 2896346137 | 2896344016 | Bacteria | 3811746 |
| 706 | 2902051524 | 2902048731 | Bacteria | 4976191 |
| 707 | 2904783769 | 2904780799 | Bacteria | 5840761 |
| 708 | 2911139464 | 2911138879 | Bacteria | 5811561 |
| 709 | 2919181981 | 2919177583 | Bacteria | 5641607 |
| 710 | Ga0068853_100043702 | |||
| 711 | rootH1_10106452 | |||
| 712 | rootH2_10009426 | |||
| 713 | rootH2_10223217 | |||
| 714 | Ga0065165_1000639 | |||
| 715 | Ga0065704_10002415 | |||
| 716 | Ga0070658_10000121 | |||
| 717 | Ga0070658_10021582 | |||
| 718 | Ga0070658_10079725 | |||
| 719 | Ga0070683_100002041 | |||
| 720 | Ga0070683_100034019 | |||
| 721 | Ga0070683_100053355 | |||
| 722 | Ga0070670_100048822 | |||
| 723 | Ga0068869_100026222 | |||
| 724 | Ga0070680_100000986 | |||
| 725 | Ga0070680_100205572 | |||
| 726 | Ga0070680_100247038 | |||
| 727 | Ga0070680_100294798 | |||
| 728 | Ga0070682_100128071 | |||
| 729 | Ga0068868_100000066 | |||
| 730 | Ga0068868_100009078 | |||
| 731 | Ga0068868_100065060 | |||
| 732 | Ga0068868_100081115 | |||
| 733 | Ga0068868_100327777 | |||
| 734 | Ga0070660_100029979 | |||
| 735 | Ga0070660_100052984 | |||
| 736 | Ga0070661_100129713 | |||
| 737 | Ga0070661_100488462 | |||
| 738 | Ga0070668_100272594 | |||
| 739 | Ga0070668_100282585 | |||
| 740 | Ga0070669_100037481 | |||
| 741 | Ga0070669_100163152 | |||
| 742 | Ga0070675_100015083 | |||
| 743 | Ga0070675_100100900 | |||
| 744 | Ga0070671_100019026 | |||
| 745 | Ga0070674_100003653 | |||
| 746 | Ga0070674_100005539 | |||
| 747 | Ga0070674_100007368 | |||
| 748 | Ga0070659_100004580 | |||
| 749 | Ga0070667_100046288 | |||
| 750 | Ga0070667_100355272 | |||
| 751 | Ga0070709_10088765 | |||
| 752 | Ga0070714_100223952 | |||
| 753 | Ga0070713_100018623 | |||
| 754 | Ga0070713_100139431 | |||
| 755 | Ga0070713_100302543 | |||
| 756 | Ga0070710_10007431 | |||
| 757 | Ga0070711_100004729 | |||
| 758 | Ga0070711_100010327 | |||
| 759 | Ga0070711_100115600 | |||
| 760 | Ga0070700_100022140 | |||
| 761 | Ga0070708_100132156 | |||
| 762 | Ga0070663_100299139 | |||
| 763 | Ga0070663_100377747 | |||
| 764 | Ga0070678_100013774 | |||
| 765 | Ga0070678_100040742 | |||
| 766 | Ga0070678_100172880 | |||
| 767 | Ga0070678_100215546 | |||
| 768 | Ga0070681_10028439 | |||
| 769 | Ga0070681_10051676 | |||
| 770 | Ga0070681_10059995 | |||
| 771 | Ga0070681_10072900 | |||
| 772 | Ga0070685_10004403 | |||
| 773 | Ga0070685_10373645 | |||
| 774 | Ga0070706_100009858 | |||
| 775 | Ga0070706_100192849 | |||
| 776 | Ga0070707_100001684 | |||
| 777 | Ga0070679_100000968 | |||
| 778 | Ga0070679_100002610 | |||
| 779 | Ga0070679_100003993 | |||
| 780 | Ga0070679_100092454 | |||
| 781 | Ga0070679_100111123 | |||
| 782 | Ga0070684_100043409 | |||
| 783 | Ga0070684_100107048 | |||
| 784 | Ga0070684_100430167 | |||
| 785 | Ga0070684_100433660 | |||
| 786 | Ga0068853_100000367 | |||
| 787 | Ga0068853_100107800 | |||
| 788 | Ga0070686_100014710 | |||
| 789 | Ga0070665_100013537 | |||
| 790 | Ga0070665_100035648 | |||
| 791 | Ga0070665_100155561 | |||
| 792 | Ga0070704_100184123 | |||
| 793 | Ga0068855_100010384 | |||
| 794 | Ga0068855_100011915 | |||
| 795 | Ga0068855_100035334 | |||
| 796 | Ga0068855_100127193 | |||
| 797 | Ga0068855_100180615 | |||
