F476640

General Info

Members Datasets Scaffolds Average Seq Length
709 315 1418 113

Family's Representative Sequence

Representative Sequence 3300005438|Ga0070701_10031718|Ga0070701_100317182
Length 123
Sequence MLPRNISGETPMPHTADLALLQGTLDVLVLKALMFGPRHGYAVASWIRDTSDETLNVEDRALYVALHRLEDRGWVEAEWGLSENNRKAKYYQLTTRGRAQLRAETTRWTAYAEAVFKVLRAPS

Samples

Sample ID Description Type Environment
1 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
174 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
178 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
179 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
180 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
181 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
182 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
183 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
184 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
185 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
186 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
187 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
188 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
189 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
190 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
191 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
192 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
193 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
194 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
195 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
196 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
197 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
198 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
199 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
200 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
201 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
202 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
203 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
204 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
205 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
206 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
207 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
208 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
209 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
210 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
211 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
212 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
213 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
214 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
215 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
216 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
217 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
218 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
219 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
220 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
221 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
222 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
223 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
224 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
225 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
226 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
227 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
228 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
229 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
230 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
231 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
232 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
233 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
234 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
235 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
236 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
237 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
238 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
239 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
240 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
241 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
242 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
243 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
244 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
245 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
246 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
247 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
248 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
249 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
250 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
251 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
252 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
253 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
254 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
255 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
256 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
257 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
258 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
259 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
260 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
261 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
262 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
263 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
264 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
265 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
278 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
279 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
280 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
281 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
282 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
283 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
284 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
285 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
286 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
287 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
288 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
289 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
290 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
291 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
292 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
293 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
294 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
295 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
296 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
297 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
299 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
300 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
301 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
302 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
303 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
304 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
305 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
306 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
307 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
308 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
309 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
310 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
311 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
312 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
313 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
