F476643

General Info

Members Datasets Scaffolds Average Seq Length
709 347 1418 250

Family's Representative Sequence

Representative Sequence 3300005539|Ga0068853_100043702|Ga0068853_1000437022
Length 290
Sequence VPSDPLHPRKQNPDFDPDRRQSCLSGAPHLPGAPRLAKRIIACLDVDAGRVVKGVQFQQLRDAGDPAELAVAHASAGADEIVLLDVTATNEGRETLAETVRRAARDLFVPFTVGGGIRTLADAAKVFDAGADKVSINSAALANPKLISEIAGRFGSQAVIVAIDARRGTGPADTAEVFVSGGRTATGKKALQWACEAQERGAGEILLTSMDRDGTGLGFDCELTSAVASSVSIPVIASGGAGNAQHFVDVFSSGHADAALAASIFHFGTHAVADLKQTLLRAGVPMRWPC

Samples

Sample ID Description Type Environment
1 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
99 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
100 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
101 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
102 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
103 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
104 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
164 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
168 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300031010 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
173 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
174 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
175 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
176 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
177 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
178 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
179 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
180 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
181 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
182 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
183 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
184 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
185 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
186 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
187 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
188 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
189 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
190 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
191 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
192 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
193 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
194 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
195 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
196 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
197 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
198 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
199 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
200 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
201 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
202 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
203 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
204 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
205 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
206 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
207 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
208 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
209 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
210 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
211 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
212 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
213 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
214 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
215 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
216 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
217 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
218 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
219 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
220 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
221 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
222 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
223 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
224 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
225 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
226 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
227 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
228 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
229 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
230 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
231 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
232 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
233 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
234 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
235 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
236 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
237 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
238 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
239 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
240 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
241 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
242 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
243 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
244 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
245 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
246 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
247 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
248 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
249 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
250 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
251 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
252 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
253 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
254 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
255 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
256 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
257 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
258 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
259 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
260 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
261 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
262 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
263 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
264 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
265 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
266 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
267 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
268 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
269 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
270 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
271 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
272 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
273 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
274 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
275 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
276 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
277 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
278 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
279 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
280 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
281 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
282 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
283 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
284 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
285 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
286 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
287 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
288 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
289 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