| 798 | Ga0068855_100182459 | |||
| 799 | Ga0070664_100080620 | |||
| 800 | Ga0070664_100233250 | |||
| 801 | Ga0068857_100003191 | |||
| 802 | Ga0068857_100338048 | |||
| 803 | Ga0068857_100344814 | |||
| 804 | Ga0068854_100000019 | |||
| 805 | Ga0068854_100006821 | |||
| 806 | Ga0068854_100123734 | |||
| 807 | Ga0068854_100284393 | |||
| 808 | Ga0068854_100485092 | |||
| 809 | Ga0068854_100560236 | |||
| 810 | Ga0068856_100033069 | |||
| 811 | Ga0068856_100057606 | |||
| 812 | Ga0068856_100062110 | |||
| 813 | Ga0068852_100097697 | |||
| 814 | Ga0068852_100103163 | |||
| 815 | Ga0068852_100280517 | |||
| 816 | Ga0068852_100981180 | |||
| 817 | Ga0068859_100210649 | |||
| 818 | Ga0068864_100000625 | |||
| 819 | Ga0068864_100032027 | |||
| 820 | Ga0068864_100086854 | |||
| 821 | Ga0068866_10025185 | |||
| 822 | Ga0068866_10057060 | |||
| 823 | Ga0068861_100065980 | |||
| 824 | Ga0068861_100634606 | |||
| 825 | Ga0068851_10016393 | |||
| 826 | Ga0068870_10016531 | |||
| 827 | Ga0068870_10027751 | |||
| 828 | Ga0068863_100001753 | |||
| 829 | Ga0068863_100001814 | |||
| 830 | Ga0068858_100014586 | |||
| 831 | Ga0068858_100077602 | |||
| 832 | Ga0068860_100000689 | |||
| 833 | Ga0068862_100329594 | |||
| 834 | Ga0081455_10051839 | |||
| 835 | Ga0081455_10407649 | |||
| 836 | Ga0081538_10000465 | |||
| 837 | Ga0081540_1004351 | |||
| 838 | Ga0070717_10127876 | |||
| 839 | Ga0070716_100000287 | |||
| 840 | Ga0070712_100002632 | |||
| 841 | Ga0070712_100024471 | |||
| 842 | Ga0070712_100222772 | |||
| 843 | Ga0070712_100292956 | |||
| 844 | Ga0097621_100000116 | |||
| 845 | Ga0097621_100000349 | |||
| 846 | Ga0097621_100241191 | |||
| 847 | Ga0068871_100002325 | |||
| 848 | Ga0075428_100015743 | |||
| 849 | Ga0068865_100013860 | |||
| 850 | Ga0075436_100009109 | |||
| 851 | Ga0097620_100210642 | |||
| 852 | Ga0075435_100131543 | |||
| 853 | Ga0105240_10000001 | |||
| 854 | Ga0105240_10000372 | |||
| 855 | Ga0105240_10009346 | |||
| 856 | Ga0105240_10010838 | |||
| 857 | Ga0105240_10046039 | |||
| 858 | Ga0105240_10122860 | |||
| 859 | Ga0105240_10299137 | |||
| 860 | Ga0105240_10312296 | |||
| 861 | Ga0111539_10427708 | |||
| 862 | Ga0105245_10000486 | |||
| 863 | Ga0105245_10021587 | |||
| 864 | Ga0105245_10283198 | |||
| 865 | Ga0105245_10581286 | |||
| 866 | Ga0105245_10788506 | |||
| 867 | Ga0105247_10002346 | |||
| 868 | Ga0114129_10403567 | |||
| 869 | Ga0105243_10000043 | |||
| 870 | Ga0105243_10006595 | |||
| 871 | Ga0105243_10008481 | |||
| 872 | Ga0105243_10010773 | |||
| 873 | Ga0105241_10002032 | |||
| 874 | Ga0105241_10050871 | |||
| 875 | Ga0105242_10004704 | |||
| 876 | Ga0105248_10000019 | |||
| 877 | Ga0105248_10016372 | |||
| 878 | Ga0105248_10029618 | |||
| 879 | Ga0105248_10108464 | |||
| 880 | Ga0105248_10321320 | |||
| 881 | Ga0105237_10006331 | |||
| 882 | Ga0105237_10055825 | |||
| 883 | Ga0105237_10317658 | |||
| 884 | Ga0105238_10000509 | |||
| 885 | Ga0105238_10026652 | |||
| 886 | Ga0105238_10078759 | |||
| 887 | Ga0105238_10155125 | |||
| 888 | Ga0105238_10286222 | |||
| 889 | Ga0105249_10003449 | |||
| 890 | Ga0105249_10027405 | |||
| 891 | Ga0105239_10129889 | |||
| 892 | Ga0105246_10001192 | |||
| 893 | Ga0105246_10011295 | |||
| 894 | Ga0157371_10152599 | |||
| 895 | Ga0157370_10010879 | |||