314 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
315 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.86
Metatranscriptomes 0.14
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.55
Rhizosphere 98.45
Stem 0
Stem Tuber 0
Unclassified 23.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070701_10031718 3300005438 Bacteria 2624
2 JGI24741J21665_1064407 3300001915 Bacteria 542
3 JGI24749J21850_1046725 3300002076 Unclassified 641
4 Ga0065712_10651287 3300005290 Bacteria 567
5 Ga0065712_10670575 3300005290 Unclassified 558
6 Ga0065715_10010652 3300005293 Bacteria 2501
7 Ga0065715_10504188 3300005293 Unclassified 777
8 Ga0065707_10011386 3300005295 Bacteria 2848
9 Ga0065707_10593886 3300005295 Bacteria 694
10 Ga0065707_10780851 3300005295 Bacteria 607
11 Ga0070676_10023699 3300005328 Bacteria 3451
12 Ga0070676_10096934 3300005328 Unclassified 1816
13 Ga0070683_100065325 3300005329 Bacteria 3388
14 Ga0070683_100187972 3300005329 Bacteria 1961
15 Ga0070690_100064304 3300005330 Unclassified 2369
16 Ga0070690_100125420 3300005330 Bacteria 1728
17 Ga0070670_100008413 3300005331 Bacteria 8795
18 Ga0070670_100055633 3300005331 Unclassified 3396
19 Ga0070670_100327149 3300005331 Bacteria 1344
20 Ga0070677_10316326 3300005333 Bacteria 798
21 Ga0070677_10332330 3300005333 Bacteria 782
22 Ga0068869_100009772 3300005334 Bacteria 6230
23 Ga0068869_100051682 3300005334 Unclassified 2981
24 Ga0068869_101385749 3300005334 Bacteria 622
25 Ga0070666_10033691 3300005335 Unclassified 3391
26 Ga0070666_10112108 3300005335 Bacteria 1887
27 Ga0070666_10502751 3300005335 Bacteria 879
28 Ga0070680_100113788 3300005336 Bacteria 2254
29 Ga0070680_100176246 3300005336 Bacteria 1800
30 Ga0070680_100177520 3300005336 Bacteria 1793
31 Ga0070680_100320128 3300005336 Unclassified 1316
32 Ga0070680_100719766 3300005336 Bacteria 859
33 Ga0070682_101270452 3300005337 Unclassified 624
34 Ga0068868_100048641 3300005338 Bacteria 3326
35 Ga0068868_100159650 3300005338 Bacteria 1861
36 Ga0068868_100385286 3300005338 Unclassified 1207
37 Ga0068868_101424623 3300005338 Unclassified 647
38 Ga0070660_100075568 3300005339 Bacteria 2638
39 Ga0070660_100132449 3300005339 Bacteria 1996
40 Ga0070660_101018768 3300005339 Bacteria 700
41 Ga0070689_100021243 3300005340 Bacteria 4829
42 Ga0070689_100232735 3300005340 Bacteria 1515
43 Ga0070689_101190645 3300005340 Unclassified 684
44 Ga0070691_10166864 3300005341 Bacteria 1138
45 Ga0070691_10818469 3300005341 Bacteria 568
46 Ga0070687_100001076 3300005343 Bacteria 9361
47 Ga0070687_100019832 3300005343 Bacteria 3136
48 Ga0070661_100010303 3300005344 Bacteria 6498
49 Ga0070661_100025238 3300005344 Bacteria 4271
50 Ga0070661_100069304 3300005344 Bacteria 2593
51 Ga0070661_100153663 3300005344 Bacteria 1741
52 Ga0070661_100424832 3300005344 Unclassified 1054
53 Ga0070661_100537143 3300005344 Unclassified 939
54 Ga0070668_100003992 3300005347 Bacteria 10922
55 Ga0070668_100028357 3300005347 Bacteria 4251
56 Ga0070668_100114003 3300005347 Bacteria 2154
57 Ga0070668_100263201 3300005347 Bacteria 1435
58 Ga0070669_100024592 3300005353 Bacteria 4320
59 Ga0070669_100031683 3300005353 Bacteria 3819
60 Ga0070669_100122553 3300005353 Bacteria 1985
61 Ga0070669_100216823 3300005353 Bacteria 1512
62 Ga0070669_100863359 3300005353 Unclassified 771
63 Ga0070675_100010675 3300005354 Bacteria 7182
64 Ga0070675_100089067 3300005354 Bacteria 2583
65 Ga0070675_100093313 3300005354 Unclassified 2524
66 Ga0070675_101148363 3300005354 Unclassified 715
67 Ga0070671_100338286 3300005355 Bacteria 1284
68 Ga0070671_100537149 3300005355 Bacteria 1008
69 Ga0070674_100027324 3300005356 Bacteria 3739
70 Ga0070674_100185680 3300005356 Bacteria 1596
71 Ga0070674_100949144 3300005356 Unclassified 752
72 Ga0070673_100086209 3300005364 Bacteria 2558
73 Ga0070673_100208117 3300005364 Bacteria 1688
74 Ga0070673_100305526 3300005364 Bacteria 1402
75 Ga0070673_100649906 3300005364 Unclassified 965
76 Ga0070688_100008531 3300005365 Bacteria 5567
77 Ga0070688_100018415 3300005365 Bacteria 4030
78 Ga0070688_100329012 3300005365 Unclassified 1112
79 Ga0070688_100568652 3300005365 Bacteria 864
80 Ga0070659_100018822 3300005366 Bacteria 5214
81 Ga0070659_100062234 3300005366 Unclassified 2950
82 Ga0070659_100186860 3300005366 Bacteria 1702
83 Ga0070659_100274562 3300005366 Bacteria 1401
84 Ga0070659_101714598 3300005366 Unclassified 562
85 Ga0070667_100015360 3300005367 Bacteria 6331
86 Ga0070667_100088866 3300005367 Unclassified 2653
87 Ga0070667_100301534 3300005367 Bacteria 1443
88 Ga0070667_100308736 3300005367 Bacteria 1425
89 Ga0070667_100436666 3300005367 Unclassified 1195
90 Ga0070714_100078143 3300005435 Bacteria 2876
91 Ga0070713_100001685 3300005436 Bacteria 14195
92 Ga0070713_100005739 3300005436 Bacteria 8523
93 Ga0070713_102207558 3300005436 Unclassified 533
94 Ga0070701_10142202 3300005438 Bacteria 1374
95 Ga0070711_100030729 3300005439 Bacteria 3560
96 Ga0070711_100386568 3300005439 Bacteria 1133
97 Ga0070711_101946377 3300005439 Unclassified 517
98 Ga0070700_100027052 3300005441 Bacteria 3397
99 Ga0070700_100073125 3300005441 Bacteria 2193
100 Ga0070694_100116624 3300005444 Bacteria 1910
101 Ga0070694_100186038 3300005444 Bacteria 1539
102 Ga0070663_100088515 3300005455 Bacteria 2290
103 Ga0070663_102020159 3300005455 Unclassified 519
104 Ga0070678_100395708 3300005456 Unclassified 1199
105 Ga0070678_100588028 3300005456 Unclassified 992
106 Ga0070662_100027980 3300005457 Bacteria 3920
107 Ga0070662_100050331 3300005457 Bacteria 3005
108 Ga0070662_100062912 3300005457 Bacteria 2713
109 Ga0070662_100080583 3300005457 Bacteria 2424
110 Ga0070681_10002146 3300005458 Bacteria 17942
111 Ga0070681_10042760 3300005458 Bacteria 4539
112 Ga0070681_10490056 3300005458 Bacteria 1142
113 Ga0070681_10896081 3300005458 Bacteria 805
114 Ga0068867_100106246 3300005459 Bacteria 2150
115 Ga0068867_100179183 3300005459 Bacteria 1684
116 Ga0068867_100354697 3300005459 Unclassified 1225
117 Ga0068867_100424630 3300005459 Unclassified 1127
118 Ga0068867_100599209 3300005459 Bacteria 961
119 Ga0070685_10120671 3300005466 Unclassified 1628
120 Ga0070685_10150402 3300005466 Bacteria 1475
121 Ga0070685_10858252 3300005466 Unclassified 673
122 Ga0070698_100043161 3300005471 Unclassified 4625
123 Ga0070698_100332628 3300005471 Bacteria 1450
124 Ga0070699_100262680 3300005518 Bacteria 1544
125 Ga0070679_100001455 3300005530 Bacteria 20959
126 Ga0070679_101861068 3300005530 Unclassified 550
127 Ga0070684_100000957 3300005535 Bacteria 20571
128 Ga0070684_100245905 3300005535 Bacteria 1635
129 Ga0070684_100347015 3300005535 Bacteria 1365
130 Ga0068853_100013241 3300005539 Bacteria 6731
131 Ga0068853_100086481 3300005539 Bacteria 2749
132 Ga0068853_100930092 3300005539 Unclassified 836
133 Ga0070672_100005674 3300005543 Bacteria 8311
134 Ga0070672_100017274 3300005543 Bacteria 5188
135 Ga0070672_100113868 3300005543 Unclassified 2208
136 Ga0070672_100161487 3300005543 Bacteria 1859
137 Ga0070672_100307883 3300005543 Bacteria 1344
138 Ga0070686_100083572 3300005544 Bacteria 2120
139 Ga0070686_100136690 3300005544 Unclassified 1701
140 Ga0070686_100429602 3300005544 Bacteria 1011
141 Ga0070686_100604928 3300005544 Unclassified 864
142 Ga0070695_100236085 3300005545 Bacteria 1324
143 Ga0070693_101005382 3300005547 Bacteria 631
144 Ga0070693_101279358 3300005547 Bacteria 566
145 Ga0070665_100078387 3300005548 Bacteria 3310
146 Ga0070665_100629100 3300005548 Bacteria 1086
147 Ga0070665_101100724 3300005548 Bacteria 806
148 Ga0070665_101548738 3300005548 Unclassified 671
149 Ga0068855_100048485 3300005563 Bacteria 5012