290 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
291 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
292 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
293 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
294 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
295 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
296 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
297 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
304 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
311 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
312 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
313 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
314 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
315 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
316 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
317 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
318 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
319 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
320 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
321 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
322 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
323 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
325 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
326 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
327 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
328 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
329 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
330 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
331 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
332 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
333 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
334 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
335 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
336 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
337 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
338 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
339 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
340 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
341 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere
342 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
343 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
344 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
345 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
346 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
347 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.88
Metatranscriptomes 0.85
Isolates 1.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.27
Nodule 0
Rhizoplane 4.51
Rhizosphere 91.54
Stem 0
Stem Tuber 0
Unclassified 1.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068853_100043702 3300005539 Bacteria 3833
2 rootH1_10106452 3300003316 Bacteria 2104
3 rootH2_10009426 3300003320 Bacteria 39179
4 rootH2_10223217 3300003320 Bacteria 1214
5 Ga0065165_1000639 3300005262 Bacteria 50701
6 Ga0065704_10002415 3300005289 Bacteria 5278
7 Ga0070658_10000121 3300005327 Bacteria 70439
8 Ga0070658_10021582 3300005327 Bacteria 5160
9 Ga0070658_10079725 3300005327 Bacteria 2689
10 Ga0070683_100002041 3300005329 Bacteria 15901
11 Ga0070683_100034019 3300005329 Bacteria 4652
12 Ga0070683_100053355 3300005329 Bacteria 3746
13 Ga0070670_100048822 3300005331 Bacteria 3641
14 Ga0068869_100026222 3300005334 Bacteria 4054
15 Ga0070680_100000986 3300005336 Bacteria 20202
16 Ga0070680_100205572 3300005336 Bacteria 1661
17 Ga0070680_100247038 3300005336 Bacteria 1508
18 Ga0070680_100294798 3300005336 Bacteria 1375
19 Ga0070682_100128071 3300005337 Unclassified 1714
20 Ga0068868_100000066 3300005338 Bacteria 59945
21 Ga0068868_100009078 3300005338 Bacteria 7140
22 Ga0068868_100065060 3300005338 Bacteria 2896
23 Ga0068868_100081115 3300005338 Bacteria 2600
24 Ga0068868_100327777 3300005338 Bacteria 1306
25 Ga0070660_100029979 3300005339 Bacteria 4079
26 Ga0070660_100052984 3300005339 Bacteria 3129
27 Ga0070661_100129713 3300005344 Bacteria 1893
28 Ga0070661_100488462 3300005344 Bacteria 984
29 Ga0070668_100272594 3300005347 Bacteria 1411
30 Ga0070668_100282585 3300005347 Bacteria 1387
31 Ga0070669_100037481 3300005353 Bacteria 3517
32 Ga0070669_100163152 3300005353 Bacteria 1733
33 Ga0070675_100015083 3300005354 Bacteria 6103
34 Ga0070675_100100900 3300005354 Bacteria 2431
35 Ga0070671_100019026 3300005355 Bacteria 5586
36 Ga0070674_100003653 3300005356 Bacteria 8667
37 Ga0070674_100005539 3300005356 Bacteria 7301
38 Ga0070674_100007368 3300005356 Bacteria 6488
39 Ga0070659_100004580 3300005366 Bacteria 9889
40 Ga0070667_100046288 3300005367 Bacteria 3659
41 Ga0070667_100355272 3300005367 Bacteria 1327
42 Ga0070709_10088765 3300005434 Bacteria 2034
43 Ga0070714_100223952 3300005435 Unclassified 1730
44 Ga0070713_100018623 3300005436 Bacteria 5277
45 Ga0070713_100139431 3300005436 Bacteria 2146
46 Ga0070713_100302543 3300005436 Bacteria 1472
47 Ga0070710_10007431 3300005437 Bacteria 5307
48 Ga0070711_100004729 3300005439 Bacteria 8065
49 Ga0070711_100010327 3300005439 Bacteria 5776
50 Ga0070711_100115600 3300005439 Bacteria 1976
51 Ga0070700_100022140 3300005441 Bacteria 3702
52 Ga0070708_100132156 3300005445 Bacteria 2310
53 Ga0070663_100299139 3300005455 Bacteria 1287
54 Ga0070663_100377747 3300005455 Bacteria 1153
55 Ga0070678_100013774 3300005456 Bacteria 5080
56 Ga0070678_100040742 3300005456 Bacteria 3288
57 Ga0070678_100172880 3300005456 Bacteria 1761
58 Ga0070678_100215546 3300005456 Bacteria 1593
59 Ga0070681_10028439 3300005458 Bacteria 5620
60 Ga0070681_10051676 3300005458 Bacteria 4099
61 Ga0070681_10059995 3300005458 Unclassified 3782
62 Ga0070681_10072900 3300005458 Bacteria 3396
63 Ga0070685_10004403 3300005466 Bacteria 7113
64 Ga0070685_10373645 3300005466 Bacteria 980
65 Ga0070706_100009858 3300005467 Bacteria 8876
66 Ga0070706_100192849 3300005467 Unclassified 1904
67 Ga0070707_100001684 3300005468 Bacteria 21318
68 Ga0070679_100000968 3300005530 Bacteria 24975
69 Ga0070679_100002610 3300005530 Bacteria 16386
70 Ga0070679_100003993 3300005530 Bacteria 13587
71 Ga0070679_100092454 3300005530 Bacteria 3012
72 Ga0070679_100111123 3300005530 Bacteria 2727
73 Ga0070684_100043409 3300005535 Bacteria 3882
74 Ga0070684_100107048 3300005535 Bacteria 2504
75 Ga0070684_100430167 3300005535 Bacteria 1219
76 Ga0070684_100433660 3300005535 Bacteria 1214
77 Ga0068853_100000367 3300005539 Bacteria 31060
78 Ga0068853_100107800 3300005539 Bacteria 2470
79 Ga0070686_100014710 3300005544 Bacteria 4516
80 Ga0070665_100013537 3300005548 Bacteria 8205
81 Ga0070665_100035648 3300005548 Bacteria 5003
82 Ga0070665_100155561 3300005548 Bacteria 2288
83 Ga0070704_100184123 3300005549 Bacteria 1673
84 Ga0068855_100010384 3300005563 Bacteria 11233
85 Ga0068855_100011915 3300005563 Bacteria 10511
86 Ga0068855_100035334 3300005563 Bacteria 5953
87 Ga0068855_100127193 3300005563 Bacteria 2912
88 Ga0068855_100180615 3300005563 Bacteria 2386
89 Ga0068855_100182459 3300005563 Bacteria 2372
90 Ga0070664_100080620 3300005564 Bacteria 2803
91 Ga0070664_100233250 3300005564 Bacteria 1650
92 Ga0068857_100003191 3300005577 Bacteria 13595
93 Ga0068857_100338048 3300005577 Bacteria 1393
94 Ga0068857_100344814 3300005577 Bacteria 1378
95 Ga0068854_100000019 3300005578 Bacteria 134145
96 Ga0068854_100006821 3300005578 Bacteria 7282
97 Ga0068854_100123734 3300005578 Bacteria 1967
98 Ga0068854_100284393 3300005578 Bacteria 1333
99 Ga0068854_100485092 3300005578 Bacteria 1038
100 Ga0068854_100560236 3300005578 Bacteria 971
101 Ga0068856_100033069 3300005614 Bacteria 5063
102 Ga0068856_100057606 3300005614 Bacteria 3836
103 Ga0068856_100062110 3300005614 Bacteria 3690
104 Ga0068852_100097697 3300005616 Bacteria 2642
105 Ga0068852_100103163 3300005616 Bacteria 2579