| 896 | Ga0157370_10013763 | |||
| 897 | Ga0157370_10046758 | |||
| 898 | Ga0157370_10056931 | |||
| 899 | Ga0157370_10358073 | |||
| 900 | Ga0157370_10368441 | |||
| 901 | Ga0157370_10448778 | |||
| 902 | Ga0157370_10448784 | |||
| 903 | Ga0157369_10009218 | |||
| 904 | Ga0157369_10010533 | |||
| 905 | Ga0157369_10012659 | |||
| 906 | Ga0157369_10044962 | |||
| 907 | Ga0157369_10048503 | |||
| 908 | Ga0157369_10127916 | |||
| 909 | Ga0157369_10168089 | |||
| 910 | Ga0157369_10218919 | |||
| 911 | Ga0157369_10719337 | |||
| 912 | Ga0157374_10023020 | |||
| 913 | Ga0157374_10035016 | |||
| 914 | Ga0157374_10192351 | |||
| 915 | Ga0157378_10000108 | |||
| 916 | Ga0157378_10117504 | |||
| 917 | Ga0157378_10131240 | |||
| 918 | Ga0157378_10139810 | |||
| 919 | Ga0163162_10022177 | |||
| 920 | Ga0163162_10045378 | |||
| 921 | Ga0157372_10010870 | |||
| 922 | Ga0157372_10312122 | |||
| 923 | Ga0157375_10005984 | |||
| 924 | Ga0163163_10001161 | |||
| 925 | Ga0163163_10005969 | |||
| 926 | Ga0163163_10192750 | |||
| 927 | Ga0157380_10157679 | |||
| 928 | Ga0157377_10016037 | |||
| 929 | Ga0157379_10002312 | |||
| 930 | Ga0157376_10023888 | |||
| 931 | Ga0157376_10032166 | |||
| 932 | Ga0157376_10033667 | |||
| 933 | Ga0157376_10243031 | |||
| 934 | Ga0157376_10321136 | |||
| 935 | Ga0182006_1000068 | |||
| 936 | Ga0163161_10310295 | |||
| 937 | Ga0213874_10049873 | |||
| 938 | Ga0213876_10167759 | |||
| 939 | Ga0224570_100026 | |||
| 940 | Ga0224569_101932 | |||
| 941 | Ga0209437_110555 | |||
| 942 | Ga0209233_1001442 | |||
| 943 | Ga0209233_1002363 | |||
| 944 | Ga0209676_1000488 | |||
| 945 | Ga0207692_10004786 | |||
| 946 | Ga0207642_10065207 | |||
| 947 | Ga0207710_10036272 | |||
| 948 | Ga0207688_10102097 | |||
| 949 | Ga0207680_10030474 | |||
| 950 | Ga0207647_10014872 | |||
| 951 | Ga0207647_10272235 | |||
| 952 | Ga0207699_10079051 | |||
| 953 | Ga0207643_10003224 | |||
| 954 | Ga0207643_10008421 | |||
| 955 | Ga0207705_10000021 | |||
| 956 | Ga0207705_10002125 | |||
| 957 | Ga0207705_10027435 | |||
| 958 | Ga0207705_10032912 | |||
| 959 | Ga0207705_10142618 | |||
| 960 | Ga0207684_10020316 | |||
| 961 | Ga0207654_10000808 | |||
| 962 | Ga0207707_10005331 | |||
| 963 | Ga0207707_10020540 | |||
| 964 | Ga0207695_10000001 | |||
| 965 | Ga0207695_10000113 | |||
| 966 | Ga0207695_10000263 | |||
| 967 | Ga0207695_10033351 | |||
| 968 | Ga0207695_10072087 | |||
| 969 | Ga0207695_10101137 | |||
| 970 | Ga0207671_10000065 | |||
| 971 | Ga0207671_10000139 | |||
| 972 | Ga0207671_10188288 | |||
| 973 | Ga0207693_10006209 | |||
| 974 | Ga0207693_10021959 | |||
| 975 | Ga0207693_10214783 | |||
| 976 | Ga0207663_10016545 | |||
| 977 | Ga0207663_10045093 | |||
| 978 | Ga0207663_10244447 | |||
| 979 | Ga0207660_10005756 | |||
| 980 | Ga0207660_10047824 | |||
| 981 | Ga0207660_10146224 | |||
| 982 | Ga0207660_10154371 | |||
| 983 | Ga0207660_10440590 | |||
| 984 | Ga0207657_10022299 | |||
| 985 | Ga0207657_10058470 | |||
| 986 | Ga0207657_10123818 | |||
| 987 | Ga0207649_10069614 | |||
| 988 | Ga0207649_10077505 | |||
| 989 | Ga0207652_10002459 | |||
| 990 | Ga0207652_10005848 | |||
| 991 | Ga0207652_10015711 | |||
| 992 | Ga0207652_10036402 | |||
| 993 | Ga0207652_10217083 | |||