150 Ga0068855_100062527 3300005563 Bacteria 4346
151 Ga0068855_100289689 3300005563 Unclassified 1815
152 Ga0068855_100413924 3300005563 Bacteria 1475
153 Ga0070664_100014428 3300005564 Bacteria 6443
154 Ga0070664_100018618 3300005564 Bacteria 5709
155 Ga0070664_100054506 3300005564 Bacteria 3392
156 Ga0070664_100105008 3300005564 Bacteria 2460
157 Ga0070664_100227951 3300005564 Unclassified 1669
158 Ga0070664_100318797 3300005564 Unclassified 1408
159 Ga0070664_101429865 3300005564 Unclassified 654
160 Ga0068857_100001714 3300005577 Bacteria 17635
161 Ga0068857_100022540 3300005577 Bacteria 5541
162 Ga0068857_100175335 3300005577 Bacteria 1950
163 Ga0068857_100196992 3300005577 Unclassified 1835
164 Ga0068857_100973119 3300005577 Bacteria 816
165 Ga0068854_100110186 3300005578 Bacteria 2075
166 Ga0068854_100872448 3300005578 Unclassified 789
167 Ga0068856_100044029 3300005614 Bacteria 4391
168 Ga0068856_100491389 3300005614 Bacteria 1248
169 Ga0070702_100972060 3300005615 Unclassified 670
170 Ga0070702_101020129 3300005615 Unclassified 656
171 Ga0068852_100071384 3300005616 Bacteria 3049
172 Ga0068852_100455261 3300005616 Unclassified 1267
173 Ga0068852_100703207 3300005616 Unclassified 1021
174 Ga0068852_101187750 3300005616 Bacteria 784
175 Ga0068859_100005500 3300005617 Bacteria 12901
176 Ga0068859_100420632 3300005617 Unclassified 1432
177 Ga0068859_100505509 3300005617 Bacteria 1304
178 Ga0068864_100154940 3300005618 Unclassified 2079
179 Ga0068864_100276570 3300005618 Bacteria 1566
180 Ga0068864_100327207 3300005618 Bacteria 1441
181 Ga0068866_10023508 3300005718 Bacteria 2868
182 Ga0068861_100000931 3300005719 Bacteria 17786
183 Ga0068861_100030245 3300005719 Bacteria 3967
184 Ga0068861_100317903 3300005719 Bacteria 1355
185 Ga0068861_100474651 3300005719 Unclassified 1125
186 Ga0068861_102098081 3300005719 Bacteria 565
187 Ga0068851_10008434 3300005834 Bacteria 4762
188 Ga0068851_10561431 3300005834 Unclassified 691
189 Ga0068870_10052606 3300005840 Unclassified 2160
190 Ga0068870_10118302 3300005840 Bacteria 1523
191 Ga0068870_10328542 3300005840 Bacteria 974
192 Ga0068863_100033037 3300005841 Bacteria 4929
193 Ga0068863_100151130 3300005841 Unclassified 2222
194 Ga0068863_100444433 3300005841 Bacteria 1272
195 Ga0068858_100039995 3300005842 Bacteria 4348
196 Ga0068858_101634199 3300005842 Unclassified 636
197 Ga0068860_100038901 3300005843 Bacteria 4550
198 Ga0068860_100631065 3300005843 Unclassified 1078
199 Ga0068862_100005519 3300005844 Bacteria 10568
200 Ga0068862_100017989 3300005844 Bacteria 5887
201 Ga0068862_100036106 3300005844 Bacteria 4187
202 Ga0068862_100464657 3300005844 Bacteria 1195
203 Ga0068862_100910877 3300005844 Bacteria 865
204 Ga0070717_10016409 3300006028 Bacteria 5741
205 Ga0070717_10894798 3300006028 Unclassified 808
206 Ga0070717_11160685 3300006028 Bacteria 703
207 Ga0070716_100484253 3300006173 Unclassified 909
208 Ga0070712_100409426 3300006175 Unclassified 1122
209 Ga0097621_100239802 3300006237 Bacteria 1585
210 Ga0097621_100388583 3300006237 Unclassified 1247
211 Ga0068871_100987933 3300006358 Unclassified 783
212 Ga0068871_101017991 3300006358 Bacteria 772
213 Ga0075428_100023914 3300006844 Bacteria 6761
214 Ga0075428_100035579 3300006844 Bacteria 5488
215 Ga0075428_100501948 3300006844 Bacteria 1298
216 Ga0075428_101414439 3300006844 Bacteria 730
217 Ga0075430_100118015 3300006846 Bacteria 2212
218 Ga0075430_100296094 3300006846 Unclassified 1338
219 Ga0075430_100950369 3300006846 Bacteria 708
220 Ga0075430_101120931 3300006846 Unclassified 648
221 Ga0075431_100073063 3300006847 Bacteria 3539
222 Ga0075431_100080566 3300006847 Bacteria 3361
223 Ga0075431_100202248 3300006847 Bacteria 2032
224 Ga0075431_101912780 3300006847 Bacteria 549
225 Ga0075433_10023625 3300006852 Bacteria 5177
226 Ga0075434_100040987 3300006871 Bacteria 4585
227 Ga0075434_101156380 3300006871 Unclassified 786
228 Ga0075429_100213905 3300006880 Bacteria 1689
229 Ga0075429_100215608 3300006880 Bacteria 1682
230 Ga0075429_100247026 3300006880 Bacteria 1562
231 Ga0075429_100294212 3300006880 Bacteria 1422
232 Ga0075429_100908210 3300006880 Bacteria 771
233 Ga0068865_100027105 3300006881 Bacteria 3782
234 Ga0068865_100144770 3300006881 Bacteria 1796
235 Ga0068865_100887073 3300006881 Bacteria 775
236 Ga0075436_100038866 3300006914 Bacteria 3284
237 Ga0075436_100937471 3300006914 Unclassified 648
238 Ga0097620_100005500 3300006931 Bacteria 12901
239 Ga0097620_100420627 3300006931 Unclassified 1432
240 Ga0097620_100505504 3300006931 Bacteria 1304
241 Ga0075435_100095872 3300007076 Bacteria 2454
242 Ga0075435_100101591 3300007076 Unclassified 2383
243 Ga0105244_10498820 3300009036 Bacteria 560
244 Ga0105240_10104448 3300009093 Bacteria 3440
245 Ga0105240_10545712 3300009093 Bacteria 1283
246 Ga0105240_12533603 3300009093 Unclassified 530
247 Ga0111539_10013776 3300009094 Bacteria 10101
248 Ga0111539_10057912 3300009094 Bacteria 4599
249 Ga0111539_10063050 3300009094 Bacteria 4386
250 Ga0111539_10432672 3300009094 Bacteria 1532
251 Ga0111539_10467039 3300009094 Bacteria 1469
252 Ga0111539_10895130 3300009094 Unclassified 1032
253 Ga0105245_10184825 3300009098 Unclassified 1993
254 Ga0105245_10205360 3300009098 Bacteria 1894
255 Ga0114129_10553570 3300009147 Bacteria 1495
256 Ga0114129_10741441 3300009147 Bacteria 1258
257 Ga0114129_10870623 3300009147 Unclassified 1144
258 Ga0114129_11923517 3300009147 Bacteria 717
259 Ga0105243_10057924 3300009148 Bacteria 3086
260 Ga0105243_10199609 3300009148 Unclassified 1753
261 Ga0105241_10016159 3300009174 Bacteria 5471
262 Ga0105241_10598546 3300009174 Bacteria 996
263 Ga0105242_10099996 3300009176 Bacteria 2455
264 Ga0105248_10019925 3300009177 Bacteria 7425
265 Ga0105248_10028008 3300009177 Bacteria 6275
266 Ga0105248_11343958 3300009177 Bacteria 808
267 Ga0105248_13270662 3300009177 Bacteria 515
268 Ga0105237_10068093 3300009545 Bacteria 3554
269 Ga0105237_10117351 3300009545 Bacteria 2655
270 Ga0105238_10110158 3300009551 Bacteria 2734
271 Ga0105238_10469671 3300009551 Bacteria 1256
272 Ga0105249_10000854 3300009553 Bacteria 27209
273 Ga0105249_10008187 3300009553 Bacteria 9110
274 Ga0105249_10072066 3300009553 Bacteria 3193
275 Ga0105239_10154310 3300010375 Bacteria 2564
276 Ga0105239_11476606 3300010375 Bacteria 785
277 Ga0105246_10435786 3300011119 Bacteria 1098
278 Ga0157373_10039503 3300013100 Bacteria 3379
279 Ga0157373_10056833 3300013100 Bacteria 2777
280 Ga0157373_11333678 3300013100 Bacteria 544
281 Ga0157373_11589824 3300013100 Unclassified 500
282 Ga0157371_10069307 3300013102 Bacteria 2497
283 Ga0157371_11198428 3300013102 Unclassified 585
284 Ga0157370_10001559 3300013104 Bacteria 28406
285 Ga0157370_10183855 3300013104 Bacteria 1941
286 Ga0157370_10686245 3300013104 Bacteria 935
287 Ga0157369_10010691 3300013105 Bacteria 10444
288 Ga0157369_10088649 3300013105 Bacteria 3303
289 Ga0157369_10120795 3300013105 Bacteria 2780
290 Ga0157369_10313803 3300013105 Unclassified 1630
291 Ga0157374_10103549 3300013296 Bacteria 2731
292 Ga0157374_11827936 3300013296 Bacteria 633
293 Ga0157378_10407952 3300013297 Bacteria 1340
294 Ga0157378_10412995 3300013297 Bacteria 1332
295 Ga0157378_11380744 3300013297 Unclassified 747
296 Ga0163162_10051909 3300013306 Bacteria 4116
297 Ga0163162_10053842 3300013306 Bacteria 4045
298 Ga0163162_10193209 3300013306 Unclassified 2163
299 Ga0163162_10616311 3300013306 Bacteria 1211
300 Ga0157372_10003203 3300013307 Bacteria 17673
301 Ga0157372_10007502 3300013307 Bacteria 11601
302 Ga0157372_10046068 3300013307 Bacteria 4840
303 Ga0157372_10115402 3300013307 Bacteria 3079
304 Ga0157372_10429413 3300013307 Bacteria 1540