106 Ga0068852_100280517 3300005616 Bacteria 1606
107 Ga0068852_100981180 3300005616 Bacteria 863
108 Ga0068859_100210649 3300005617 Bacteria 2030
109 Ga0068864_100000625 3300005618 Bacteria 29830
110 Ga0068864_100032027 3300005618 Bacteria 4464
111 Ga0068864_100086854 3300005618 Bacteria 2753
112 Ga0068866_10025185 3300005718 Bacteria 2794
113 Ga0068866_10057060 3300005718 Bacteria 2010
114 Ga0068861_100065980 3300005719 Bacteria 2789
115 Ga0068861_100634606 3300005719 Bacteria 985
116 Ga0068851_10016393 3300005834 Bacteria 3544
117 Ga0068870_10016531 3300005840 Bacteria 3527
118 Ga0068870_10027751 3300005840 Bacteria 2835
119 Ga0068863_100001753 3300005841 Bacteria 21524
120 Ga0068863_100001814 3300005841 Bacteria 21208
121 Ga0068858_100014586 3300005842 Bacteria 7404
122 Ga0068858_100077602 3300005842 Bacteria 3086
123 Ga0068860_100000689 3300005843 Bacteria 38878
124 Ga0068862_100329594 3300005844 Bacteria 1411
125 Ga0081455_10051839 3300005937 Bacteria 3517
126 Ga0081455_10407649 3300005937 Bacteria 941
127 Ga0081538_10000465 3300005981 Bacteria 45439
128 Ga0081540_1004351 3300005983 Bacteria 10839
129 Ga0070717_10127876 3300006028 Bacteria 2183
130 Ga0070716_100000287 3300006173 Bacteria 20418
131 Ga0070712_100002632 3300006175 Bacteria 11078
132 Ga0070712_100024471 3300006175 Bacteria 4003
133 Ga0070712_100222772 3300006175 Bacteria 1494
134 Ga0070712_100292956 3300006175 Bacteria 1315
135 Ga0097621_100000116 3300006237 Bacteria 45553
136 Ga0097621_100000349 3300006237 Bacteria 31779
137 Ga0097621_100241191 3300006237 Bacteria 1580
138 Ga0068871_100002325 3300006358 Bacteria 12946
139 Ga0075428_100015743 3300006844 Bacteria 8378
140 Ga0068865_100013860 3300006881 Bacteria 5110
141 Ga0075436_100009109 3300006914 Bacteria 6792
142 Ga0097620_100210642 3300006931 Bacteria 2030
143 Ga0075435_100131543 3300007076 Bacteria 2094
144 Ga0105240_10000001 3300009093 Bacteria 2887840
145 Ga0105240_10000372 3300009093 Bacteria 84325
146 Ga0105240_10009346 3300009093 Bacteria 13895
147 Ga0105240_10010838 3300009093 Bacteria 12767
148 Ga0105240_10046039 3300009093 Bacteria 5530
149 Ga0105240_10122860 3300009093 Bacteria 3124
150 Ga0105240_10299137 3300009093 Bacteria 1841
151 Ga0105240_10312296 3300009093 Bacteria 1794
152 Ga0111539_10427708 3300009094 Bacteria 1542
153 Ga0105245_10000486 3300009098 Bacteria 36378
154 Ga0105245_10021587 3300009098 Bacteria 5650
155 Ga0105245_10283198 3300009098 Bacteria 1621
156 Ga0105245_10581286 3300009098 Bacteria 1145
157 Ga0105245_10788506 3300009098 Bacteria 988
158 Ga0105247_10002346 3300009101 Bacteria 12922
159 Ga0114129_10403567 3300009147 Bacteria 1801
160 Ga0105243_10000043 3300009148 Bacteria 158809
161 Ga0105243_10006595 3300009148 Bacteria 8966
162 Ga0105243_10008481 3300009148 Bacteria 7889
163 Ga0105243_10010773 3300009148 Bacteria 6920
164 Ga0105241_10002032 3300009174 Bacteria 15308
165 Ga0105241_10050871 3300009174 Bacteria 3158
166 Ga0105242_10004704 3300009176 Bacteria 10568
167 Ga0105248_10000019 3300009177 Bacteria 285766
168 Ga0105248_10016372 3300009177 Bacteria 8160
169 Ga0105248_10029618 3300009177 Bacteria 6107
170 Ga0105248_10108464 3300009177 Bacteria 3131
171 Ga0105248_10321320 3300009177 Bacteria 1743
172 Ga0105237_10006331 3300009545 Bacteria 13155
173 Ga0105237_10055825 3300009545 Bacteria 3955
174 Ga0105237_10317658 3300009545 Bacteria 1561
175 Ga0105238_10000509 3300009551 Bacteria 40868
176 Ga0105238_10026652 3300009551 Bacteria 5892
177 Ga0105238_10078759 3300009551 Bacteria 3286
178 Ga0105238_10155125 3300009551 Bacteria 2265
179 Ga0105238_10286222 3300009551 Bacteria 1630
180 Ga0105249_10003449 3300009553 Bacteria 13698
181 Ga0105249_10027405 3300009553 Bacteria 5140
182 Ga0105239_10129889 3300010375 Bacteria 2801
183 Ga0105246_10001192 3300011119 Bacteria 15150
184 Ga0105246_10011295 3300011119 Bacteria 5541
185 Ga0157371_10152599 3300013102 Bacteria 1648
186 Ga0157370_10010879 3300013104 Bacteria 9556
187 Ga0157370_10013763 3300013104 Bacteria 8313
188 Ga0157370_10046758 3300013104 Unclassified 4149
189 Ga0157370_10056931 3300013104 Bacteria 3720
190 Ga0157370_10358073 3300013104 Bacteria 1345
191 Ga0157370_10368441 3300013104 Bacteria 1324
192 Ga0157370_10448778 3300013104 Bacteria 1186
193 Ga0157370_10448784 3300013104 Bacteria 1186
194 Ga0157369_10009218 3300013105 Bacteria 11289
195 Ga0157369_10010533 3300013105 Bacteria 10523
196 Ga0157369_10012659 3300013105 Bacteria 9566
197 Ga0157369_10044962 3300013105 Bacteria 4804
198 Ga0157369_10048503 3300013105 Bacteria 4608
199 Ga0157369_10127916 3300013105 Bacteria 2692
200 Ga0157369_10168089 3300013105 Bacteria 2312
201 Ga0157369_10218919 3300013105 Bacteria 1993
202 Ga0157369_10719337 3300013105 Bacteria 1028
203 Ga0157374_10023020 3300013296 Bacteria 5565
204 Ga0157374_10035016 3300013296 Bacteria 4591
205 Ga0157374_10192351 3300013296 Bacteria 1996
206 Ga0157378_10000108 3300013297 Bacteria 78677
207 Ga0157378_10117504 3300013297 Bacteria 2447
208 Ga0157378_10131240 3300013297 Bacteria 2319
209 Ga0157378_10139810 3300013297 Bacteria 2248
210 Ga0163162_10022177 3300013306 Bacteria 6259
211 Ga0163162_10045378 3300013306 Bacteria 4403
212 Ga0157372_10010870 3300013307 Bacteria 9688
213 Ga0157372_10312122 3300013307 Bacteria 1830
214 Ga0157375_10005984 3300013308 Bacteria 10610
215 Ga0163163_10001161 3300014325 Bacteria 22403
216 Ga0163163_10005969 3300014325 Bacteria 10594
217 Ga0163163_10192750 3300014325 Bacteria 2086
218 Ga0157380_10157679 3300014326 Bacteria 1969
219 Ga0157377_10016037 3300014745 Bacteria 3846
220 Ga0157379_10002312 3300014968 Bacteria 15882
221 Ga0157376_10023888 3300014969 Bacteria 4793
222 Ga0157376_10032166 3300014969 Bacteria 4209
223 Ga0157376_10033667 3300014969 Bacteria 4128
224 Ga0157376_10243031 3300014969 Bacteria 1678
225 Ga0157376_10321136 3300014969 Bacteria 1472
226 Ga0182006_1000068 3300015261 Bacteria 144823
227 Ga0163161_10310295 3300017792 Bacteria 1244
228 Ga0213874_10049873 3300021377 Bacteria 1281
229 Ga0213876_10167759 3300021384 Bacteria 1168
230 Ga0224570_100026 3300022730 Bacteria 6889
231 Ga0224569_101932 3300022732 Bacteria 1712
232 Ga0209437_110555 3300025233 Bacteria 1408
233 Ga0209233_1001442 3300025261 Bacteria 9385
234 Ga0209233_1002363 3300025261 Bacteria 7019
235 Ga0209676_1000488 3300025292 Bacteria 64408
236 Ga0207692_10004786 3300025898 Bacteria 5379
237 Ga0207642_10065207 3300025899 Bacteria 1710
238 Ga0207710_10036272 3300025900 Bacteria 2173
239 Ga0207688_10102097 3300025901 Bacteria 1657
240 Ga0207680_10030474 3300025903 Bacteria 3043
241 Ga0207647_10014872 3300025904 Bacteria 5351
242 Ga0207647_10272235 3300025904 Bacteria 968
243 Ga0207699_10079051 3300025906 Bacteria 2034
244 Ga0207643_10003224 3300025908 Bacteria 8793
245 Ga0207643_10008421 3300025908 Bacteria 5534
246 Ga0207705_10000021 3300025909 Bacteria 309436
247 Ga0207705_10002125 3300025909 Bacteria 15376
248 Ga0207705_10027435 3300025909 Bacteria 4060
249 Ga0207705_10032912 3300025909 Bacteria 3705
250 Ga0207705_10142618 3300025909 Bacteria 1790
251 Ga0207684_10020316 3300025910 Bacteria 5674
252 Ga0207654_10000808 3300025911 Bacteria 17242
253 Ga0207707_10005331 3300025912 Bacteria 11237
254 Ga0207707_10020540 3300025912 Bacteria 5767
255 Ga0207695_10000001 3300025913 Bacteria 2888630
256 Ga0207695_10000113 3300025913 Bacteria 247240
257 Ga0207695_10000263 3300025913 Bacteria 132894
258 Ga0207695_10033351 3300025913 Bacteria 5617
259 Ga0207695_10072087 3300025913 Bacteria 3526
260 Ga0207695_10101137 3300025913 Bacteria 2877
261 Ga0207671_10000065 3300025914 Bacteria 166743
262 Ga0207671_10000139 3300025914 Bacteria 111786
263 Ga0207671_10188288 3300025914 Bacteria 1608
264 Ga0207693_10006209 3300025915 Bacteria 9910
265 Ga0207693_10021959 3300025915 Bacteria 5074
266 Ga0207693_10214783 3300025915 Bacteria 1511
267 Ga0207663_10016545 3300025916 Bacteria 4093
268 Ga0207663_10045093 3300025916 Bacteria 2710