| 994 | Ga0207646_10021685 | |||
| 995 | Ga0207681_10155992 | |||
| 996 | Ga0207681_10177994 | |||
| 997 | Ga0207694_10000711 | |||
| 998 | Ga0207694_10048093 | |||
| 999 | Ga0207694_10121290 | |||
| 1000 | Ga0207694_10163997 | |||
| 1001 | Ga0207694_10359142 | |||
| 1002 | Ga0207650_10136689 | |||
| 1003 | Ga0207650_10141600 | |||
| 1004 | Ga0207659_10289514 | |||
| 1005 | Ga0207687_10000978 | |||
| 1006 | Ga0207687_10002372 | |||
| 1007 | Ga0207687_10563744 | |||
| 1008 | Ga0207700_10003745 | |||
| 1009 | Ga0207700_10163747 | |||
| 1010 | Ga0207664_10319666 | |||
| 1011 | Ga0207644_10004420 | |||
| 1012 | Ga0207644_10222547 | |||
| 1013 | Ga0207690_10128659 | |||
| 1014 | Ga0207690_10213666 | |||
| 1015 | Ga0207709_10000021 | |||
| 1016 | Ga0207709_10017040 | |||
| 1017 | Ga0207709_10068957 | |||
| 1018 | Ga0207670_10088192 | |||
| 1019 | Ga0207669_10003949 | |||
| 1020 | Ga0207669_10009825 | |||
| 1021 | Ga0207669_10038680 | |||
| 1022 | Ga0207704_10004960 | |||
| 1023 | Ga0207704_10353180 | |||
| 1024 | Ga0207665_10000046 | |||
| 1025 | Ga0207665_10006547 | |||
| 1026 | Ga0207691_10150871 | |||
| 1027 | Ga0207711_10000014 | |||
| 1028 | Ga0207711_10043809 | |||
| 1029 | Ga0207711_10044398 | |||
| 1030 | Ga0207711_10661291 | |||
| 1031 | Ga0207689_10000724 | |||
| 1032 | Ga0207689_10016491 | |||
| 1033 | Ga0207661_10001283 | |||
| 1034 | Ga0207661_10055641 | |||
| 1035 | Ga0207661_10059682 | |||
| 1036 | Ga0207661_10070648 | |||
| 1037 | Ga0207679_10132282 | |||
| 1038 | Ga0207679_10171034 | |||
| 1039 | Ga0207667_10007633 | |||
| 1040 | Ga0207667_10012818 | |||
| 1041 | Ga0207667_10025432 | |||
| 1042 | Ga0207667_10060137 | |||
| 1043 | Ga0207667_10264572 | |||
| 1044 | Ga0207667_10714850 | |||
| 1045 | Ga0207651_10056279 | |||
| 1046 | Ga0207712_10101716 | |||
| 1047 | Ga0207640_10000028 | |||
| 1048 | Ga0207640_10008968 | |||
| 1049 | Ga0207640_10472361 | |||
| 1050 | Ga0207658_10003428 | |||
| 1051 | Ga0207677_10000143 | |||
| 1052 | Ga0207677_10232946 | |||
| 1053 | Ga0207677_10261237 | |||
| 1054 | Ga0207703_10004820 | |||
| 1055 | Ga0207703_10097231 | |||
| 1056 | Ga0207703_10272109 | |||
| 1057 | Ga0207639_10000371 | |||
| 1058 | Ga0207639_10016992 | |||
| 1059 | Ga0207639_10490959 | |||
| 1060 | Ga0207678_10017744 | |||
| 1061 | Ga0207678_10056161 | |||
| 1062 | Ga0207678_10149736 | |||
| 1063 | Ga0207678_10264377 | |||
| 1064 | Ga0207678_10440288 | |||
| 1065 | Ga0207678_10442909 | |||
| 1066 | Ga0207708_10005523 | |||
| 1067 | Ga0207702_10017932 | |||
| 1068 | Ga0207641_10168679 | |||
| 1069 | Ga0207641_10342717 | |||
| 1070 | Ga0207648_10167251 | |||
| 1071 | Ga0207648_10564244 | |||
| 1072 | Ga0207676_10002595 | |||
| 1073 | Ga0207676_10052862 | |||
| 1074 | Ga0207676_10074181 | |||
| 1075 | Ga0207674_10000669 | |||
| 1076 | Ga0207674_10222951 | |||
| 1077 | Ga0207675_100029257 | |||
| 1078 | Ga0207675_100200693 | |||
| 1079 | Ga0207683_10043496 | |||
| 1080 | Ga0207683_10079034 | |||
| 1081 | Ga0207683_10233183 | |||
| 1082 | Ga0207698_10105923 | |||
| 1083 | Ga0207698_10220280 | |||
| 1084 | Ga0265356_1000126 | |||
| 1085 | Ga0268266_10005265 | |||
| 1086 | Ga0268266_10006399 | |||
| 1087 | Ga0268266_10274050 | |||
| 1088 | Ga0268265_10205563 | |||
| 1089 | Ga0268265_10316591 | |||