305 Ga0157372_10646136 3300013307 Unclassified 1232
306 Ga0157372_11037378 3300013307 Bacteria 949
307 Ga0157375_10064305 3300013308 Unclassified 3652
308 Ga0157375_10131904 3300013308 Bacteria 2619
309 Ga0157375_12006366 3300013308 Unclassified 688
310 Ga0163163_10013138 3300014325 Bacteria 7567
311 Ga0163163_10550465 3300014325 Bacteria 1216
312 Ga0163163_10798632 3300014325 Unclassified 1007
313 Ga0157380_10019451 3300014326 Bacteria 5060
314 Ga0157380_10066201 3300014326 Bacteria 2905
315 Ga0157380_11114706 3300014326 Bacteria 829
316 Ga0157377_10014003 3300014745 Bacteria 4072
317 Ga0157377_10154430 3300014745 Unclassified 1422
318 Ga0157377_10310892 3300014745 Bacteria 1043
319 Ga0157379_10066546 3300014968 Bacteria 3221
320 Ga0206353_10727485 3300020082 Unclassified 682
321 Ga0207697_10011245 3300025315 Bacteria 3791
322 Ga0207656_10022914 3300025321 Bacteria 2509
323 Ga0207656_10080658 3300025321 Bacteria 1462
324 Ga0207682_10147038 3300025893 Bacteria 1061
325 Ga0207682_10328641 3300025893 Bacteria 719
326 Ga0207692_10052874 3300025898 Bacteria 2066
327 Ga0207692_10378608 3300025898 Bacteria 878
328 Ga0207692_10861600 3300025898 Unclassified 595
329 Ga0207642_10233704 3300025899 Bacteria 1034
330 Ga0207688_10035400 3300025901 Bacteria 2766
331 Ga0207688_10120976 3300025901 Bacteria 1528
332 Ga0207680_10080533 3300025903 Bacteria 2045
333 Ga0207680_10255084 3300025903 Unclassified 1212
334 Ga0207680_10504634 3300025903 Bacteria 862
335 Ga0207647_10099031 3300025904 Bacteria 1732
336 Ga0207699_10021794 3300025906 Bacteria 3461
337 Ga0207699_10047262 3300025906 Unclassified 2522
338 Ga0207645_10005671 3300025907 Bacteria 9016
339 Ga0207645_10689172 3300025907 Unclassified 694
340 Ga0207645_10751258 3300025907 Unclassified 663
341 Ga0207643_10020268 3300025908 Bacteria 3649
342 Ga0207643_10027918 3300025908 Unclassified 3133
343 Ga0207643_10305416 3300025908 Bacteria 991
344 Ga0207654_10139777 3300025911 Unclassified 1543
345 Ga0207654_10694208 3300025911 Unclassified 731
346 Ga0207707_10004220 3300025912 Bacteria 12721
347 Ga0207707_10066770 3300025912 Bacteria 3132
348 Ga0207707_10204592 3300025912 Bacteria 1721
349 Ga0207707_10780685 3300025912 Bacteria 797
350 Ga0207695_10056336 3300025913 Bacteria 4091
351 Ga0207695_10093010 3300025913 Bacteria 3025
352 Ga0207695_10097029 3300025913 Bacteria 2949
353 Ga0207695_10241922 3300025913 Unclassified 1706
354 Ga0207671_10060599 3300025914 Bacteria 2807
355 Ga0207671_10422235 3300025914 Bacteria 1061
356 Ga0207693_10077746 3300025915 Bacteria 2598
357 Ga0207663_10346974 3300025916 Bacteria 1123
358 Ga0207663_10507688 3300025916 Unclassified 937
359 Ga0207663_11436369 3300025916 Unclassified 556
360 Ga0207660_10200978 3300025917 Bacteria 1557
361 Ga0207660_10657486 3300025917 Bacteria 855
362 Ga0207660_10808412 3300025917 Unclassified 765
363 Ga0207660_10869845 3300025917 Bacteria 736
364 Ga0207660_11333339 3300025917 Bacteria 582
365 Ga0207662_10002548 3300025918 Bacteria 9178
366 Ga0207662_10007493 3300025918 Bacteria 5942
367 Ga0207657_10039784 3300025919 Bacteria 4174
368 Ga0207657_10084785 3300025919 Bacteria 2655
369 Ga0207657_10708870 3300025919 Unclassified 781
370 Ga0207649_10003804 3300025920 Bacteria 8234
371 Ga0207649_10081991 3300025920 Bacteria 2090
372 Ga0207649_10125303 3300025920 Unclassified 1737
373 Ga0207649_10170900 3300025920 Bacteria 1514
374 Ga0207649_10414066 3300025920 Bacteria 1011
375 Ga0207652_10020303 3300025921 Bacteria 5469
376 Ga0207681_10020798 3300025923 Bacteria 4164
377 Ga0207681_10045936 3300025923 Bacteria 2935
378 Ga0207681_10106399 3300025923 Bacteria 2033
379 Ga0207681_10120030 3300025923 Unclassified 1927
380 Ga0207681_10196218 3300025923 Bacteria 1547
381 Ga0207694_10036116 3300025924 Bacteria 3791
382 Ga0207694_11155594 3300025924 Bacteria 655
383 Ga0207694_11678584 3300025924 Bacteria 535
384 Ga0207650_10192919 3300025925 Bacteria 1628
385 Ga0207650_10221253 3300025925 Bacteria 1524
386 Ga0207650_10236841 3300025925 Bacteria 1474
387 Ga0207650_10334684 3300025925 Bacteria 1242
388 Ga0207650_10352973 3300025925 Bacteria 1210
389 Ga0207650_10432707 3300025925 Bacteria 1093
390 Ga0207650_10594022 3300025925 Bacteria 930
391 Ga0207659_10043884 3300025926 Bacteria 3144
392 Ga0207659_10171406 3300025926 Unclassified 1712
393 Ga0207659_10889514 3300025926 Unclassified 766
394 Ga0207659_11502878 3300025926 Bacteria 576
395 Ga0207687_10407669 3300025927 Bacteria 1119
396 Ga0207700_10004515 3300025928 Bacteria 8217
397 Ga0207700_10132094 3300025928 Bacteria 2040
398 Ga0207700_10651381 3300025928 Bacteria 939
399 Ga0207664_10067195 3300025929 Bacteria 2876
400 Ga0207664_10155331 3300025929 Bacteria 1947
401 Ga0207664_10198493 3300025929 Bacteria 1730
402 Ga0207644_10408206 3300025931 Bacteria 1111
403 Ga0207644_10591209 3300025931 Bacteria 921
404 Ga0207690_10017832 3300025932 Bacteria 4344
405 Ga0207690_10055401 3300025932 Bacteria 2670
406 Ga0207690_10243170 3300025932 Bacteria 1387
407 Ga0207690_10452925 3300025932 Bacteria 1032
408 Ga0207706_10000182 3300025933 Bacteria 70053
409 Ga0207706_10102037 3300025933 Bacteria 2524
410 Ga0207706_10104465 3300025933 Bacteria 2492
411 Ga0207686_10108576 3300025934 Bacteria 1867
412 Ga0207686_10687472 3300025934 Bacteria 812
413 Ga0207709_10163273 3300025935 Bacteria 1556
414 Ga0207670_10005372 3300025936 Bacteria 7026
415 Ga0207670_10177177 3300025936 Unclassified 1603
416 Ga0207670_10877858 3300025936 Unclassified 750
417 Ga0207669_10108044 3300025937 Bacteria 1857
418 Ga0207704_10119400 3300025938 Bacteria 1801
419 Ga0207704_10679333 3300025938 Unclassified 851
420 Ga0207704_10809753 3300025938 Bacteria 783
421 Ga0207665_10255133 3300025939 Unclassified 1297
422 Ga0207691_10007444 3300025940 Bacteria 10540
423 Ga0207691_10023917 3300025940 Bacteria 5749
424 Ga0207691_10028397 3300025940 Bacteria 5238
425 Ga0207691_10040335 3300025940 Bacteria 4314
426 Ga0207691_10285592 3300025940 Bacteria 1419
427 Ga0207711_10175680 3300025941 Bacteria 1946
428 Ga0207711_10273233 3300025941 Bacteria 1555
429 Ga0207711_11918957 3300025941 Unclassified 535
430 Ga0207689_10015674 3300025942 Bacteria 6417
431 Ga0207689_10017991 3300025942 Bacteria 5967
432 Ga0207689_10359854 3300025942 Bacteria 1210
433 Ga0207661_10012394 3300025944 Bacteria 6194
434 Ga0207661_11209794 3300025944 Unclassified 695
435 Ga0207679_10006184 3300025945 Bacteria 7558
436 Ga0207679_10007521 3300025945 Bacteria 6914
437 Ga0207679_10067640 3300025945 Bacteria 2681
438 Ga0207679_10136604 3300025945 Bacteria 1975
439 Ga0207679_10173485 3300025945 Bacteria 1777
440 Ga0207679_10412763 3300025945 Bacteria 1190
441 Ga0207651_10088850 3300025960 Bacteria 2254
442 Ga0207651_10118759 3300025960 Bacteria 2001
443 Ga0207651_10569180 3300025960 Unclassified 987
444 Ga0207651_11346639 3300025960 Bacteria 642
445 Ga0207712_10003231 3300025961 Bacteria 10356
446 Ga0207712_10006706 3300025961 Bacteria 7259
447 Ga0207668_10075770 3300025972 Bacteria 2420
448 Ga0207668_10419101 3300025972 Unclassified 1136
449 Ga0207640_10760996 3300025981 Bacteria 836
450 Ga0207640_10983696 3300025981 Bacteria 741
451 Ga0207658_10038995 3300025986 Bacteria 3426
452 Ga0207658_10256961 3300025986 Unclassified 1487
453 Ga0207658_10400761 3300025986 Unclassified 1206
454 Ga0207677_10065024 3300026023 Unclassified 2543
455 Ga0207677_10133317 3300026023 Bacteria 1890
456 Ga0207677_10307293 3300026023 Unclassified 1312
457 Ga0207677_10547859 3300026023 Bacteria 1008
458 Ga0207703_12003749 3300026035 Bacteria 555
459 Ga0207639_10084071 3300026041 Bacteria 2527
460 Ga0207639_10324021 3300026041 Bacteria 1369