269 Ga0207663_10244447 3300025916 Bacteria 1318
270 Ga0207660_10005756 3300025917 Bacteria 8041
271 Ga0207660_10047824 3300025917 Bacteria 3026
272 Ga0207660_10146224 3300025917 Bacteria 1812
273 Ga0207660_10154371 3300025917 Bacteria 1766
274 Ga0207660_10440590 3300025917 Bacteria 1053
275 Ga0207657_10022299 3300025919 Bacteria 5931
276 Ga0207657_10058470 3300025919 Bacteria 3317
277 Ga0207657_10123818 3300025919 Bacteria 2125
278 Ga0207649_10069614 3300025920 Bacteria 2241
279 Ga0207649_10077505 3300025920 Bacteria 2142
280 Ga0207652_10002459 3300025921 Bacteria 15619
281 Ga0207652_10005848 3300025921 Bacteria 9964
282 Ga0207652_10015711 3300025921 Bacteria 6166
283 Ga0207652_10036402 3300025921 Bacteria 4160
284 Ga0207652_10217083 3300025921 Bacteria 1723
285 Ga0207646_10021685 3300025922 Bacteria 5930
286 Ga0207681_10155992 3300025923 Bacteria 1716
287 Ga0207681_10177994 3300025923 Bacteria 1617
288 Ga0207694_10000711 3300025924 Bacteria 29920
289 Ga0207694_10048093 3300025924 Bacteria 3300
290 Ga0207694_10121290 3300025924 Bacteria 2088
291 Ga0207694_10163997 3300025924 Bacteria 1796
292 Ga0207694_10359142 3300025924 Bacteria 1207
293 Ga0207650_10136689 3300025925 Bacteria 1923
294 Ga0207650_10141600 3300025925 Bacteria 1891
295 Ga0207659_10289514 3300025926 Bacteria 1342
296 Ga0207687_10000978 3300025927 Bacteria 19404
297 Ga0207687_10002372 3300025927 Bacteria 12792
298 Ga0207687_10563744 3300025927 Bacteria 957
299 Ga0207700_10003745 3300025928 Bacteria 8878
300 Ga0207700_10163747 3300025928 Bacteria 1849
301 Ga0207664_10319666 3300025929 Unclassified 1369
302 Ga0207644_10004420 3300025931 Bacteria 9123
303 Ga0207644_10222547 3300025931 Bacteria 1496
304 Ga0207690_10128659 3300025932 Bacteria 1850
305 Ga0207690_10213666 3300025932 Bacteria 1472
306 Ga0207709_10000021 3300025935 Bacteria 386722
307 Ga0207709_10017040 3300025935 Bacteria 4050
308 Ga0207709_10068957 3300025935 Bacteria 2237
309 Ga0207670_10088192 3300025936 Bacteria 2187
310 Ga0207669_10003949 3300025937 Bacteria 6470
311 Ga0207669_10009825 3300025937 Bacteria 4576
312 Ga0207669_10038680 3300025937 Bacteria 2749
313 Ga0207704_10004960 3300025938 Bacteria 6121
314 Ga0207704_10353180 3300025938 Bacteria 1145
315 Ga0207665_10000046 3300025939 Bacteria 78992
316 Ga0207665_10006547 3300025939 Bacteria 7723
317 Ga0207691_10150871 3300025940 Bacteria 2043
318 Ga0207711_10000014 3300025941 Bacteria 506753
319 Ga0207711_10043809 3300025941 Bacteria 3819
320 Ga0207711_10044398 3300025941 Bacteria 3794
321 Ga0207711_10661291 3300025941 Bacteria 974
322 Ga0207689_10000724 3300025942 Bacteria 31641
323 Ga0207689_10016491 3300025942 Bacteria 6253
324 Ga0207661_10001283 3300025944 Bacteria 16799
325 Ga0207661_10055641 3300025944 Bacteria 3174
326 Ga0207661_10059682 3300025944 Bacteria 3075
327 Ga0207661_10070648 3300025944 Bacteria 2851
328 Ga0207679_10132282 3300025945 Bacteria 2003
329 Ga0207679_10171034 3300025945 Bacteria 1789
330 Ga0207667_10007633 3300025949 Bacteria 12958
331 Ga0207667_10012818 3300025949 Bacteria 9632
332 Ga0207667_10025432 3300025949 Bacteria 6479
333 Ga0207667_10060137 3300025949 Bacteria 3978
334 Ga0207667_10264572 3300025949 Bacteria 1759
335 Ga0207667_10714850 3300025949 Bacteria 1003
336 Ga0207651_10056279 3300025960 Bacteria 2706
337 Ga0207712_10101716 3300025961 Bacteria 2138
338 Ga0207640_10000028 3300025981 Bacteria 135727
339 Ga0207640_10008968 3300025981 Bacteria 5574
340 Ga0207640_10472361 3300025981 Bacteria 1038
341 Ga0207658_10003428 3300025986 Bacteria 11222
342 Ga0207677_10000143 3300026023 Bacteria 58337
343 Ga0207677_10232946 3300026023 Bacteria 1485
344 Ga0207677_10261237 3300026023 Bacteria 1411
345 Ga0207703_10004820 3300026035 Bacteria 10980
346 Ga0207703_10097231 3300026035 Bacteria 2487
347 Ga0207703_10272109 3300026035 Bacteria 1535
348 Ga0207639_10000371 3300026041 Bacteria 31074
349 Ga0207639_10016992 3300026041 Bacteria 5155
350 Ga0207639_10490959 3300026041 Bacteria 1120
351 Ga0207678_10017744 3300026067 Bacteria 6250
352 Ga0207678_10056161 3300026067 Bacteria 3390
353 Ga0207678_10149736 3300026067 Bacteria 1992
354 Ga0207678_10264377 3300026067 Bacteria 1475
355 Ga0207678_10440288 3300026067 Bacteria 1132
356 Ga0207678_10442909 3300026067 Bacteria 1128
357 Ga0207708_10005523 3300026075 Bacteria 9332
358 Ga0207702_10017932 3300026078 Bacteria 5856
359 Ga0207641_10168679 3300026088 Bacteria 1996
360 Ga0207641_10342717 3300026088 Bacteria 1422
361 Ga0207648_10167251 3300026089 Bacteria 1943
362 Ga0207648_10564244 3300026089 Bacteria 1047
363 Ga0207676_10002595 3300026095 Bacteria 12891
364 Ga0207676_10052862 3300026095 Bacteria 3177
365 Ga0207676_10074181 3300026095 Bacteria 2740
366 Ga0207674_10000669 3300026116 Bacteria 44573
367 Ga0207674_10222951 3300026116 Bacteria 1834
368 Ga0207675_100029257 3300026118 Bacteria 5132
369 Ga0207675_100200693 3300026118 Bacteria 1916
370 Ga0207683_10043496 3300026121 Bacteria 3926
371 Ga0207683_10079034 3300026121 Bacteria 2915
372 Ga0207683_10233183 3300026121 Bacteria 1679
373 Ga0207698_10105923 3300026142 Bacteria 2344
374 Ga0207698_10220280 3300026142 Bacteria 1714
375 Ga0265356_1000126 3300028017 Bacteria 13295
376 Ga0268266_10005265 3300028379 Bacteria 12146
377 Ga0268266_10006399 3300028379 Bacteria 10792
378 Ga0268266_10274050 3300028379 Bacteria 1567
379 Ga0268265_10205563 3300028380 Bacteria 1711
380 Ga0268265_10316591 3300028380 Bacteria 1411
381 Ga0268265_10500825 3300028380 Bacteria 1144
382 Ga0268264_10000598 3300028381 Bacteria 43640
383 Ga0265338_10040619 3300028800 Bacteria 4367
384 Ga0265762_1000808 3300030760 Bacteria 5592
385 Ga0265762_1010022 3300030760 Bacteria 1692
386 Ga0265770_1002060 3300030878 Unclassified 2737
387 Ga0265771_1001140 3300031010 Bacteria 1203
388 Ga0265760_10000082 3300031090 Bacteria 24708
389 Ga0265760_10001348 3300031090 Bacteria 7206
390 Ga0307408_100000660 3300031548 Bacteria 28737
391 Ga0316579_10046140 3300031691 Bacteria 2032
392 Ga0265314_10019749 3300031711 Bacteria 5212
393 Ga0316576_10006145 3300031727 Bacteria 7440
394 Ga0316576_10151991 3300031727 Bacteria 1744
395 Ga0316577_10060552 3300031733 Unclassified 2113
396 Ga0307413_10170289 3300031824 Bacteria 1541
397 Ga0307410_10361754 3300031852 Bacteria 1162
398 Ga0307412_10082906 3300031911 Bacteria 2221
399 Ga0307414_10026677 3300032004 Bacteria 3721
400 Ga0307414_10084135 3300032004 Bacteria 2339
401 Ga0307414_10212787 3300032004 Bacteria 1581
402 Ga0307411_10050620 3300032005 Bacteria 2706
403 Ga0316585_10084904 3300032137 Bacteria 1033
404 Ga0316580_10005346 3300032139 Bacteria 3744
405 Ga0307510_10010774 3300033180 Bacteria 10874
406 Ga0307510_10071107 3300033180 Bacteria 3468
407 Ga0307510_10094785 3300033180 Bacteria 2808
408 Ga0373923_0048364 3300035111 Bacteria 1775
409 Ga0373936_0015094 3300035113 Bacteria 2959
410 Ga0373936_0052042 3300035113 Bacteria 1658
411 Ga0373945_0014521 3300035116 Bacteria 2640
412 Ga0373956_0021847 3300035119 Bacteria 2732
413 Ga0373924_0116751 3300035410 Bacteria 1156
414 Ga0373935_0009673 3300035692 Bacteria 5769
415 Ga0373935_0040726 3300035692 Bacteria 2916
416 Ga0373927_0156967 3300035695 Bacteria 1490
417 Ga0373927_0170653 3300035695 Bacteria 1426
418 Ga0373947_0001682 3300035725 Bacteria 13546
419 Ga0373947_0007151 3300035725 Bacteria 6471
420 Ga0373947_0044923 3300035725 Bacteria 2643
421 Ga0373947_0085542 3300035725 Bacteria 1958
422 Ga0373937_0000199 3300036401 Bacteria 58972
423 Ga0373937_0019961 3300036401 Bacteria 6002
424 Ga0373937_0029447 3300036401 Bacteria 4973
425 Ga0316584_0172474 3300036712 Bacteria 1603
426 Ga0373925_0011183 3300037068 Bacteria 6510
427 Ga0373925_0012072 3300037068 Bacteria 6255
428 Ga0373925_0035446 3300037068 Bacteria 3681
429 Ga0373925_0057418 3300037068 Bacteria 2916
430 Ga0395900_0025848 3300037418 Bacteria 6011
431 Ga0395900_0046312 3300037418 Bacteria 4478
432 Ga0395900_0465767 3300037418 Bacteria 1218
433 Ga0395905_0492983 3300037471 Bacteria 1125