| 1090 | Ga0268265_10500825 | |||
| 1091 | Ga0268264_10000598 | |||
| 1092 | Ga0265338_10040619 | |||
| 1093 | Ga0265762_1000808 | |||
| 1094 | Ga0265762_1010022 | |||
| 1095 | Ga0265770_1002060 | |||
| 1096 | Ga0265771_1001140 | |||
| 1097 | Ga0265760_10000082 | |||
| 1098 | Ga0265760_10001348 | |||
| 1099 | Ga0307408_100000660 | |||
| 1100 | Ga0316579_10046140 | |||
| 1101 | Ga0265314_10019749 | |||
| 1102 | Ga0316576_10006145 | |||
| 1103 | Ga0316576_10151991 | |||
| 1104 | Ga0316577_10060552 | |||
| 1105 | Ga0307413_10170289 | |||
| 1106 | Ga0307410_10361754 | |||
| 1107 | Ga0307412_10082906 | |||
| 1108 | Ga0307414_10026677 | |||
| 1109 | Ga0307414_10084135 | |||
| 1110 | Ga0307414_10212787 | |||
| 1111 | Ga0307411_10050620 | |||
| 1112 | Ga0316585_10084904 | |||
| 1113 | Ga0316580_10005346 | |||
| 1114 | Ga0307510_10010774 | |||
| 1115 | Ga0307510_10071107 | |||
| 1116 | Ga0307510_10094785 | |||
| 1117 | Ga0373923_0048364 | |||
| 1118 | Ga0373936_0015094 | |||
| 1119 | Ga0373936_0052042 | |||
| 1120 | Ga0373945_0014521 | |||
| 1121 | Ga0373956_0021847 | |||
| 1122 | Ga0373924_0116751 | |||
| 1123 | Ga0373935_0009673 | |||
| 1124 | Ga0373935_0040726 | |||
| 1125 | Ga0373927_0156967 | |||
| 1126 | Ga0373927_0170653 | |||
| 1127 | Ga0373947_0001682 | |||
| 1128 | Ga0373947_0007151 | |||
| 1129 | Ga0373947_0044923 | |||
| 1130 | Ga0373947_0085542 | |||
| 1131 | Ga0373937_0000199 | |||
| 1132 | Ga0373937_0019961 | |||
| 1133 | Ga0373937_0029447 | |||
| 1134 | Ga0316584_0172474 | |||
| 1135 | Ga0373925_0011183 | |||
| 1136 | Ga0373925_0012072 | |||
| 1137 | Ga0373925_0035446 | |||
| 1138 | Ga0373925_0057418 | |||
| 1139 | Ga0395900_0025848 | |||
| 1140 | Ga0395900_0046312 | |||
| 1141 | Ga0395900_0465767 | |||
| 1142 | Ga0395905_0492983 | |||
| 1143 | Ga0395901_0476043 | |||
| 1144 | Ga0400489_71328 | |||
| 1145 | Ga0436365_1607100 | |||
| 1146 | Ga0436363_0684479 | |||
| 1147 | Ga0439457_010856 | |||
| 1148 | Ga0466969_0149492 | |||
| 1149 | Ga0466965_0004348 | |||
| 1150 | Ga0466966_0164880 | |||
| 1151 | Ga0466961_0001506 | |||
| 1152 | Ga0466971_0001983 | |||
| 1153 | Ga0466970_0050725 | |||
| 1154 | Ga0466957_0000702 | |||
| 1155 | Ga0466957_0712715 | |||
| 1156 | Ga0466959_0003421 | |||
| 1157 | Ga0466958_0115891 | |||
| 1158 | Ga0466967_0034277 | |||
| 1159 | Ga0495627_004479 | |||
| 1160 | Ga0495592_0047500 | |||
| 1161 | Ga0495603_0009924 | |||
| 1162 | Ga0495603_0048079 | |||
| 1163 | Ga0495603_0126847 | |||
| 1164 | Ga0495603_0262828 | |||
| 1165 | Ga0495629_0011020 | |||
| 1166 | Ga0495629_0049585 | |||
| 1167 | Ga0495629_0075929 | |||
| 1168 | Ga0495641_0000681 | |||
| 1169 | Ga0495651_0067062 | |||
| 1170 | Ga0495651_0070949 | |||
| 1171 | Ga0495651_0163141 | |||
| 1172 | Ga0495651_0266601 | |||
| 1173 | Ga0495653_0010749 | |||
| 1174 | Ga0495653_0089319 | |||
| 1175 | Ga0495650_0000038 | |||
| 1176 | Ga0495650_0000087 | |||
| 1177 | Ga0495650_0002342 | |||
| 1178 | Ga0495580_0005628 | |||
| 1179 | Ga0495580_0034332 | |||
| 1180 | Ga0495580_0041316 | |||
| 1181 | Ga0495580_0058878 | |||
| 1182 | Ga0495580_0103353 | |||
| 1183 | Ga0495582_0000643 | |||
| 1184 | Ga0495582_0001853 | |||
| 1185 | Ga0495582_0067225 | |||
| 1186 | Ga0495582_0080396 | |||
| 1187 | Ga0495639_0002049 | |||