461 Ga0207639_10535313 3300026041 Bacteria 1074
462 Ga0207678_10020854 3300026067 Bacteria 5743
463 Ga0207678_11774788 3300026067 Unclassified 541
464 Ga0207708_10025246 3300026075 Bacteria 4494
465 Ga0207708_10044111 3300026075 Bacteria 3398
466 Ga0207702_10165097 3300026078 Bacteria 2025
467 Ga0207702_10275290 3300026078 Bacteria 1589
468 Ga0207641_10055885 3300026088 Bacteria 3353
469 Ga0207641_10409699 3300026088 Unclassified 1303
470 Ga0207641_10641493 3300026088 Bacteria 1042
471 Ga0207641_11867677 3300026088 Unclassified 602
472 Ga0207648_10087998 3300026089 Bacteria 2711
473 Ga0207648_10175960 3300026089 Bacteria 1893
474 Ga0207648_10258122 3300026089 Bacteria 1555
475 Ga0207648_10283120 3300026089 Bacteria 1483
476 Ga0207676_10904821 3300026095 Unclassified 866
477 Ga0207676_10907870 3300026095 Unclassified 864
478 Ga0207676_12438390 3300026095 Unclassified 520
479 Ga0207674_10001301 3300026116 Bacteria 32612
480 Ga0207674_10001495 3300026116 Bacteria 30163
481 Ga0207674_10008003 3300026116 Bacteria 12264
482 Ga0207674_10107155 3300026116 Bacteria 2771
483 Ga0207675_100005686 3300026118 Bacteria 11932
484 Ga0207675_100044260 3300026118 Bacteria 4159
485 Ga0207675_100479683 3300026118 Unclassified 1236
486 Ga0207675_100604290 3300026118 Bacteria 1100
487 Ga0207675_102713109 3300026118 Bacteria 504
488 Ga0207683_10167221 3300026121 Unclassified 1990
489 Ga0207683_10451512 3300026121 Bacteria 1185
490 Ga0207683_10691231 3300026121 Unclassified 946
491 Ga0207698_10244091 3300026142 Bacteria 1639
492 Ga0207698_10470747 3300026142 Bacteria 1217
493 Ga0207698_10593555 3300026142 Unclassified 1091
494 Ga0207698_10752911 3300026142 Bacteria 973
495 Ga0207698_11607401 3300026142 Unclassified 665
496 Ga0207428_10089350 3300027907 Bacteria 2394
497 Ga0268266_10009068 3300028379 Bacteria 8787
498 Ga0268266_10399764 3300028379 Bacteria 1299
499 Ga0268266_10568900 3300028379 Bacteria 1087
500 Ga0268266_11290447 3300028379 Bacteria 705
501 Ga0268266_11993997 3300028379 Unclassified 554
502 Ga0268265_10000759 3300028380 Bacteria 31322
503 Ga0268265_10049246 3300028380 Bacteria 3167
504 Ga0268265_10745377 3300028380 Bacteria 950
505 Ga0268265_11686514 3300028380 Unclassified 639
506 Ga0268265_12000776 3300028380 Unclassified 586
507 Ga0268264_10098700 3300028381 Bacteria 2533
508 Ga0268264_10165707 3300028381 Bacteria 1995
509 Ga0316182_1451853 3300030745 Bacteria 546
510 Ga0307408_100007346 3300031548 Bacteria 7290
511 Ga0307408_100777651 3300031548 Bacteria 867
512 Ga0307405_10000820 3300031731 Bacteria 12222
513 Ga0307405_10106688 3300031731 Unclassified 1890
514 Ga0307413_10001434 3300031824 Bacteria 9027
515 Ga0307413_10061985 3300031824 Bacteria 2311
516 Ga0307413_10346978 3300031824 Unclassified 1144
517 Ga0307413_10348929 3300031824 Bacteria 1141
518 Ga0307413_11182173 3300031824 Bacteria 664
519 Ga0307410_10003797 3300031852 Bacteria 7668
520 Ga0307410_10348407 3300031852 Bacteria 1183
521 Ga0307410_10545160 3300031852 Unclassified 961
522 Ga0307410_10968617 3300031852 Bacteria 732
523 Ga0307410_11729331 3300031852 Bacteria 554
524 Ga0307406_10007794 3300031901 Bacteria 5954
525 Ga0307406_10020214 3300031901 Bacteria 3917
526 Ga0307406_11153640 3300031901 Bacteria 671
527 Ga0307406_11293762 3300031901 Unclassified 636
528 Ga0307406_11519222 3300031901 Bacteria 590
529 Ga0307407_10030901 3300031903 Bacteria 2894
530 Ga0307407_10210752 3300031903 Bacteria 1308
531 Ga0307407_10999254 3300031903 Bacteria 646
532 Ga0307412_10000710 3300031911 Bacteria 19206
533 Ga0307412_10479957 3300031911 Unclassified 1031
534 Ga0307412_10845045 3300031911 Bacteria 798
535 Ga0307409_100197442 3300031995 Unclassified 1797
536 Ga0307409_100207218 3300031995 Bacteria 1759
537 Ga0307409_100605896 3300031995 Bacteria 1083
538 Ga0307409_101858818 3300031995 Bacteria 631
539 Ga0307416_100261619 3300032002 Bacteria 1691
540 Ga0307414_10012587 3300032004 Bacteria 5009
541 Ga0307414_10085382 3300032004 Bacteria 2325
542 Ga0307414_10313620 3300032004 Bacteria 1332
543 Ga0307411_10069970 3300032005 Bacteria 2372
544 Ga0307411_11686462 3300032005 Bacteria 586
545 Ga0307415_100001076 3300032126 Bacteria 12696
546 Ga0307415_100306734 3300032126 Bacteria 1317
547 Ga0307415_100657867 3300032126 Bacteria 940
548 Ga0373923_0091187 3300035111 Bacteria 1333
549 Ga0373936_0035043 3300035113 Bacteria 1997
550 Ga0373945_0182477 3300035116 Bacteria 864
551 Ga0373953_0014589 3300035117 Bacteria 2830
552 Ga0373954_0084110 3300035118 Bacteria 1523
553 Ga0373956_0005416 3300035119 Bacteria 5109
554 Ga0373957_0040118 3300035120 Bacteria 1759
555 Ga0373943_0003071 3300035170 Bacteria 7586
556 Ga0373946_0026785 3300035171 Bacteria 2277
557 Ga0373946_0339004 3300035171 Unclassified 750
558 Ga0373955_0010083 3300035172 Bacteria 4449
559 Ga0316574_1005768 3300035398 Bacteria 502
560 Ga0373931_0570554 3300035691 Bacteria 737
561 Ga0373935_0025087 3300035692 Bacteria 3673
562 Ga0373935_0446223 3300035692 Bacteria 934
563 Ga0373927_0013319 3300035695 Bacteria 5468
564 Ga0373933_0000527 3300035724 Bacteria 23842
565 Ga0373947_0004337 3300035725 Bacteria 8329
566 Ga0373947_0416827 3300035725 Bacteria 907
567 Ga0373937_0039457 3300036401 Unclassified 4303
568 Ga0373925_0110288 3300037068 Bacteria 2125
569 Ga0373925_0327680 3300037068 Bacteria 1240
570 Ga0451800_0462171 3300041459 Bacteria 556
571 Ga0451800_1514298 3300041459 Bacteria 892
572 Ga0439448_0099944 3300042005 Bacteria 985
573 Ga0439448_0343163 3300042005 Bacteria 532
574 Ga0466963_0123711 3300044694 Unclassified 1782
575 Ga0466963_0961742 3300044694 Bacteria 601
576 Ga0466957_0318519 3300044842 Bacteria 1049
577 Ga0451576_0055472 3300045051 Bacteria 4145
578 Ga0451576_0599579 3300045051 Bacteria 1158
579 Ga0466958_0616423 3300045836 Bacteria 706
580 Ga0466967_0072695 3300045976 Bacteria 3083
581 Ga0466967_0091255 3300045976 Unclassified 2768
582 Ga0466967_0096239 3300045976 Bacteria 2700
583 Ga0466967_0098990 3300045976 Bacteria 2663
584 Ga0495592_0027673 3300046454 Bacteria 4296
585 Ga0495603_0016139 3300046455 Bacteria 4516
586 Ga0495629_0035096 3300046459 Bacteria 3545
587 Ga0495629_0077003 3300046459 Bacteria 2328
588 Ga0495641_0473693 3300046461 Bacteria 570
589 Ga0495651_0002397 3300046462 Bacteria 14468
590 Ga0495653_0001540 3300046463 Bacteria 17983
591 Ga0495582_0027018 3300046473 Bacteria 3145
592 Ga0495582_0275883 3300046473 Unclassified 965
593 Ga0495639_0032587 3300046475 Bacteria 2324
594 Ga0495664_0057972 3300046477 Unclassified 2304
595 Ga0495608_0000991 3300046511 Bacteria 20051
596 Ga0495630_0037837 3300046517 Bacteria 3608
597 Ga0495652_0053900 3300046529 Bacteria 3426
598 Ga0495665_0019809 3300046531 Bacteria 3617
599 Ga0495640_0626551 3300046533 Bacteria 648
600 Ga0495586_0029404 3300046535 Bacteria 2940
601 Ga0495587_0052009 3300046536 Bacteria 2419
602 Ga0495598_0082361 3300046537 Bacteria 1035
603 Ga0495645_0005482 3300046543 Bacteria 8715
604 Ga0495622_0102672 3300046557 Bacteria 1310
605 Ga0495667_0004277 3300046559 Bacteria 9626
606 Ga0495634_0058383 3300046642 Bacteria 2572
607 Ga0495635_0000779 3300046663 Bacteria 20760
608 Ga0495588_0039749 3300046674 Bacteria 2397
609 Ga0495657_0019749 3300046675 Bacteria 4857
610 Ga0495599_0006226 3300046678 Bacteria 7193
611 Ga0495623_0000338 3300046679 Bacteria 30811
612 Ga0495646_0070074 3300046680 Bacteria 2066
613 Ga0495647_0320787 3300046681 Bacteria 701
614 Ga0495658_0175327 3300046683 Bacteria 1328
615 Ga0495613_0024907 3300046689 Bacteria 4458
616 Ga0495613_0104451 3300046689 Bacteria 2045
617 Ga0495670_0422279 3300046691 Unclassified 721
618 Ga0495600_0002208 3300046809 Bacteria 11068
619 Ga0495581_0384032 3300047315 Bacteria 819