434 Ga0395901_0476043 3300038443 Bacteria 1274
435 Ga0400489_71328 3300039093 Bacteria 2332
436 Ga0436365_1607100 3300039437 Bacteria 1720
437 Ga0436363_0684479 3300039450 Unclassified 3001
438 Ga0439457_010856 3300042014 Bacteria 2083
439 Ga0466969_0149492 3300044656 Bacteria 1076
440 Ga0466965_0004348 3300044683 Bacteria 6297
441 Ga0466966_0164880 3300044684 Bacteria 1348
442 Ga0466961_0001506 3300044693 Bacteria 14458
443 Ga0466971_0001983 3300044719 Bacteria 8660
444 Ga0466970_0050725 3300044765 Bacteria 2214
445 Ga0466957_0000702 3300044842 Bacteria 17095
446 Ga0466957_0712715 3300044842 Bacteria 709
447 Ga0466959_0003421 3300045049 Bacteria 10378
448 Ga0466958_0115891 3300045836 Bacteria 1674
449 Ga0466967_0034277 3300045976 Bacteria 4307
450 Ga0495627_004479 3300046453 Bacteria 5842
451 Ga0495592_0047500 3300046454 Bacteria 3197
452 Ga0495603_0009924 3300046455 Bacteria 5763
453 Ga0495603_0048079 3300046455 Bacteria 2540
454 Ga0495603_0126847 3300046455 Bacteria 1487
455 Ga0495603_0262828 3300046455 Bacteria 993
456 Ga0495629_0011020 3300046459 Bacteria 6567
457 Ga0495629_0049585 3300046459 Bacteria 2942
458 Ga0495629_0075929 3300046459 Bacteria 2346
459 Ga0495641_0000681 3300046461 Bacteria 28646
460 Ga0495651_0067062 3300046462 Bacteria 2738
461 Ga0495651_0070949 3300046462 Bacteria 2649
462 Ga0495651_0163141 3300046462 Bacteria 1595
463 Ga0495651_0266601 3300046462 Bacteria 1163
464 Ga0495653_0010749 3300046463 Bacteria 7495
465 Ga0495653_0089319 3300046463 Bacteria 2258
466 Ga0495650_0000038 3300046471 Bacteria 377530
467 Ga0495650_0000087 3300046471 Bacteria 234870
468 Ga0495650_0002342 3300046471 Bacteria 15659
469 Ga0495580_0005628 3300046472 Bacteria 10312
470 Ga0495580_0034332 3300046472 Bacteria 3652
471 Ga0495580_0041316 3300046472 Bacteria 3289
472 Ga0495580_0058878 3300046472 Bacteria 2701
473 Ga0495580_0103353 3300046472 Bacteria 1980
474 Ga0495582_0000643 3300046473 Bacteria 19225
475 Ga0495582_0001853 3300046473 Bacteria 11921
476 Ga0495582_0067225 3300046473 Bacteria 1980
477 Ga0495582_0080396 3300046473 Bacteria 1810
478 Ga0495639_0002049 3300046475 Bacteria 8922
479 Ga0495639_0004538 3300046475 Bacteria 5952
480 Ga0495662_0001214 3300046476 Bacteria 12678
481 Ga0495664_0001348 3300046477 Bacteria 12929
482 Ga0495664_0036690 3300046477 Bacteria 2890
483 Ga0495664_0049296 3300046477 Bacteria 2500
484 Ga0495584_0058377 3300046491 Bacteria 1941
485 Ga0495585_0000286 3300046492 Bacteria 50524
486 Ga0495585_0025037 3300046492 Bacteria 3420
487 Ga0495594_0001190 3300046499 Bacteria 13614
488 Ga0495594_0004431 3300046499 Bacteria 7222
489 Ga0495594_0017006 3300046499 Bacteria 3839
490 Ga0495594_0043704 3300046499 Bacteria 2456
491 Ga0495594_0056792 3300046499 Bacteria 2161
492 Ga0495583_0050307 3300046506 Bacteria 1905
493 Ga0495606_0000052 3300046507 Bacteria 201529
494 Ga0495606_0076509 3300046507 Bacteria 2092
495 Ga0495606_0089617 3300046507 Bacteria 1895
496 Ga0495608_0171818 3300046511 Bacteria 1374
497 Ga0495610_0087725 3300046512 Bacteria 1415
498 Ga0495616_0005196 3300046513 Bacteria 8053
499 Ga0495618_0037508 3300046514 Bacteria 3044
500 Ga0495618_0081798 3300046514 Bacteria 2063
501 Ga0495628_0015738 3300046516 Bacteria 6314
502 Ga0495628_0033438 3300046516 Bacteria 4145
503 Ga0495628_0199156 3300046516 Bacteria 1509
504 Ga0495630_0169403 3300046517 Bacteria 1663
505 Ga0495630_0188567 3300046517 Bacteria 1573
506 Ga0495631_0010490 3300046518 Bacteria 4581
507 Ga0495644_0000048 3300046523 Bacteria 57696
508 Ga0495666_0024917 3300046526 Bacteria 2955
509 Ga0495652_0006640 3300046529 Bacteria 10742
510 Ga0495652_0020823 3300046529 Bacteria 5827
511 Ga0495652_0263793 3300046529 Bacteria 1270
512 Ga0495665_0009651 3300046531 Bacteria 5228
513 Ga0495665_0037967 3300046531 Bacteria 2569
514 Ga0495665_0047858 3300046531 Bacteria 2268
515 Ga0495665_0186240 3300046531 Bacteria 1078
516 Ga0495640_0004801 3300046533 Bacteria 10760
517 Ga0495640_0027681 3300046533 Bacteria 4086
518 Ga0495586_0019711 3300046535 Bacteria 3591
519 Ga0495586_0052639 3300046535 Bacteria 2204
520 Ga0495587_0007267 3300046536 Bacteria 7183
521 Ga0495587_0016961 3300046536 Bacteria 4529
522 Ga0495587_0251359 3300046536 Bacteria 994
523 Ga0495645_0004272 3300046543 Bacteria 9760
524 Ga0495645_0039222 3300046543 Bacteria 3455
525 Ga0495645_0120435 3300046543 Bacteria 1848
526 Ga0495645_0206604 3300046543 Bacteria 1328
527 Ga0495645_0244933 3300046543 Bacteria 1194
528 Ga0495633_0013243 3300046558 Bacteria 4354
529 Ga0495667_0027898 3300046559 Bacteria 3801
530 Ga0495667_0039064 3300046559 Bacteria 3158
531 Ga0495667_0347438 3300046559 Bacteria 937
532 Ga0495668_0053449 3300046616 Bacteria 2233
533 Ga0495634_0006225 3300046642 Bacteria 9093
534 Ga0495611_0005877 3300046648 Bacteria 5236
535 Ga0495625_0000036 3300046660 Bacteria 221680
536 Ga0495625_0000985 3300046660 Bacteria 37750
537 Ga0495625_0017473 3300046660 Bacteria 5617
538 Ga0495625_0026175 3300046660 Bacteria 4411
539 Ga0495625_0034121 3300046660 Bacteria 3757
540 Ga0495625_0263232 3300046660 Bacteria 1115
541 Ga0495635_0001587 3300046663 Bacteria 15288
542 Ga0495635_0002836 3300046663 Bacteria 11904
543 Ga0495635_0127751 3300046663 Bacteria 1733
544 Ga0495635_0172193 3300046663 Bacteria 1472
545 Ga0495661_0015900 3300046665 Bacteria 5009
546 Ga0495588_0068626 3300046674 Bacteria 1842
547 Ga0495657_0329562 3300046675 Bacteria 906
548 Ga0495599_0037006 3300046678 Bacteria 3066
549 Ga0495599_0048151 3300046678 Bacteria 2672
550 Ga0495599_0106580 3300046678 Bacteria 1746
551 Ga0495623_0071905 3300046679 Bacteria 2151
552 Ga0495623_0073201 3300046679 Bacteria 2130
553 Ga0495623_0151262 3300046679 Bacteria 1372
554 Ga0495646_0013211 3300046680 Bacteria 5247
555 Ga0495646_0032680 3300046680 Bacteria 3237
556 Ga0495658_0000432 3300046683 Bacteria 23385
557 Ga0495658_0157788 3300046683 Bacteria 1397
558 Ga0495658_0159853 3300046683 Bacteria 1389
559 Ga0495613_0003966 3300046689 Bacteria 11081
560 Ga0495624_0007524 3300046690 Bacteria 7641
561 Ga0495624_0016847 3300046690 Bacteria 4917
562 Ga0495671_0072938 3300046692 Bacteria 1685
563 Ga0495649_0000017 3300046694 Bacteria 221685
564 Ga0495649_0023327 3300046694 Bacteria 3458
565 Ga0495600_0012858 3300046809 Bacteria 5243
566 Ga0495600_0014306 3300046809 Bacteria 4999
567 Ga0495600_0037962 3300046809 Bacteria 3133
568 Ga0495581_0001976 3300047315 Bacteria 11495
569 Ga0495581_0002893 3300047315 Bacteria 9823
570 Ga0495581_0044298 3300047315 Bacteria 2573
571 Ga0495581_0084345 3300047315 Bacteria 1841
572 Ga0495604_0032429 3300047317 Bacteria 4140
573 Ga0495604_0073803 3300047317 Bacteria 2573
574 Ga0495604_0089870 3300047317 Bacteria 2282
575 Ga0495674_0011368 3300047319 Bacteria 8401
576 Ga0495674_0014334 3300047319 Bacteria 7423
577 Ga0495676_0001661 3300047321 Bacteria 19426
578 Ga0495676_0008961 3300047321 Bacteria 9134
579 Ga0495676_0429286 3300047321 Bacteria 874
580 Ga0495680_0005808 3300047322 Bacteria 11550
581 Ga0495680_0017467 3300047322 Bacteria 6127
582 Ga0495687_041841 3300047443 Bacteria 2007
583 Ga0495675_0227374 3300047444 Bacteria 1127
584 Ga0495675_0249437 3300047444 Bacteria 1067
585 Ga0495673_0090672 3300047469 Bacteria 1250
586 Ga0495684_0009819 3300047471 Bacteria 7386
587 Ga0495684_0010690 3300047471 Bacteria 7096
588 Ga0495686_0000178 3300047472 Bacteria 121468
589 Ga0495686_0001621 3300047472 Bacteria 23566
590 Ga0495686_0008419 3300047472 Bacteria 7568
591 Ga0495686_0031962 3300047472 Bacteria 3409
592 Ga0495686_0058154 3300047472 Bacteria 2411
593 Ga0495686_0126738 3300047472 Bacteria 1517
594 Ga0495593_0001102 3300047673 Bacteria 15762
595 Ga0495593_0061551 3300047673 Bacteria 1963
596 Ga0495602_0355123 3300048088 Bacteria 1057
597 Ga0495614_0000972 3300048089 Bacteria 12208
598 Ga0495614_0068526 3300048089 Bacteria 1528
599 Ga0496100_0005780 3300048903 Bacteria 6692
600 Ga0496100_0106136 3300048903 Unclassified 1944