| 1188 | Ga0495639_0004538 | |||
| 1189 | Ga0495662_0001214 | |||
| 1190 | Ga0495664_0001348 | |||
| 1191 | Ga0495664_0036690 | |||
| 1192 | Ga0495664_0049296 | |||
| 1193 | Ga0495584_0058377 | |||
| 1194 | Ga0495585_0000286 | |||
| 1195 | Ga0495585_0025037 | |||
| 1196 | Ga0495594_0001190 | |||
| 1197 | Ga0495594_0004431 | |||
| 1198 | Ga0495594_0017006 | |||
| 1199 | Ga0495594_0043704 | |||
| 1200 | Ga0495594_0056792 | |||
| 1201 | Ga0495583_0050307 | |||
| 1202 | Ga0495606_0000052 | |||
| 1203 | Ga0495606_0076509 | |||
| 1204 | Ga0495606_0089617 | |||
| 1205 | Ga0495608_0171818 | |||
| 1206 | Ga0495610_0087725 | |||
| 1207 | Ga0495616_0005196 | |||
| 1208 | Ga0495618_0037508 | |||
| 1209 | Ga0495618_0081798 | |||
| 1210 | Ga0495628_0015738 | |||
| 1211 | Ga0495628_0033438 | |||
| 1212 | Ga0495628_0199156 | |||
| 1213 | Ga0495630_0169403 | |||
| 1214 | Ga0495630_0188567 | |||
| 1215 | Ga0495631_0010490 | |||
| 1216 | Ga0495644_0000048 | |||
| 1217 | Ga0495666_0024917 | |||
| 1218 | Ga0495652_0006640 | |||
| 1219 | Ga0495652_0020823 | |||
| 1220 | Ga0495652_0263793 | |||
| 1221 | Ga0495665_0009651 | |||
| 1222 | Ga0495665_0037967 | |||
| 1223 | Ga0495665_0047858 | |||
| 1224 | Ga0495665_0186240 | |||
| 1225 | Ga0495640_0004801 | |||
| 1226 | Ga0495640_0027681 | |||
| 1227 | Ga0495586_0019711 | |||
| 1228 | Ga0495586_0052639 | |||
| 1229 | Ga0495587_0007267 | |||
| 1230 | Ga0495587_0016961 | |||
| 1231 | Ga0495587_0251359 | |||
| 1232 | Ga0495645_0004272 | |||
| 1233 | Ga0495645_0039222 | |||
| 1234 | Ga0495645_0120435 | |||
| 1235 | Ga0495645_0206604 | |||
| 1236 | Ga0495645_0244933 | |||
| 1237 | Ga0495633_0013243 | |||
| 1238 | Ga0495667_0027898 | |||
| 1239 | Ga0495667_0039064 | |||
| 1240 | Ga0495667_0347438 | |||
| 1241 | Ga0495668_0053449 | |||
| 1242 | Ga0495634_0006225 | |||
| 1243 | Ga0495611_0005877 | |||
| 1244 | Ga0495625_0000036 | |||
| 1245 | Ga0495625_0000985 | |||
| 1246 | Ga0495625_0017473 | |||
| 1247 | Ga0495625_0026175 | |||
| 1248 | Ga0495625_0034121 | |||
| 1249 | Ga0495625_0263232 | |||
| 1250 | Ga0495635_0001587 | |||
| 1251 | Ga0495635_0002836 | |||
| 1252 | Ga0495635_0127751 | |||
| 1253 | Ga0495635_0172193 | |||
| 1254 | Ga0495661_0015900 | |||
| 1255 | Ga0495588_0068626 | |||
| 1256 | Ga0495657_0329562 | |||
| 1257 | Ga0495599_0037006 | |||
| 1258 | Ga0495599_0048151 | |||
| 1259 | Ga0495599_0106580 | |||
| 1260 | Ga0495623_0071905 | |||
| 1261 | Ga0495623_0073201 | |||
| 1262 | Ga0495623_0151262 | |||
| 1263 | Ga0495646_0013211 | |||
| 1264 | Ga0495646_0032680 | |||
| 1265 | Ga0495658_0000432 | |||
| 1266 | Ga0495658_0157788 | |||
| 1267 | Ga0495658_0159853 | |||
| 1268 | Ga0495613_0003966 | |||
| 1269 | Ga0495624_0007524 | |||
| 1270 | Ga0495624_0016847 | |||
| 1271 | Ga0495671_0072938 | |||
| 1272 | Ga0495649_0000017 | |||
| 1273 | Ga0495649_0023327 | |||
| 1274 | Ga0495600_0012858 | |||
| 1275 | Ga0495600_0014306 | |||
| 1276 | Ga0495600_0037962 | |||
| 1277 | Ga0495581_0001976 | |||
| 1278 | Ga0495581_0002893 | |||
| 1279 | Ga0495581_0044298 | |||
| 1280 | Ga0495581_0084345 | |||
| 1281 | Ga0495604_0032429 | |||
| 1282 | Ga0495604_0073803 | |||
| 1283 | Ga0495604_0089870 | |||
| 1284 | Ga0495674_0011368 | |||
| 1285 | Ga0495674_0014334 | |||