620 Ga0495604_0054189 3300047317 Bacteria 3096
621 Ga0495636_0425863 3300047318 Unclassified 635
622 Ga0495674_0023225 3300047319 Bacteria 5716
623 Ga0495674_0532268 3300047319 Unclassified 937
624 Ga0495680_0017266 3300047322 Bacteria 6168
625 Ga0495675_0004163 3300047444 Bacteria 8750
626 Ga0495684_0006798 3300047471 Bacteria 8880
627 Ga0495593_0072978 3300047673 Bacteria 1780
628 Ga0495602_0018987 3300048088 Bacteria 6842
629 Ga0495614_0015521 3300048089 Bacteria 3321
630 Ga0496106_0054119 3300048909 Bacteria 3032
631 Ga0496108_0401413 3300048911 Bacteria 1197
632 Ga0496108_1447245 3300048911 Bacteria 573
633 Ga0496109_0131527 3300048912 Bacteria 2336
634 Ga0496109_0550956 3300048912 Bacteria 1088
635 Ga0496110_0210163 3300048913 Bacteria 1769
636 Ga0496112_0066927 3300048915 Bacteria 3545
637 Ga0496112_0099619 3300048915 Unclassified 2876
638 Ga0496113_0744011 3300048916 Bacteria 781
639 Ga0501292_103817 3300049515 Bacteria 566
640 Ga0501296_062953 3300049519 Unclassified 564
641 Ga0501031_0022396 3300049568 Unclassified 4119
642 Ga0501031_0719509 3300049568 Unclassified 641
643 Ga0501032_0002946 3300049569 Bacteria 13237
644 Ga0501034_0001238 3300049571 Bacteria 34664
645 Ga0501036_0004649 3300049572 Bacteria 11094
646 Ga0501037_0016732 3300049573 Bacteria 5396
647 Ga0501038_0014967 3300049574 Bacteria 7064
648 Ga0501039_0013121 3300049575 Bacteria 6334
649 Ga0501040_0312286 3300049576 Bacteria 1124
650 Ga0501043_0008270 3300049579 Bacteria 8198
651 Ga0501046_0004333 3300049580 Bacteria 12917
652 Ga0501047_0002048 3300049581 Bacteria 19273
653 Ga0501048_0009223 3300049582 Bacteria 7413
654 Ga0501067_0019451 3300049583 Bacteria 3760
655 Ga0501068_0003679 3300049584 Bacteria 8297
656 Ga0501069_0065356 3300049585 Bacteria 2034
657 Ga0501069_0832560 3300049585 Bacteria 560
658 Ga0501073_0002773 3300049589 Bacteria 13119
659 Ga0501075_0951471 3300049591 Unclassified 653
660 Ga0501076_0090793 3300049592 Bacteria 2457
661 Ga0501077_0402533 3300049593 Unclassified 875
662 Ga0501217_163646 3300049661 Unclassified 673
663 Ga0501233_141316 3300049668 Unclassified 665
664 Ga0501235_016175 3300049669 Unclassified 1647
665 Ga0501249_107796 3300049679 Bacteria 671
666 Ga0501258_031180 3300049687 Unclassified 674
667 Ga0501259_010487 3300049688 Unclassified 1515
668 Ga0501225_0212957 3300049705 Unclassified 619
669 Ga0501225_0285017 3300049705 Unclassified 554
670 Ga0501079_0173862 3300049741 Bacteria 1679
671 Ga0501080_0002266 3300049742 Bacteria 16739
672 Ga0501083_0714982 3300049744 Bacteria 651
673 Ga0501268_081465 3300049765 Unclassified 669
674 Ga0501272_013307 3300049769 Bacteria 942
675 Ga0501275_082713 3300049772 Bacteria 523
676 Ga0501035_0012388 3300049822 Bacteria 7883
677 Ga0501044_0001527 3300049823 Bacteria 27141
678 nmdc:mga05p37_588917_c1 3300050507 Bacteria 1258
679 nmdc:mga05p37_734374_c1 3300050507 Unclassified 1091
680 nmdc:mga09592_249064_c1 3300050508 Bacteria 1540
681 nmdc:mga09592_291970_c1 3300050508 Bacteria 1413
682 nmdc:mga09592_403491_c1 3300050508 Bacteria 1181
683 nmdc:mga09592_441701_c1 3300050508 Bacteria 1123
684 nmdc:mga09592_460627_c1 3300050508 Bacteria 1096
685 nmdc:mga09592_821719_c1 3300050508 Bacteria 785
686 nmdc:mga0qj67_1110919_c1 3300050509 Bacteria 617
687 nmdc:mga0qj67_1449214_c1 3300050509 Unclassified 529
688 nmdc:mga0qj67_35435_c1 3300050509 Unclassified 3902
689 nmdc:mga06r32_1980833_c1 3300050510 Bacteria 516
690 nmdc:mga06r32_29061_c1 3300050510 Bacteria 5177
691 nmdc:mga06r32_460055_c1 3300050510 Bacteria 1251
692 nmdc:mga08y16_293521_c1 3300050511 Bacteria 1676
693 nmdc:mga08y16_60362_c1 3300050511 Bacteria 3961
694 nmdc:mga08y16_943882_c1 3300050511 Bacteria 846
695 nmdc:mga0n895_4861_c1 3300050512 Bacteria 11134
696 nmdc:mga0rr50_91774_c1 3300050513 Unclassified 2366
697 nmdc:mga08x19_34117_c1 3300050514 Bacteria 3215
698 nmdc:mga08x19_713900_c1 3300050514 Unclassified 712
699 nmdc:mga0a205_129695_c1 3300050515 Unclassified 1817
700 nmdc:mga0a205_1440_c1 3300050515 Bacteria 20253
701 Ga0495601_0019596 3300053077 Bacteria 4127
702 Ga0495601_0787235 3300053077 Unclassified 604
703 Ga0495612_0010145 3300053078 Bacteria 3810
704 Ga0495595_0013581 3300053084 Bacteria 3442
705 Ga0495619_0002056 3300053085 Bacteria 13368
706 Ga0501084_0758382 3300054114 Bacteria 818
707 Ga0590071_096555 3300059421 Bacteria 742
708 Ga0501082_0011325 3300060353 Bacteria 7665
709 Ga0530510_0275443 3300061734 Bacteria 1256
710 Ga0070701_10031718
711 JGI24741J21665_1064407
712 JGI24749J21850_1046725
713 Ga0065712_10651287
714 Ga0065712_10670575
715 Ga0065715_10010652
716 Ga0065715_10504188
717 Ga0065707_10011386
718 Ga0065707_10593886
719 Ga0065707_10780851
720 Ga0070676_10023699
721 Ga0070676_10096934
722 Ga0070683_100065325
723 Ga0070683_100187972
724 Ga0070690_100064304
725 Ga0070690_100125420
726 Ga0070670_100008413
727 Ga0070670_100055633
728 Ga0070670_100327149
729 Ga0070677_10316326
730 Ga0070677_10332330
731 Ga0068869_100009772
732 Ga0068869_100051682
733 Ga0068869_101385749
734 Ga0070666_10033691
735 Ga0070666_10112108
736 Ga0070666_10502751
737 Ga0070680_100113788
738 Ga0070680_100176246
739 Ga0070680_100177520
740 Ga0070680_100320128
741 Ga0070680_100719766
742 Ga0070682_101270452
743 Ga0068868_100048641
744 Ga0068868_100159650
745 Ga0068868_100385286
746 Ga0068868_101424623
747 Ga0070660_100075568
748 Ga0070660_100132449
749 Ga0070660_101018768
750 Ga0070689_100021243
751 Ga0070689_100232735
752 Ga0070689_101190645
753 Ga0070691_10166864
754 Ga0070691_10818469
755 Ga0070687_100001076
756 Ga0070687_100019832
757 Ga0070661_100010303
758 Ga0070661_100025238
759 Ga0070661_100069304
760 Ga0070661_100153663
761 Ga0070661_100424832
762 Ga0070661_100537143
763 Ga0070668_100003992
764 Ga0070668_100028357
765 Ga0070668_100114003
766 Ga0070668_100263201
767 Ga0070669_100024592
768 Ga0070669_100031683
769 Ga0070669_100122553
770 Ga0070669_100216823
771 Ga0070669_100863359
772 Ga0070675_100010675
773 Ga0070675_100089067
774 Ga0070675_100093313
775 Ga0070675_101148363
776 Ga0070671_100338286
777 Ga0070671_100537149
778 Ga0070674_100027324
779 Ga0070674_100185680
780 Ga0070674_100949144
781 Ga0070673_100086209
782 Ga0070673_100208117
783 Ga0070673_100305526
784 Ga0070673_100649906
785 Ga0070688_100008531
786 Ga0070688_100018415
787 Ga0070688_100329012
788 Ga0070688_100568652
789 Ga0070659_100018822
790 Ga0070659_100062234
791 Ga0070659_100186860
792 Ga0070659_100274562
793 Ga0070659_101714598
794 Ga0070667_100015360
795 Ga0070667_100088866
796 Ga0070667_100301534
797 Ga0070667_100308736
798 Ga0070667_100436666
799 Ga0070714_100078143
800 Ga0070713_100001685
801 Ga0070713_100005739
802 Ga0070713_102207558
803 Ga0070701_10142202
804 Ga0070711_100030729
805 Ga0070711_100386568
806 Ga0070711_101946377
807 Ga0070700_100027052
808 Ga0070700_100073125
809 Ga0070694_100116624
810 Ga0070694_100186038
811 Ga0070663_100088515
812 Ga0070663_102020159
813 Ga0070678_100395708
814 Ga0070678_100588028
815 Ga0070662_100027980
816 Ga0070662_100050331
817 Ga0070662_100062912
818 Ga0070662_100080583
819 Ga0070681_10002146
820 Ga0070681_10042760
821 Ga0070681_10490056
822 Ga0070681_10896081
823 Ga0068867_100106246
824 Ga0068867_100179183
825 Ga0068867_100354697
826 Ga0068867_100424630
827 Ga0068867_100599209
828 Ga0070685_10120671
829 Ga0070685_10150402
830 Ga0070685_10858252
831 Ga0070698_100043161
832 Ga0070698_100332628
833 Ga0070699_100262680
834 Ga0070679_100001455
835 Ga0070679_101861068
836 Ga0070684_100000957
837 Ga0070684_100245905
838 Ga0070684_100347015
839 Ga0068853_100013241
840 Ga0068853_100086481
841 Ga0068853_100930092
842 Ga0070672_100005674
843 Ga0070672_100017274