601 Ga0496101_0042419 3300048904 Bacteria 3247
602 Ga0496101_0203968 3300048904 Bacteria 1529
603 Ga0496101_0330005 3300048904 Bacteria 1197
604 Ga0496102_0048627 3300048905 Bacteria 3856
605 Ga0496104_0000053 3300048907 Bacteria 135895
606 Ga0496104_0056645 3300048907 Bacteria 3708
607 Ga0496104_0112862 3300048907 Bacteria 2606
608 Ga0496105_0001615 3300048908 Bacteria 15999
609 Ga0496105_0005740 3300048908 Bacteria 9452
610 Ga0496105_0063911 3300048908 Bacteria 3037
611 Ga0496106_0078284 3300048909 Bacteria 2536
612 Ga0496108_0071573 3300048911 Bacteria 2926
613 Ga0496108_0181015 3300048911 Bacteria 1825
614 Ga0496108_0495528 3300048911 Bacteria 1067
615 Ga0496109_0195218 3300048912 Bacteria 1902
616 Ga0496110_0079754 3300048913 Bacteria 2915
617 Ga0496110_0584967 3300048913 Bacteria 1013
618 Ga0496111_0043001 3300048914 Bacteria 3246
619 Ga0496112_0103201 3300048915 Bacteria 2821
620 Ga0496112_0131339 3300048915 Bacteria 2475
621 Ga0496112_0162231 3300048915 Bacteria 2202
622 Ga0496112_0192441 3300048915 Bacteria 2001
623 Ga0496113_0001193 3300048916 Bacteria 14220
624 Ga0496113_0285461 3300048916 Bacteria 1320
625 Ga0496114_0005321 3300048917 Bacteria 10057
626 Ga0496114_0415038 3300048917 Bacteria 1192
627 Ga0496115_0003110 3300048918 Bacteria 11925
628 Ga0496115_0085005 3300048918 Bacteria 2580
629 Ga0496115_0159540 3300048918 Bacteria 1864
630 Ga0496115_0210018 3300048918 Bacteria 1608
631 Ga0496116_0001728 3300048919 Bacteria 23852
632 Ga0496117_0003269 3300048920 Bacteria 19047
633 Ga0496122_0006115 3300048925 Bacteria 14014
634 Ga0496123_0003787 3300048926 Bacteria 16562
635 Ga0496126_0000014 3300048929 Bacteria 686881
636 Ga0496126_0000100 3300048929 Bacteria 203706
637 Ga0496126_0000154 3300048929 Bacteria 159983
638 Ga0496126_0273933 3300048929 Bacteria 1400
639 Ga0501032_0001912 3300049569 Bacteria 16446
640 Ga0501033_0028282 3300049570 Bacteria 4213
641 Ga0501033_0165396 3300049570 Bacteria 1590
642 Ga0501034_0169330 3300049571 Bacteria 2152
643 Ga0501036_0019400 3300049572 Bacteria 5708
644 Ga0501036_0081969 3300049572 Bacteria 2726
645 Ga0501037_0084065 3300049573 Bacteria 2305
646 Ga0501038_0048143 3300049574 Bacteria 3690
647 Ga0501038_0067879 3300049574 Bacteria 3033
648 Ga0501038_0275352 3300049574 Bacteria 1326
649 Ga0501039_0079801 3300049575 Bacteria 2546
650 Ga0501040_0199735 3300049576 Bacteria 1419
651 Ga0501041_0107506 3300049577 Bacteria 1729
652 Ga0501042_0001950 3300049578 Bacteria 12427
653 Ga0501042_0271022 3300049578 Bacteria 1226
654 Ga0501043_0003983 3300049579 Bacteria 12094
655 Ga0501046_0000056 3300049580 Bacteria 129342
656 Ga0501046_0333955 3300049580 Bacteria 1103
657 Ga0501047_0008947 3300049581 Bacteria 9454
658 Ga0501048_0025123 3300049582 Bacteria 4343
659 Ga0501067_0120289 3300049583 Bacteria 1461
660 Ga0501068_0027744 3300049584 Bacteria 3345
661 Ga0501071_0003551 3300049587 Bacteria 9762
662 Ga0501072_0003556 3300049588 Bacteria 11728
663 Ga0501072_0205735 3300049588 Bacteria 1569
664 Ga0501074_0056654 3300049590 Bacteria 2825
665 Ga0501074_0182161 3300049590 Bacteria 1498
666 Ga0501074_0498123 3300049590 Bacteria 863
667 Ga0501075_0012301 3300049591 Bacteria 6079
668 Ga0501076_0074854 3300049592 Bacteria 2713
669 Ga0501076_0427197 3300049592 Bacteria 1090
670 Ga0501077_0026976 3300049593 Bacteria 3647
671 Ga0501079_0018432 3300049741 Bacteria 5333
672 Ga0501079_0332195 3300049741 Bacteria 1190
673 Ga0501080_0014166 3300049742 Bacteria 7339
674 Ga0501080_0320944 3300049742 Bacteria 1402
675 Ga0501081_0006567 3300049743 Bacteria 7557
676 Ga0501083_0099076 3300049744 Bacteria 1922
677 Ga0501083_0475114 3300049744 Bacteria 814
678 Ga0501035_0044540 3300049822 Bacteria 3995
679 Ga0501035_0222235 3300049822 Bacteria 1612
680 Ga0501044_0027240 3300049823 Bacteria 6042
681 Ga0501044_0095095 3300049823 Bacteria 3003
682 Ga0501044_0361355 3300049823 Bacteria 1370
683 Ga0501045_0161385 3300049824 Bacteria 1668
684 nmdc:mga05p37_506693_c1 3300050507 Bacteria 1384
685 nmdc:mga09592_10254_c1 3300050508 Bacteria 7626
686 nmdc:mga08y16_103557_c1 3300050511 Bacteria 2963
687 nmdc:mga08x19_17719_c1 3300050514 Bacteria 4361
688 Ga0495601_0113830 3300053077 Bacteria 1753
689 Ga0495601_0118423 3300053077 Bacteria 1719
690 Ga0495612_0230001 3300053078 Bacteria 822
691 Ga0495619_0002309 3300053085 Bacteria 12568
692 Ga0500651_0000005 3300053093 Bacteria 384761
693 Ga0500595_000004 3300053119 Bacteria 410922
694 Ga0500595_007997 3300053119 Bacteria 4343
695 Ga0500595_051334 3300053119 Bacteria 1277
696 Ga0501084_0006738 3300054114 Bacteria 9444
697 Ga0501084_0443166 3300054114 Bacteria 1098
698 Ga0501082_0020279 3300060353 Bacteria 5731
699 Ga0466962_0000121 3300061719 Bacteria 31836
700 Ga0530510_0001091 3300061734 Bacteria 17991
701 2522549306 2522125168 Bacteria 7376607
702 2722726345 2721755487 Bacteria 6357185
703 2884217802 2884215851 Bacteria 4554841
704 2887380526 2887375801 Bacteria 5334027
705 2896346137 2896344016 Bacteria 3811746
706 2902051524 2902048731 Bacteria 4976191
707 2904783769 2904780799 Bacteria 5840761
708 2911139464 2911138879 Bacteria 5811561
709 2919181981 2919177583 Bacteria 5641607
710 Ga0068853_100043702
711 rootH1_10106452
712 rootH2_10009426
713 rootH2_10223217
714 Ga0065165_1000639
715 Ga0065704_10002415
716 Ga0070658_10000121
717 Ga0070658_10021582
718 Ga0070658_10079725
719 Ga0070683_100002041
720 Ga0070683_100034019
721 Ga0070683_100053355
722 Ga0070670_100048822
723 Ga0068869_100026222
724 Ga0070680_100000986
725 Ga0070680_100205572
726 Ga0070680_100247038
727 Ga0070680_100294798
728 Ga0070682_100128071
729 Ga0068868_100000066
730 Ga0068868_100009078
731 Ga0068868_100065060
732 Ga0068868_100081115
733 Ga0068868_100327777
734 Ga0070660_100029979
735 Ga0070660_100052984
736 Ga0070661_100129713
737 Ga0070661_100488462
738 Ga0070668_100272594
739 Ga0070668_100282585
740 Ga0070669_100037481
741 Ga0070669_100163152
742 Ga0070675_100015083
743 Ga0070675_100100900
744 Ga0070671_100019026
745 Ga0070674_100003653
746 Ga0070674_100005539
747 Ga0070674_100007368
748 Ga0070659_100004580
749 Ga0070667_100046288
750 Ga0070667_100355272
751 Ga0070709_10088765
752 Ga0070714_100223952
753 Ga0070713_100018623
754 Ga0070713_100139431
755 Ga0070713_100302543
756 Ga0070710_10007431
757 Ga0070711_100004729
758 Ga0070711_100010327
759 Ga0070711_100115600
760 Ga0070700_100022140
761 Ga0070708_100132156
762 Ga0070663_100299139
763 Ga0070663_100377747
764 Ga0070678_100013774
765 Ga0070678_100040742
766 Ga0070678_100172880
767 Ga0070678_100215546
768 Ga0070681_10028439
769 Ga0070681_10051676
770 Ga0070681_10059995
771 Ga0070681_10072900
772 Ga0070685_10004403
773 Ga0070685_10373645
774 Ga0070706_100009858
775 Ga0070706_100192849
776 Ga0070707_100001684
777 Ga0070679_100000968
778 Ga0070679_100002610
779 Ga0070679_100003993
780 Ga0070679_100092454
781 Ga0070679_100111123
782 Ga0070684_100043409
783 Ga0070684_100107048
784 Ga0070684_100430167
785 Ga0070684_100433660
786 Ga0068853_100000367
787 Ga0068853_100107800
788 Ga0070686_100014710
789 Ga0070665_100013537
790 Ga0070665_100035648
791 Ga0070665_100155561
792 Ga0070704_100184123
793 Ga0068855_100010384
794 Ga0068855_100011915
795 Ga0068855_100035334
796 Ga0068855_100127193
797 Ga0068855_100180615
798 Ga0068855_100182459
799 Ga0070664_100080620
800 Ga0070664_100233250
801 Ga0068857_100003191
802 Ga0068857_100338048
803 Ga0068857_100344814
804 Ga0068854_100000019
805 Ga0068854_100006821
806 Ga0068854_100123734
807 Ga0068854_100284393
808 Ga0068854_100485092
809 Ga0068854_100560236
810 Ga0068856_100033069
811 Ga0068856_100057606
812 Ga0068856_100062110
813 Ga0068852_100097697
814 Ga0068852_100103163
815 Ga0068852_100280517
816 Ga0068852_100981180
817 Ga0068859_100210649
818 Ga0068864_100000625
819 Ga0068864_100032027
820 Ga0068864_100086854
821 Ga0068866_10025185
822 Ga0068866_10057060
823 Ga0068861_100065980
824 Ga0068861_100634606
825 Ga0068851_10016393
826 Ga0068870_10016531