| 1286 | Ga0495676_0001661 | |||
| 1287 | Ga0495676_0008961 | |||
| 1288 | Ga0495676_0429286 | |||
| 1289 | Ga0495680_0005808 | |||
| 1290 | Ga0495680_0017467 | |||
| 1291 | Ga0495687_041841 | |||
| 1292 | Ga0495675_0227374 | |||
| 1293 | Ga0495675_0249437 | |||
| 1294 | Ga0495673_0090672 | |||
| 1295 | Ga0495684_0009819 | |||
| 1296 | Ga0495684_0010690 | |||
| 1297 | Ga0495686_0000178 | |||
| 1298 | Ga0495686_0001621 | |||
| 1299 | Ga0495686_0008419 | |||
| 1300 | Ga0495686_0031962 | |||
| 1301 | Ga0495686_0058154 | |||
| 1302 | Ga0495686_0126738 | |||
| 1303 | Ga0495593_0001102 | |||
| 1304 | Ga0495593_0061551 | |||
| 1305 | Ga0495602_0355123 | |||
| 1306 | Ga0495614_0000972 | |||
| 1307 | Ga0495614_0068526 | |||
| 1308 | Ga0496100_0005780 | |||
| 1309 | Ga0496100_0106136 | |||
| 1310 | Ga0496101_0042419 | |||
| 1311 | Ga0496101_0203968 | |||
| 1312 | Ga0496101_0330005 | |||
| 1313 | Ga0496102_0048627 | |||
| 1314 | Ga0496104_0000053 | |||
| 1315 | Ga0496104_0056645 | |||
| 1316 | Ga0496104_0112862 | |||
| 1317 | Ga0496105_0001615 | |||
| 1318 | Ga0496105_0005740 | |||
| 1319 | Ga0496105_0063911 | |||
| 1320 | Ga0496106_0078284 | |||
| 1321 | Ga0496108_0071573 | |||
| 1322 | Ga0496108_0181015 | |||
| 1323 | Ga0496108_0495528 | |||
| 1324 | Ga0496109_0195218 | |||
| 1325 | Ga0496110_0079754 | |||
| 1326 | Ga0496110_0584967 | |||
| 1327 | Ga0496111_0043001 | |||
| 1328 | Ga0496112_0103201 | |||
| 1329 | Ga0496112_0131339 | |||
| 1330 | Ga0496112_0162231 | |||
| 1331 | Ga0496112_0192441 | |||
| 1332 | Ga0496113_0001193 | |||
| 1333 | Ga0496113_0285461 | |||
| 1334 | Ga0496114_0005321 | |||
| 1335 | Ga0496114_0415038 | |||
| 1336 | Ga0496115_0003110 | |||
| 1337 | Ga0496115_0085005 | |||
| 1338 | Ga0496115_0159540 | |||
| 1339 | Ga0496115_0210018 | |||
| 1340 | Ga0496116_0001728 | |||
| 1341 | Ga0496117_0003269 | |||
| 1342 | Ga0496122_0006115 | |||
| 1343 | Ga0496123_0003787 | |||
| 1344 | Ga0496126_0000014 | |||
| 1345 | Ga0496126_0000100 | |||
| 1346 | Ga0496126_0000154 | |||
| 1347 | Ga0496126_0273933 | |||
| 1348 | Ga0501032_0001912 | |||
| 1349 | Ga0501033_0028282 | |||
| 1350 | Ga0501033_0165396 | |||
| 1351 | Ga0501034_0169330 | |||
| 1352 | Ga0501036_0019400 | |||
| 1353 | Ga0501036_0081969 | |||
| 1354 | Ga0501037_0084065 | |||
| 1355 | Ga0501038_0048143 | |||
| 1356 | Ga0501038_0067879 | |||
| 1357 | Ga0501038_0275352 | |||
| 1358 | Ga0501039_0079801 | |||
| 1359 | Ga0501040_0199735 | |||
| 1360 | Ga0501041_0107506 | |||
| 1361 | Ga0501042_0001950 | |||
| 1362 | Ga0501042_0271022 | |||
| 1363 | Ga0501043_0003983 | |||
| 1364 | Ga0501046_0000056 | |||
| 1365 | Ga0501046_0333955 | |||
| 1366 | Ga0501047_0008947 | |||
| 1367 | Ga0501048_0025123 | |||
| 1368 | Ga0501067_0120289 | |||
| 1369 | Ga0501068_0027744 | |||
| 1370 | Ga0501071_0003551 | |||
| 1371 | Ga0501072_0003556 | |||
| 1372 | Ga0501072_0205735 | |||
| 1373 | Ga0501074_0056654 | |||
| 1374 | Ga0501074_0182161 | |||
| 1375 | Ga0501074_0498123 | |||
| 1376 | Ga0501075_0012301 | |||
| 1377 | Ga0501076_0074854 | |||
| 1378 | Ga0501076_0427197 | |||
| 1379 | Ga0501077_0026976 | |||
| 1380 | Ga0501079_0018432 | |||
| 1381 | Ga0501079_0332195 | |||
| 1382 | Ga0501080_0014166 | |||
| 1383 | Ga0501080_0320944 | |||
| 1384 | Ga0501081_0006567 | |||