844 Ga0070672_100113868
845 Ga0070672_100161487
846 Ga0070672_100307883
847 Ga0070686_100083572
848 Ga0070686_100136690
849 Ga0070686_100429602
850 Ga0070686_100604928
851 Ga0070695_100236085
852 Ga0070693_101005382
853 Ga0070693_101279358
854 Ga0070665_100078387
855 Ga0070665_100629100
856 Ga0070665_101100724
857 Ga0070665_101548738
858 Ga0068855_100048485
859 Ga0068855_100062527
860 Ga0068855_100289689
861 Ga0068855_100413924
862 Ga0070664_100014428
863 Ga0070664_100018618
864 Ga0070664_100054506
865 Ga0070664_100105008
866 Ga0070664_100227951
867 Ga0070664_100318797
868 Ga0070664_101429865
869 Ga0068857_100001714
870 Ga0068857_100022540
871 Ga0068857_100175335
872 Ga0068857_100196992
873 Ga0068857_100973119
874 Ga0068854_100110186
875 Ga0068854_100872448
876 Ga0068856_100044029
877 Ga0068856_100491389
878 Ga0070702_100972060
879 Ga0070702_101020129
880 Ga0068852_100071384
881 Ga0068852_100455261
882 Ga0068852_100703207
883 Ga0068852_101187750
884 Ga0068859_100005500
885 Ga0068859_100420632
886 Ga0068859_100505509
887 Ga0068864_100154940
888 Ga0068864_100276570
889 Ga0068864_100327207
890 Ga0068866_10023508
891 Ga0068861_100000931
892 Ga0068861_100030245
893 Ga0068861_100317903
894 Ga0068861_100474651
895 Ga0068861_102098081
896 Ga0068851_10008434
897 Ga0068851_10561431
898 Ga0068870_10052606
899 Ga0068870_10118302
900 Ga0068870_10328542
901 Ga0068863_100033037
902 Ga0068863_100151130
903 Ga0068863_100444433
904 Ga0068858_100039995
905 Ga0068858_101634199
906 Ga0068860_100038901
907 Ga0068860_100631065
908 Ga0068862_100005519
909 Ga0068862_100017989
910 Ga0068862_100036106
911 Ga0068862_100464657
912 Ga0068862_100910877
913 Ga0070717_10016409
914 Ga0070717_10894798
915 Ga0070717_11160685
916 Ga0070716_100484253
917 Ga0070712_100409426
918 Ga0097621_100239802
919 Ga0097621_100388583
920 Ga0068871_100987933
921 Ga0068871_101017991
922 Ga0075428_100023914
923 Ga0075428_100035579
924 Ga0075428_100501948
925 Ga0075428_101414439
926 Ga0075430_100118015
927 Ga0075430_100296094
928 Ga0075430_100950369
929 Ga0075430_101120931
930 Ga0075431_100073063
931 Ga0075431_100080566
932 Ga0075431_100202248
933 Ga0075431_101912780
934 Ga0075433_10023625
935 Ga0075434_100040987
936 Ga0075434_101156380
937 Ga0075429_100213905
938 Ga0075429_100215608
939 Ga0075429_100247026
940 Ga0075429_100294212
941 Ga0075429_100908210
942 Ga0068865_100027105
943 Ga0068865_100144770
944 Ga0068865_100887073
945 Ga0075436_100038866
946 Ga0075436_100937471
947 Ga0097620_100005500
948 Ga0097620_100420627
949 Ga0097620_100505504
950 Ga0075435_100095872
951 Ga0075435_100101591
952 Ga0105244_10498820
953 Ga0105240_10104448
954 Ga0105240_10545712
955 Ga0105240_12533603
956 Ga0111539_10013776
957 Ga0111539_10057912
958 Ga0111539_10063050
959 Ga0111539_10432672
960 Ga0111539_10467039
961 Ga0111539_10895130
962 Ga0105245_10184825
963 Ga0105245_10205360
964 Ga0114129_10553570
965 Ga0114129_10741441
966 Ga0114129_10870623
967 Ga0114129_11923517
968 Ga0105243_10057924
969 Ga0105243_10199609
970 Ga0105241_10016159
971 Ga0105241_10598546
972 Ga0105242_10099996
973 Ga0105248_10019925
974 Ga0105248_10028008
975 Ga0105248_11343958
976 Ga0105248_13270662
977 Ga0105237_10068093
978 Ga0105237_10117351
979 Ga0105238_10110158
980 Ga0105238_10469671
981 Ga0105249_10000854
982 Ga0105249_10008187
983 Ga0105249_10072066
984 Ga0105239_10154310
985 Ga0105239_11476606
986 Ga0105246_10435786
987 Ga0157373_10039503
988 Ga0157373_10056833
989 Ga0157373_11333678
990 Ga0157373_11589824
991 Ga0157371_10069307
992 Ga0157371_11198428
993 Ga0157370_10001559
994 Ga0157370_10183855
995 Ga0157370_10686245
996 Ga0157369_10010691
997 Ga0157369_10088649
998 Ga0157369_10120795
999 Ga0157369_10313803
1000 Ga0157374_10103549
1001 Ga0157374_11827936
1002 Ga0157378_10407952
1003 Ga0157378_10412995
1004 Ga0157378_11380744
1005 Ga0163162_10051909
1006 Ga0163162_10053842
1007 Ga0163162_10193209
1008 Ga0163162_10616311
1009 Ga0157372_10003203
1010 Ga0157372_10007502
1011 Ga0157372_10046068
1012 Ga0157372_10115402
1013 Ga0157372_10429413
1014 Ga0157372_10646136
1015 Ga0157372_11037378
1016 Ga0157375_10064305
1017 Ga0157375_10131904
1018 Ga0157375_12006366
1019 Ga0163163_10013138
1020 Ga0163163_10550465
1021 Ga0163163_10798632
1022 Ga0157380_10019451
1023 Ga0157380_10066201
1024 Ga0157380_11114706
1025 Ga0157377_10014003
1026 Ga0157377_10154430
1027 Ga0157377_10310892
1028 Ga0157379_10066546
1029 Ga0206353_10727485
1030 Ga0207697_10011245
1031 Ga0207656_10022914
1032 Ga0207656_10080658
1033 Ga0207682_10147038
1034 Ga0207682_10328641
1035 Ga0207692_10052874
1036 Ga0207692_10378608
1037 Ga0207692_10861600
1038 Ga0207642_10233704
1039 Ga0207688_10035400
1040 Ga0207688_10120976
1041 Ga0207680_10080533
1042 Ga0207680_10255084
1043 Ga0207680_10504634
1044 Ga0207647_10099031
1045 Ga0207699_10021794
1046 Ga0207699_10047262
1047 Ga0207645_10005671
1048 Ga0207645_10689172
1049 Ga0207645_10751258
1050 Ga0207643_10020268
1051 Ga0207643_10027918
1052 Ga0207643_10305416
1053 Ga0207654_10139777
1054 Ga0207654_10694208
1055 Ga0207707_10004220
1056 Ga0207707_10066770
1057 Ga0207707_10204592
1058 Ga0207707_10780685
1059 Ga0207695_10056336
1060 Ga0207695_10093010
1061 Ga0207695_10097029
1062 Ga0207695_10241922
1063 Ga0207671_10060599
1064 Ga0207671_10422235
1065 Ga0207693_10077746
1066 Ga0207663_10346974
1067 Ga0207663_10507688
1068 Ga0207663_11436369
1069 Ga0207660_10200978
1070 Ga0207660_10657486
1071 Ga0207660_10808412
1072 Ga0207660_10869845
1073 Ga0207660_11333339
1074 Ga0207662_10002548
1075 Ga0207662_10007493
1076 Ga0207657_10039784
1077 Ga0207657_10084785
1078 Ga0207657_10708870
1079 Ga0207649_10003804
1080 Ga0207649_10081991
1081 Ga0207649_10125303
1082 Ga0207649_10170900
1083 Ga0207649_10414066
1084 Ga0207652_10020303
1085 Ga0207681_10020798
1086 Ga0207681_10045936
1087 Ga0207681_10106399
1088 Ga0207681_10120030
1089 Ga0207681_10196218
1090 Ga0207694_10036116
1091 Ga0207694_11155594
1092 Ga0207694_11678584
1093 Ga0207650_10192919
1094 Ga0207650_10221253
1095 Ga0207650_10236841
1096 Ga0207650_10334684
1097 Ga0207650_10352973
1098 Ga0207650_10432707
1099 Ga0207650_10594022
1100 Ga0207659_10043884
1101 Ga0207659_10171406
1102 Ga0207659_10889514
1103 Ga0207659_11502878
1104 Ga0207687_10407669
1105 Ga0207700_10004515
1106 Ga0207700_10132094
1107 Ga0207700_10651381
1108 Ga0207664_10067195
1109 Ga0207664_10155331
1110 Ga0207664_10198493
1111 Ga0207644_10408206
1112 Ga0207644_10591209
1113 Ga0207690_10017832
1114 Ga0207690_10055401
1115 Ga0207690_10243170
1116 Ga0207690_10452925
1117 Ga0207706_10000182
1118 Ga0207706_10102037
1119 Ga0207706_10104465
1120 Ga0207686_10108576
1121 Ga0207686_10687472
1122 Ga0207709_10163273
1123 Ga0207670_10005372
1124 Ga0207670_10177177
1125 Ga0207670_10877858
1126 Ga0207669_10108044
1127 Ga0207704_10119400
1128 Ga0207704_10679333
1129 Ga0207704_10809753
1130 Ga0207665_10255133
1131 Ga0207691_10007444
1132 Ga0207691_10023917
1133 Ga0207691_10028397
1134 Ga0207691_10040335
1135 Ga0207691_10285592
1136 Ga0207711_10175680
1137 Ga0207711_10273233
1138 Ga0207711_11918957
1139 Ga0207689_10015674
1140 Ga0207689_10017991
1141 Ga0207689_10359854
1142 Ga0207661_10012394
1143 Ga0207661_11209794
1144 Ga0207679_10006184
1145 Ga0207679_10007521
1146 Ga0207679_10067640
1147 Ga0207679_10136604
1148 Ga0207679_10173485
1149 Ga0207679_10412763
1150 Ga0207651_10088850
1151 Ga0207651_10118759
1152 Ga0207651_10569180
1153 Ga0207651_11346639
1154 Ga0207712_10003231
1155 Ga0207712_10006706
1156 Ga0207668_10075770
1157 Ga0207668_10419101
1158 Ga0207640_10760996
1159 Ga0207640_10983696
1160 Ga0207658_10038995
1161 Ga0207658_10256961
1162 Ga0207658_10400761
1163 Ga0207677_10065024