827 Ga0068870_10027751
828 Ga0068863_100001753
829 Ga0068863_100001814
830 Ga0068858_100014586
831 Ga0068858_100077602
832 Ga0068860_100000689
833 Ga0068862_100329594
834 Ga0081455_10051839
835 Ga0081455_10407649
836 Ga0081538_10000465
837 Ga0081540_1004351
838 Ga0070717_10127876
839 Ga0070716_100000287
840 Ga0070712_100002632
841 Ga0070712_100024471
842 Ga0070712_100222772
843 Ga0070712_100292956
844 Ga0097621_100000116
845 Ga0097621_100000349
846 Ga0097621_100241191
847 Ga0068871_100002325
848 Ga0075428_100015743
849 Ga0068865_100013860
850 Ga0075436_100009109
851 Ga0097620_100210642
852 Ga0075435_100131543
853 Ga0105240_10000001
854 Ga0105240_10000372
855 Ga0105240_10009346
856 Ga0105240_10010838
857 Ga0105240_10046039
858 Ga0105240_10122860
859 Ga0105240_10299137
860 Ga0105240_10312296
861 Ga0111539_10427708
862 Ga0105245_10000486
863 Ga0105245_10021587
864 Ga0105245_10283198
865 Ga0105245_10581286
866 Ga0105245_10788506
867 Ga0105247_10002346
868 Ga0114129_10403567
869 Ga0105243_10000043
870 Ga0105243_10006595
871 Ga0105243_10008481
872 Ga0105243_10010773
873 Ga0105241_10002032
874 Ga0105241_10050871
875 Ga0105242_10004704
876 Ga0105248_10000019
877 Ga0105248_10016372
878 Ga0105248_10029618
879 Ga0105248_10108464
880 Ga0105248_10321320
881 Ga0105237_10006331
882 Ga0105237_10055825
883 Ga0105237_10317658
884 Ga0105238_10000509
885 Ga0105238_10026652
886 Ga0105238_10078759
887 Ga0105238_10155125
888 Ga0105238_10286222
889 Ga0105249_10003449
890 Ga0105249_10027405
891 Ga0105239_10129889
892 Ga0105246_10001192
893 Ga0105246_10011295
894 Ga0157371_10152599
895 Ga0157370_10010879
896 Ga0157370_10013763
897 Ga0157370_10046758
898 Ga0157370_10056931
899 Ga0157370_10358073
900 Ga0157370_10368441
901 Ga0157370_10448778
902 Ga0157370_10448784
903 Ga0157369_10009218
904 Ga0157369_10010533
905 Ga0157369_10012659
906 Ga0157369_10044962
907 Ga0157369_10048503
908 Ga0157369_10127916
909 Ga0157369_10168089
910 Ga0157369_10218919
911 Ga0157369_10719337
912 Ga0157374_10023020
913 Ga0157374_10035016
914 Ga0157374_10192351
915 Ga0157378_10000108
916 Ga0157378_10117504
917 Ga0157378_10131240
918 Ga0157378_10139810
919 Ga0163162_10022177
920 Ga0163162_10045378
921 Ga0157372_10010870
922 Ga0157372_10312122
923 Ga0157375_10005984
924 Ga0163163_10001161
925 Ga0163163_10005969
926 Ga0163163_10192750
927 Ga0157380_10157679
928 Ga0157377_10016037
929 Ga0157379_10002312
930 Ga0157376_10023888
931 Ga0157376_10032166
932 Ga0157376_10033667
933 Ga0157376_10243031
934 Ga0157376_10321136
935 Ga0182006_1000068
936 Ga0163161_10310295
937 Ga0213874_10049873
938 Ga0213876_10167759
939 Ga0224570_100026
940 Ga0224569_101932
941 Ga0209437_110555
942 Ga0209233_1001442
943 Ga0209233_1002363
944 Ga0209676_1000488
945 Ga0207692_10004786
946 Ga0207642_10065207
947 Ga0207710_10036272
948 Ga0207688_10102097
949 Ga0207680_10030474
950 Ga0207647_10014872
951 Ga0207647_10272235
952 Ga0207699_10079051
953 Ga0207643_10003224
954 Ga0207643_10008421
955 Ga0207705_10000021
956 Ga0207705_10002125
957 Ga0207705_10027435
958 Ga0207705_10032912
959 Ga0207705_10142618
960 Ga0207684_10020316
961 Ga0207654_10000808
962 Ga0207707_10005331
963 Ga0207707_10020540
964 Ga0207695_10000001
965 Ga0207695_10000113
966 Ga0207695_10000263
967 Ga0207695_10033351
968 Ga0207695_10072087
969 Ga0207695_10101137
970 Ga0207671_10000065
971 Ga0207671_10000139
972 Ga0207671_10188288
973 Ga0207693_10006209
974 Ga0207693_10021959
975 Ga0207693_10214783
976 Ga0207663_10016545
977 Ga0207663_10045093
978 Ga0207663_10244447
979 Ga0207660_10005756
980 Ga0207660_10047824
981 Ga0207660_10146224
982 Ga0207660_10154371
983 Ga0207660_10440590
984 Ga0207657_10022299
985 Ga0207657_10058470
986 Ga0207657_10123818
987 Ga0207649_10069614
988 Ga0207649_10077505
989 Ga0207652_10002459
990 Ga0207652_10005848
991 Ga0207652_10015711
992 Ga0207652_10036402
993 Ga0207652_10217083
994 Ga0207646_10021685
995 Ga0207681_10155992
996 Ga0207681_10177994
997 Ga0207694_10000711
998 Ga0207694_10048093
999 Ga0207694_10121290
1000 Ga0207694_10163997
1001 Ga0207694_10359142
1002 Ga0207650_10136689
1003 Ga0207650_10141600
1004 Ga0207659_10289514
1005 Ga0207687_10000978
1006 Ga0207687_10002372
1007 Ga0207687_10563744
1008 Ga0207700_10003745
1009 Ga0207700_10163747
1010 Ga0207664_10319666
1011 Ga0207644_10004420
1012 Ga0207644_10222547
1013 Ga0207690_10128659
1014 Ga0207690_10213666
1015 Ga0207709_10000021
1016 Ga0207709_10017040
1017 Ga0207709_10068957
1018 Ga0207670_10088192
1019 Ga0207669_10003949
1020 Ga0207669_10009825
1021 Ga0207669_10038680
1022 Ga0207704_10004960
1023 Ga0207704_10353180
1024 Ga0207665_10000046
1025 Ga0207665_10006547
1026 Ga0207691_10150871
1027 Ga0207711_10000014
1028 Ga0207711_10043809
1029 Ga0207711_10044398
1030 Ga0207711_10661291
1031 Ga0207689_10000724
1032 Ga0207689_10016491
1033 Ga0207661_10001283
1034 Ga0207661_10055641
1035 Ga0207661_10059682
1036 Ga0207661_10070648
1037 Ga0207679_10132282
1038 Ga0207679_10171034
1039 Ga0207667_10007633
1040 Ga0207667_10012818
1041 Ga0207667_10025432
1042 Ga0207667_10060137
1043 Ga0207667_10264572
1044 Ga0207667_10714850
1045 Ga0207651_10056279
1046 Ga0207712_10101716
1047 Ga0207640_10000028
1048 Ga0207640_10008968
1049 Ga0207640_10472361
1050 Ga0207658_10003428
1051 Ga0207677_10000143
1052 Ga0207677_10232946
1053 Ga0207677_10261237
1054 Ga0207703_10004820
1055 Ga0207703_10097231
1056 Ga0207703_10272109
1057 Ga0207639_10000371
1058 Ga0207639_10016992
1059 Ga0207639_10490959
1060 Ga0207678_10017744
1061 Ga0207678_10056161
1062 Ga0207678_10149736
1063 Ga0207678_10264377
1064 Ga0207678_10440288
1065 Ga0207678_10442909
1066 Ga0207708_10005523
1067 Ga0207702_10017932
1068 Ga0207641_10168679
1069 Ga0207641_10342717
1070 Ga0207648_10167251
1071 Ga0207648_10564244
1072 Ga0207676_10002595
1073 Ga0207676_10052862
1074 Ga0207676_10074181
1075 Ga0207674_10000669
1076 Ga0207674_10222951
1077 Ga0207675_100029257
1078 Ga0207675_100200693
1079 Ga0207683_10043496
1080 Ga0207683_10079034
1081 Ga0207683_10233183
1082 Ga0207698_10105923
1083 Ga0207698_10220280
1084 Ga0265356_1000126
1085 Ga0268266_10005265
1086 Ga0268266_10006399
1087 Ga0268266_10274050
1088 Ga0268265_10205563
1089 Ga0268265_10316591
1090 Ga0268265_10500825
1091 Ga0268264_10000598
1092 Ga0265338_10040619
1093 Ga0265762_1000808
1094 Ga0265762_1010022
1095 Ga0265770_1002060
1096 Ga0265771_1001140
1097 Ga0265760_10000082
1098 Ga0265760_10001348
1099 Ga0307408_100000660
1100 Ga0316579_10046140
1101 Ga0265314_10019749
1102 Ga0316576_10006145
1103 Ga0316576_10151991
1104 Ga0316577_10060552
1105 Ga0307413_10170289
1106 Ga0307410_10361754
1107 Ga0307412_10082906
1108 Ga0307414_10026677
1109 Ga0307414_10084135
1110 Ga0307414_10212787
1111 Ga0307411_10050620
1112 Ga0316585_10084904
1113 Ga0316580_10005346
1114 Ga0307510_10010774
1115 Ga0307510_10071107
1116 Ga0307510_10094785
1117 Ga0373923_0048364
1118 Ga0373936_0015094
1119 Ga0373936_0052042
1120 Ga0373945_0014521
1121 Ga0373956_0021847
1122 Ga0373924_0116751
1123 Ga0373935_0009673
1124 Ga0373935_0040726
1125 Ga0373927_0156967
1126 Ga0373927_0170653
1127 Ga0373947_0001682
1128 Ga0373947_0007151
1129 Ga0373947_0044923
1130 Ga0373947_0085542
1131 Ga0373937_0000199
1132 Ga0373937_0019961
1133 Ga0373937_0029447
1134 Ga0316584_0172474
1135 Ga0373925_0011183
1136 Ga0373925_0012072
1137 Ga0373925_0035446
1138 Ga0373925_0057418
1139 Ga0395900_0025848
1140 Ga0395900_0046312
1141 Ga0395900_0465767
1142 Ga0395905_0492983
1143 Ga0395901_0476043
1144 Ga0400489_71328
1145 Ga0436365_1607100
1146 Ga0436363_0684479
1147 Ga0439457_010856
1148 Ga0466969_0149492
1149 Ga0466965_0004348
1150 Ga0466966_0164880
1151 Ga0466961_0001506
1152 Ga0466971_0001983
1153 Ga0466970_0050725
1154 Ga0466957_0000702
1155 Ga0466957_0712715
1156 Ga0466959_0003421
1157 Ga0466958_0115891
1158 Ga0466967_0034277
1159 Ga0495627_004479
1160 Ga0495592_0047500
1161 Ga0495603_0009924
1162 Ga0495603_0048079
1163 Ga0495603_0126847
1164 Ga0495603_0262828