| 1385 | Ga0501083_0099076 | |||
| 1386 | Ga0501083_0475114 | |||
| 1387 | Ga0501035_0044540 | |||
| 1388 | Ga0501035_0222235 | |||
| 1389 | Ga0501044_0027240 | |||
| 1390 | Ga0501044_0095095 | |||
| 1391 | Ga0501044_0361355 | |||
| 1392 | Ga0501045_0161385 | |||
| 1393 | nmdc:mga05p37_506693_c1 | |||
| 1394 | nmdc:mga09592_10254_c1 | |||
| 1395 | nmdc:mga08y16_103557_c1 | |||
| 1396 | nmdc:mga08x19_17719_c1 | |||
| 1397 | Ga0495601_0113830 | |||
| 1398 | Ga0495601_0118423 | |||
| 1399 | Ga0495612_0230001 | |||
| 1400 | Ga0495619_0002309 | |||
| 1401 | Ga0500651_0000005 | |||
| 1402 | Ga0500595_000004 | |||
| 1403 | Ga0500595_007997 | |||
| 1404 | Ga0500595_051334 | |||
| 1405 | Ga0501084_0006738 | |||
| 1406 | Ga0501084_0443166 | |||
| 1407 | Ga0501082_0020279 | |||
| 1408 | Ga0466962_0000121 | |||
| 1409 | Ga0530510_0001091 | |||
| 1410 | 2522549306 | |||
| 1411 | 2722726345 | |||
| 1412 | 2884217802 | |||
| 1413 | 2887380526 | |||
| 1414 | 2896346137 | |||
| 1415 | 2902051524 | |||
| 1416 | 2904783769 | |||
| 1417 | 2911139464 | |||
| 1418 | 2919181981 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6vdg-assembly1.cif.gz_A | crystal structure of the y182a hisf mutant from thermotoga maritima | 0.974 | 3 | 257 |
| 6vdg-assembly1.cif.gz_A | crystal structure of the y182a hisf mutant from thermotoga maritima | 0.97 | 3 | 257 |
| 1gpw-assembly2.cif.gz_C | structural evidence for ammonia tunneling across the (beta/alpha)8 barrel of the imidazole glycerol phosphate synthase bienzyme complex. | 0.9677 | 1 | 259 |
| 2wjz-assembly2.cif.gz_E | crystal structure of (hish) k181a y138a mutant of imidazoleglycerolphosphate synthase (hish hisf) which displays constitutive glutaminase activity | 0.9676 | 1 | 258 |
| 7qc9-assembly1.cif.gz_A | hisf-c9a-d11e-v33a_l50h_i52h mutant in complex with ni(ii) from t. maritima | 0.9669 | 2 | 257 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FUU3_1_249_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.961 | 1 | 250 | 3.20.20.70 |
| af_Q57854_1_272_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9596 | 1 | 258 | 3.20.20.70 |
| af_Q57854_1_272_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9528 | 1 | 258 | 3.20.20.70 |
| af_P60664_1_258_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9509 | 1 | 258 | 3.20.20.70 |
| af_P60664_1_258_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9473 | 1 | 258 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A352GHN9-F1-model_v4 | Imidazole glycerol phosphate synthase subunit HisF (IGP synthase subunit HisF) (ImGP synthase subunit HisF) | 0.9939 | 145 | 257 |
GO:0000105
GO:0000107 |
| AF-A0A3D5UUN4-F1-model_v4 | Imidazole glycerol phosphate synthase subunit HisF (IGP synthase subunit HisF) (ImGP synthase subunit HisF) | 0.9926 | 145 | 257 |
GO:0000105
GO:0000107 |
| AF-A0A354XIR3-F1-model_v4 | Imidazole glycerol phosphate synthase subunit HisF | 0.9918 | 145 | 257 |
GO:0000105
GO:0000107 |
| AF-A0A7V4PQW7-F1-model_v4 | imidazole glycerol-phosphate synthase (EC 4.3.2.10) (IGP synthase cyclase subunit) | 0.9907 | 43 | 256 |
GO:0000105
GO:0000107 GO:0016829 |
| AF-A0A645CJV2-F1-model_v4 | imidazole glycerol-phosphate synthase (EC 4.3.2.10) | 0.9899 | 63 | 258 |
GO:0000105
GO:0000107 GO:0016829 |