1164 Ga0207677_10133317
1165 Ga0207677_10307293
1166 Ga0207677_10547859
1167 Ga0207703_12003749
1168 Ga0207639_10084071
1169 Ga0207639_10324021
1170 Ga0207639_10535313
1171 Ga0207678_10020854
1172 Ga0207678_11774788
1173 Ga0207708_10025246
1174 Ga0207708_10044111
1175 Ga0207702_10165097
1176 Ga0207702_10275290
1177 Ga0207641_10055885
1178 Ga0207641_10409699
1179 Ga0207641_10641493
1180 Ga0207641_11867677
1181 Ga0207648_10087998
1182 Ga0207648_10175960
1183 Ga0207648_10258122
1184 Ga0207648_10283120
1185 Ga0207676_10904821
1186 Ga0207676_10907870
1187 Ga0207676_12438390
1188 Ga0207674_10001301
1189 Ga0207674_10001495
1190 Ga0207674_10008003
1191 Ga0207674_10107155
1192 Ga0207675_100005686
1193 Ga0207675_100044260
1194 Ga0207675_100479683
1195 Ga0207675_100604290
1196 Ga0207675_102713109
1197 Ga0207683_10167221
1198 Ga0207683_10451512
1199 Ga0207683_10691231
1200 Ga0207698_10244091
1201 Ga0207698_10470747
1202 Ga0207698_10593555
1203 Ga0207698_10752911
1204 Ga0207698_11607401
1205 Ga0207428_10089350
1206 Ga0268266_10009068
1207 Ga0268266_10399764
1208 Ga0268266_10568900
1209 Ga0268266_11290447
1210 Ga0268266_11993997
1211 Ga0268265_10000759
1212 Ga0268265_10049246
1213 Ga0268265_10745377
1214 Ga0268265_11686514
1215 Ga0268265_12000776
1216 Ga0268264_10098700
1217 Ga0268264_10165707
1218 Ga0316182_1451853
1219 Ga0307408_100007346
1220 Ga0307408_100777651
1221 Ga0307405_10000820
1222 Ga0307405_10106688
1223 Ga0307413_10001434
1224 Ga0307413_10061985
1225 Ga0307413_10346978
1226 Ga0307413_10348929
1227 Ga0307413_11182173
1228 Ga0307410_10003797
1229 Ga0307410_10348407
1230 Ga0307410_10545160
1231 Ga0307410_10968617
1232 Ga0307410_11729331
1233 Ga0307406_10007794
1234 Ga0307406_10020214
1235 Ga0307406_11153640
1236 Ga0307406_11293762
1237 Ga0307406_11519222
1238 Ga0307407_10030901
1239 Ga0307407_10210752
1240 Ga0307407_10999254
1241 Ga0307412_10000710
1242 Ga0307412_10479957
1243 Ga0307412_10845045
1244 Ga0307409_100197442
1245 Ga0307409_100207218
1246 Ga0307409_100605896
1247 Ga0307409_101858818
1248 Ga0307416_100261619
1249 Ga0307414_10012587
1250 Ga0307414_10085382
1251 Ga0307414_10313620
1252 Ga0307411_10069970
1253 Ga0307411_11686462
1254 Ga0307415_100001076
1255 Ga0307415_100306734
1256 Ga0307415_100657867
1257 Ga0373923_0091187
1258 Ga0373936_0035043
1259 Ga0373945_0182477
1260 Ga0373953_0014589
1261 Ga0373954_0084110
1262 Ga0373956_0005416
1263 Ga0373957_0040118
1264 Ga0373943_0003071
1265 Ga0373946_0026785
1266 Ga0373946_0339004
1267 Ga0373955_0010083
1268 Ga0316574_1005768
1269 Ga0373931_0570554
1270 Ga0373935_0025087
1271 Ga0373935_0446223
1272 Ga0373927_0013319
1273 Ga0373933_0000527
1274 Ga0373947_0004337
1275 Ga0373947_0416827
1276 Ga0373937_0039457
1277 Ga0373925_0110288
1278 Ga0373925_0327680
1279 Ga0451800_0462171
1280 Ga0451800_1514298
1281 Ga0439448_0099944
1282 Ga0439448_0343163
1283 Ga0466963_0123711
1284 Ga0466963_0961742
1285 Ga0466957_0318519
1286 Ga0451576_0055472
1287 Ga0451576_0599579
1288 Ga0466958_0616423
1289 Ga0466967_0072695
1290 Ga0466967_0091255
1291 Ga0466967_0096239
1292 Ga0466967_0098990
1293 Ga0495592_0027673
1294 Ga0495603_0016139
1295 Ga0495629_0035096
1296 Ga0495629_0077003
1297 Ga0495641_0473693
1298 Ga0495651_0002397
1299 Ga0495653_0001540
1300 Ga0495582_0027018
1301 Ga0495582_0275883
1302 Ga0495639_0032587
1303 Ga0495664_0057972
1304 Ga0495608_0000991
1305 Ga0495630_0037837
1306 Ga0495652_0053900
1307 Ga0495665_0019809
1308 Ga0495640_0626551
1309 Ga0495586_0029404
1310 Ga0495587_0052009
1311 Ga0495598_0082361
1312 Ga0495645_0005482
1313 Ga0495622_0102672
1314 Ga0495667_0004277
1315 Ga0495634_0058383
1316 Ga0495635_0000779
1317 Ga0495588_0039749
1318 Ga0495657_0019749
1319 Ga0495599_0006226
1320 Ga0495623_0000338
1321 Ga0495646_0070074
1322 Ga0495647_0320787
1323 Ga0495658_0175327
1324 Ga0495613_0024907
1325 Ga0495613_0104451
1326 Ga0495670_0422279
1327 Ga0495600_0002208
1328 Ga0495581_0384032
1329 Ga0495604_0054189
1330 Ga0495636_0425863
1331 Ga0495674_0023225
1332 Ga0495674_0532268
1333 Ga0495680_0017266
1334 Ga0495675_0004163
1335 Ga0495684_0006798
1336 Ga0495593_0072978
1337 Ga0495602_0018987
1338 Ga0495614_0015521
1339 Ga0496106_0054119
1340 Ga0496108_0401413
1341 Ga0496108_1447245
1342 Ga0496109_0131527
1343 Ga0496109_0550956
1344 Ga0496110_0210163
1345 Ga0496112_0066927
1346 Ga0496112_0099619
1347 Ga0496113_0744011
1348 Ga0501292_103817
1349 Ga0501296_062953
1350 Ga0501031_0022396
1351 Ga0501031_0719509
1352 Ga0501032_0002946
1353 Ga0501034_0001238
1354 Ga0501036_0004649
1355 Ga0501037_0016732
1356 Ga0501038_0014967
1357 Ga0501039_0013121
1358 Ga0501040_0312286
1359 Ga0501043_0008270
1360 Ga0501046_0004333
1361 Ga0501047_0002048
1362 Ga0501048_0009223
1363 Ga0501067_0019451
1364 Ga0501068_0003679
1365 Ga0501069_0065356
1366 Ga0501069_0832560
1367 Ga0501073_0002773
1368 Ga0501075_0951471
1369 Ga0501076_0090793
1370 Ga0501077_0402533
1371 Ga0501217_163646
1372 Ga0501233_141316
1373 Ga0501235_016175
1374 Ga0501249_107796
1375 Ga0501258_031180
1376 Ga0501259_010487
1377 Ga0501225_0212957
1378 Ga0501225_0285017
1379 Ga0501079_0173862
1380 Ga0501080_0002266
1381 Ga0501083_0714982
1382 Ga0501268_081465
1383 Ga0501272_013307
1384 Ga0501275_082713
1385 Ga0501035_0012388
1386 Ga0501044_0001527
1387 nmdc:mga05p37_588917_c1
1388 nmdc:mga05p37_734374_c1
1389 nmdc:mga09592_249064_c1
1390 nmdc:mga09592_291970_c1
1391 nmdc:mga09592_403491_c1
1392 nmdc:mga09592_441701_c1
1393 nmdc:mga09592_460627_c1
1394 nmdc:mga09592_821719_c1
1395 nmdc:mga0qj67_1110919_c1
1396 nmdc:mga0qj67_1449214_c1
1397 nmdc:mga0qj67_35435_c1
1398 nmdc:mga06r32_1980833_c1
1399 nmdc:mga06r32_29061_c1
1400 nmdc:mga06r32_460055_c1
1401 nmdc:mga08y16_293521_c1
1402 nmdc:mga08y16_60362_c1
1403 nmdc:mga08y16_943882_c1
1404 nmdc:mga0n895_4861_c1
1405 nmdc:mga0rr50_91774_c1
1406 nmdc:mga08x19_34117_c1
1407 nmdc:mga08x19_713900_c1
1408 nmdc:mga0a205_129695_c1
1409 nmdc:mga0a205_1440_c1
1410 Ga0495601_0019596
1411 Ga0495601_0787235
1412 Ga0495612_0010145
1413 Ga0495595_0013581
1414 Ga0495619_0002056
1415 Ga0501084_0758382
1416 Ga0590071_096555
1417 Ga0501082_0011325
1418 Ga0530510_0275443

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

29

103

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hhh-assembly1.cif.gz_B crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9212 14 109
1xma-assembly1.cif.gz_B-2 structure of a transcriptional regulator from clostridium thermocellum cth-833 0.917 11 106
1xma-assembly1.cif.gz_A structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9117 11 106
6abq-assembly1.cif.gz_A crystal structure of transcription factor from listeria monocytogenes 0.9097 10 107
3l7w-assembly1.cif.gz_A-2 the crystal structure of smu.1704 from streptococcus mutans ua159 0.9022 7 110
ID Description Score Start End Superfamily
1xmaA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9117 11 106 1.10.10.10
3l7wA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9004 7 110 1.10.10.10
af_I6X7F9_1_101_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8872 11 111 1.10.10.10
af_P71704_1_89_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8855 14 94 1.10.10.10
af_Q2FUS4_1_110_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8831 11 112 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2V8EA09-F1-model_v4 PadR family transcriptional regulator 0.9943 11 89
AF-A0A7W0YJI2-F1-model_v4 PadR family transcriptional regulator 0.9933 17 111
AF-A0A2V8HL98-F1-model_v4 PadR family transcriptional regulator 0.9912 11 111
AF-W0RGM1-F1-model_v4 Transcriptional regulator, PadR-family 0.991 11 111
AF-A0A843TB24-F1-model_v4 PadR family transcriptional regulator 0.991 11 111

Map