1165 Ga0495629_0011020
1166 Ga0495629_0049585
1167 Ga0495629_0075929
1168 Ga0495641_0000681
1169 Ga0495651_0067062
1170 Ga0495651_0070949
1171 Ga0495651_0163141
1172 Ga0495651_0266601
1173 Ga0495653_0010749
1174 Ga0495653_0089319
1175 Ga0495650_0000038
1176 Ga0495650_0000087
1177 Ga0495650_0002342
1178 Ga0495580_0005628
1179 Ga0495580_0034332
1180 Ga0495580_0041316
1181 Ga0495580_0058878
1182 Ga0495580_0103353
1183 Ga0495582_0000643
1184 Ga0495582_0001853
1185 Ga0495582_0067225
1186 Ga0495582_0080396
1187 Ga0495639_0002049
1188 Ga0495639_0004538
1189 Ga0495662_0001214
1190 Ga0495664_0001348
1191 Ga0495664_0036690
1192 Ga0495664_0049296
1193 Ga0495584_0058377
1194 Ga0495585_0000286
1195 Ga0495585_0025037
1196 Ga0495594_0001190
1197 Ga0495594_0004431
1198 Ga0495594_0017006
1199 Ga0495594_0043704
1200 Ga0495594_0056792
1201 Ga0495583_0050307
1202 Ga0495606_0000052
1203 Ga0495606_0076509
1204 Ga0495606_0089617
1205 Ga0495608_0171818
1206 Ga0495610_0087725
1207 Ga0495616_0005196
1208 Ga0495618_0037508
1209 Ga0495618_0081798
1210 Ga0495628_0015738
1211 Ga0495628_0033438
1212 Ga0495628_0199156
1213 Ga0495630_0169403
1214 Ga0495630_0188567
1215 Ga0495631_0010490
1216 Ga0495644_0000048
1217 Ga0495666_0024917
1218 Ga0495652_0006640
1219 Ga0495652_0020823
1220 Ga0495652_0263793
1221 Ga0495665_0009651
1222 Ga0495665_0037967
1223 Ga0495665_0047858
1224 Ga0495665_0186240
1225 Ga0495640_0004801
1226 Ga0495640_0027681
1227 Ga0495586_0019711
1228 Ga0495586_0052639
1229 Ga0495587_0007267
1230 Ga0495587_0016961
1231 Ga0495587_0251359
1232 Ga0495645_0004272
1233 Ga0495645_0039222
1234 Ga0495645_0120435
1235 Ga0495645_0206604
1236 Ga0495645_0244933
1237 Ga0495633_0013243
1238 Ga0495667_0027898
1239 Ga0495667_0039064
1240 Ga0495667_0347438
1241 Ga0495668_0053449
1242 Ga0495634_0006225
1243 Ga0495611_0005877
1244 Ga0495625_0000036
1245 Ga0495625_0000985
1246 Ga0495625_0017473
1247 Ga0495625_0026175
1248 Ga0495625_0034121
1249 Ga0495625_0263232
1250 Ga0495635_0001587
1251 Ga0495635_0002836
1252 Ga0495635_0127751
1253 Ga0495635_0172193
1254 Ga0495661_0015900
1255 Ga0495588_0068626
1256 Ga0495657_0329562
1257 Ga0495599_0037006
1258 Ga0495599_0048151
1259 Ga0495599_0106580
1260 Ga0495623_0071905
1261 Ga0495623_0073201
1262 Ga0495623_0151262
1263 Ga0495646_0013211
1264 Ga0495646_0032680
1265 Ga0495658_0000432
1266 Ga0495658_0157788
1267 Ga0495658_0159853
1268 Ga0495613_0003966
1269 Ga0495624_0007524
1270 Ga0495624_0016847
1271 Ga0495671_0072938
1272 Ga0495649_0000017
1273 Ga0495649_0023327
1274 Ga0495600_0012858
1275 Ga0495600_0014306
1276 Ga0495600_0037962
1277 Ga0495581_0001976
1278 Ga0495581_0002893
1279 Ga0495581_0044298
1280 Ga0495581_0084345
1281 Ga0495604_0032429
1282 Ga0495604_0073803
1283 Ga0495604_0089870
1284 Ga0495674_0011368
1285 Ga0495674_0014334
1286 Ga0495676_0001661
1287 Ga0495676_0008961
1288 Ga0495676_0429286
1289 Ga0495680_0005808
1290 Ga0495680_0017467
1291 Ga0495687_041841
1292 Ga0495675_0227374
1293 Ga0495675_0249437
1294 Ga0495673_0090672
1295 Ga0495684_0009819
1296 Ga0495684_0010690
1297 Ga0495686_0000178
1298 Ga0495686_0001621
1299 Ga0495686_0008419
1300 Ga0495686_0031962
1301 Ga0495686_0058154
1302 Ga0495686_0126738
1303 Ga0495593_0001102
1304 Ga0495593_0061551
1305 Ga0495602_0355123
1306 Ga0495614_0000972
1307 Ga0495614_0068526
1308 Ga0496100_0005780
1309 Ga0496100_0106136
1310 Ga0496101_0042419
1311 Ga0496101_0203968
1312 Ga0496101_0330005
1313 Ga0496102_0048627
1314 Ga0496104_0000053
1315 Ga0496104_0056645
1316 Ga0496104_0112862
1317 Ga0496105_0001615
1318 Ga0496105_0005740
1319 Ga0496105_0063911
1320 Ga0496106_0078284
1321 Ga0496108_0071573
1322 Ga0496108_0181015
1323 Ga0496108_0495528
1324 Ga0496109_0195218
1325 Ga0496110_0079754
1326 Ga0496110_0584967
1327 Ga0496111_0043001
1328 Ga0496112_0103201
1329 Ga0496112_0131339
1330 Ga0496112_0162231
1331 Ga0496112_0192441
1332 Ga0496113_0001193
1333 Ga0496113_0285461
1334 Ga0496114_0005321
1335 Ga0496114_0415038
1336 Ga0496115_0003110
1337 Ga0496115_0085005
1338 Ga0496115_0159540
1339 Ga0496115_0210018
1340 Ga0496116_0001728
1341 Ga0496117_0003269
1342 Ga0496122_0006115
1343 Ga0496123_0003787
1344 Ga0496126_0000014
1345 Ga0496126_0000100
1346 Ga0496126_0000154
1347 Ga0496126_0273933
1348 Ga0501032_0001912
1349 Ga0501033_0028282
1350 Ga0501033_0165396
1351 Ga0501034_0169330
1352 Ga0501036_0019400
1353 Ga0501036_0081969
1354 Ga0501037_0084065
1355 Ga0501038_0048143
1356 Ga0501038_0067879
1357 Ga0501038_0275352
1358 Ga0501039_0079801
1359 Ga0501040_0199735
1360 Ga0501041_0107506
1361 Ga0501042_0001950
1362 Ga0501042_0271022
1363 Ga0501043_0003983
1364 Ga0501046_0000056
1365 Ga0501046_0333955
1366 Ga0501047_0008947
1367 Ga0501048_0025123
1368 Ga0501067_0120289
1369 Ga0501068_0027744
1370 Ga0501071_0003551
1371 Ga0501072_0003556
1372 Ga0501072_0205735
1373 Ga0501074_0056654
1374 Ga0501074_0182161
1375 Ga0501074_0498123
1376 Ga0501075_0012301
1377 Ga0501076_0074854
1378 Ga0501076_0427197
1379 Ga0501077_0026976
1380 Ga0501079_0018432
1381 Ga0501079_0332195
1382 Ga0501080_0014166
1383 Ga0501080_0320944
1384 Ga0501081_0006567
1385 Ga0501083_0099076
1386 Ga0501083_0475114
1387 Ga0501035_0044540
1388 Ga0501035_0222235
1389 Ga0501044_0027240
1390 Ga0501044_0095095
1391 Ga0501044_0361355
1392 Ga0501045_0161385
1393 nmdc:mga05p37_506693_c1
1394 nmdc:mga09592_10254_c1
1395 nmdc:mga08y16_103557_c1
1396 nmdc:mga08x19_17719_c1
1397 Ga0495601_0113830
1398 Ga0495601_0118423
1399 Ga0495612_0230001
1400 Ga0495619_0002309
1401 Ga0500651_0000005
1402 Ga0500595_000004
1403 Ga0500595_007997
1404 Ga0500595_051334
1405 Ga0501084_0006738
1406 Ga0501084_0443166
1407 Ga0501082_0020279
1408 Ga0466962_0000121
1409 Ga0530510_0001091
1410 2522549306
1411 2722726345
1412 2884217802
1413 2887380526
1414 2896346137
1415 2902051524
1416 2904783769
1417 2911139464
1418 2919181981

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00977

His_biosynth

Histidine biosynthesis protein

39

271

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6vdg-assembly1.cif.gz_A crystal structure of the y182a hisf mutant from thermotoga maritima 0.974 3 257
6vdg-assembly1.cif.gz_A crystal structure of the y182a hisf mutant from thermotoga maritima 0.97 3 257
1gpw-assembly2.cif.gz_C structural evidence for ammonia tunneling across the (beta/alpha)8 barrel of the imidazole glycerol phosphate synthase bienzyme complex. 0.9677 1 259
2wjz-assembly2.cif.gz_E crystal structure of (hish) k181a y138a mutant of imidazoleglycerolphosphate synthase (hish hisf) which displays constitutive glutaminase activity 0.9676 1 258
7qc9-assembly1.cif.gz_A hisf-c9a-d11e-v33a_l50h_i52h mutant in complex with ni(ii) from t. maritima 0.9669 2 257
ID Description Score Start End Superfamily
af_Q2FUU3_1_249_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.961 1 250 3.20.20.70
af_Q57854_1_272_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9596 1 258 3.20.20.70
af_Q57854_1_272_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9528 1 258 3.20.20.70
af_P60664_1_258_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9509 1 258 3.20.20.70
af_P60664_1_258_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9473 1 258 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A352GHN9-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisF (IGP synthase subunit HisF) (ImGP synthase subunit HisF) 0.9939 145 257 GO:0000105
GO:0000107
AF-A0A3D5UUN4-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisF (IGP synthase subunit HisF) (ImGP synthase subunit HisF) 0.9926 145 257 GO:0000105
GO:0000107
AF-A0A354XIR3-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisF 0.9918 145 257 GO:0000105
GO:0000107
AF-A0A7V4PQW7-F1-model_v4 imidazole glycerol-phosphate synthase (EC 4.3.2.10) (IGP synthase cyclase subunit) 0.9907 43 256 GO:0000105
GO:0000107
GO:0016829
AF-A0A645CJV2-F1-model_v4 imidazole glycerol-phosphate synthase (EC 4.3.2.10) 0.9899 63 258 GO:0000105
GO:0000107
GO:0016829

Map