F476562

General Info

Members Datasets Scaffolds Average Seq Length
707 435 643 331

Family's Representative Sequence

Representative Sequence 3300046530|Ga0495654_0002952|Ga0495654_0002952_305_1372
Length 355
Sequence MIEIERVFVIESFAEKPVQFVRRVTLAVPEAPTRWSVEAIEELLELPFMELMFRAQTVHRANFPEGDVQLSTLLSVKTGGCPEDCGYCPQSVHYDTGVQASKLMAVDAVVQAATAAKAAGATRFCMGAAWRSPKDRDVENVAELVRAVKDLGMETCATLGMLEDGHAEQLRDAGLDYYNHNLDTAPDFYGDIIDTRVYQDRLDTLERVRDAGVKVCSGGIVGMGETRAQRAGLLAQLANLTPDYPESVPVNNLVRVAGTPLADTPPLDPLEFVRVIAAARITMPRARVRLSAGRQQLGEAVQALCFMAGANSIFYGDKLLVTGNPDVTADLALIEKLGLKTSQGVATSKIEGVCA

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
3 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
4 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
5 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
6 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
7 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
8 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
9 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
10 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
11 2643221570 Acidovorax sp. Root568 Isolate Unclassified
12 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
13 2643221596 Acidovorax sp. Root70 Isolate Unclassified
14 2643221609 Acidovorax sp. Root217 Isolate Unclassified
15 2643221611 Acidovorax sp. Root219 Isolate Unclassified
16 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
17 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
18 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
19 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
20 2643221652 Acidovorax sp. Root402 Isolate Unclassified
21 2643221658 Variovorax sp. Root411 Isolate Unclassified
22 2643221660 Methylibium sp. Root1272 Isolate Unclassified
23 2643221672 Variovorax sp. Root434 Isolate Unclassified
24 2643221683 Variovorax sp. Root473 Isolate Unclassified
25 2643221717 Acidovorax sp. Root267 Isolate Unclassified
26 2721755523 Delftia sp. HK171 Isolate Unclassified
27 2738541277 Variovorax sp. GV051 Isolate Unclassified
28 2738541307 Variovorax sp. GV008 Isolate Unclassified
29 2738543012 Acidovorax sp. CF301 Isolate Unclassified
30 2738543013 Variovorax sp. BT01 Isolate Unclassified
31 2738543019 Variovorax sp. GV040 Isolate Unclassified
32 2786546548 Spartobacteria bacterium LR76 Isolate Unclassified
33 2816332133 Acidovorax radicis 2721A Isolate Unclassified
34 2818991446 Variovorax sp. 1180 Isolate Unclassified
35 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
36 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
37 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
38 2842677519 Variovorax sp. R-72495 Isolate Unclassified
39 2842733646 Variovorax sp. R-72446 Isolate Unclassified
40 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
41 2885198086 Variovorax sp. 679 Isolate Unclassified
42 2885211737 Variovorax sp. 553 Isolate Unclassified
43 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
44 2899924645 Variovorax sp. 369 Isolate Unclassified
45 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
46 2904456579 Variovorax sp. 2002 Isolate Unclassified
47 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
48 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
49 2928037797 Variovorax sp. 1126 Isolate Unclassified
50 2928044640 Variovorax sp. 1128 Isolate Unclassified
51 2928051484 Variovorax sp. 1133 Isolate Unclassified
52 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
53 2928070936 Variovorax gossypii 1167 Isolate Unclassified
54 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
55 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
56 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
57 2929520902 Variovorax beijingensis 502 Isolate Unclassified
58 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
59 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
60 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
61 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
62 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
63 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
64 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
65 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
66 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
67 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
68 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
69 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
70 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
71 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
72 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
73 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
74 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
75 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
76 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
77 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
78 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
79 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
80 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
81 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
82 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
83 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
84 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
85 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
86 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
87 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
88 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
89 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
90 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
91 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
92 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
93 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
94 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
95 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
96 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
97 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
98 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
99 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
100 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
101 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
102 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
103 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
104 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
105 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
106 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
107 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
108 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
109 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
110 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
111 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
112 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
113 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
114 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
115 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
116 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
117 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
118 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
119 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
120 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
121 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
122 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
123 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
124 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
125 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
126 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
127 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
128 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
129 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
130 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
131 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
132 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
133 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
134 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
135 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
136 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
137 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
138 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
139 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
140 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
141 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
142 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
143 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
144 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
145 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
146 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
147 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
148 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
149 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
150 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
151 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
152 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
153 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
154 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
155 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
156 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
157 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
158 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
159 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
160 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
161 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
162 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
163 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
164 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
165 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
166 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
167 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
168 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
169 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
170 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
171 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
172 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
173 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
174 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
175 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
176 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
177 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
178 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
179 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
180 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
181 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
182 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
183 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
184 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
185 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
186 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
187 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
188 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
189 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
190 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
191 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
192 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
193 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
194 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
195 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
196 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
197 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
198 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
199 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
200 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
201 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
202 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
203 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
204 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
205 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
206 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
207 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
208 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
209 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
210 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
211 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
212 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
213 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
214 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
215 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
216 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
217 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
218 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
219 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
220 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
221 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
222 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
223 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
224 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
225 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
226 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
227 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
270 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
273 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
274 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
275 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
277 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
278 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
279 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
280 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
281 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
282 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
283 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
284 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
286 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
287 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
288 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
289 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
290 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
291 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
292 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
293 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
294 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
295 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
296 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
297 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
298 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
299 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
300 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
301 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
302 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
303 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
304 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
305 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
306 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
307 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
308 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
309 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
310 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
311 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
312 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
313 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
314 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
315 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
316 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
317 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
318 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
319 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
320 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
321 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
322 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
323 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
324 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
325 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
326 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
327 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
328 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
329 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
330 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
331 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
332 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
333 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
334 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
335 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
336 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
337 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
338 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
339 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
340 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
341 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
342 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
343 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
344 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
345 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
346 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
347 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
348 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
349 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
350 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
351 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
352 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
353 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
354 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
355 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
356 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
357 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
358 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
359 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
360 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
361 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
362 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
363 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
364 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
365 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
366 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
367 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
368 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
369 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
370 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
371 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
372 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
373 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
374 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
375 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
376 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
377 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
378 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
379 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
380 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
381 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
382 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
383 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
384 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
385 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
386 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
387 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
388 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
389 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
390 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
391 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
392 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
393 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
394 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
395 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
396 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
397 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
398 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
399 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
400 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
401 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
402 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
403 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
404 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
405 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
406 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
407 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
408 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
409 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
410 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
411 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
412 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
413 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
414 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
415 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
416 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
417 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
418 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
419 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
420 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
421 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
422 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
423 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
424 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
425 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
426 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
427 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
428 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
429 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
430 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
431 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
432 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
433 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
434 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
435 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.81
Metatranscriptomes 0.14
Isolates 9.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 28.01
Nodule 0.85
Rhizoplane 3.68
Rhizosphere 56.44
Stem 0
Stem Tuber 0
Unclassified 11.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000022 3300002704 Bacteria 142950
2 JGI25156J39149_1000005 3300002705 Bacteria 263980
3 JGI25154J39366_1000017 3300002738 Bacteria 252448
4 JGI25154J39366_1000144 3300002738 Bacteria 55903
5 JGI25157J39369_1000003 3300002741 Bacteria 274935
6 JGI25152J39213_1001039 3300002773 Bacteria 13223
7 JGI25152J39213_1002236 3300002773 Bacteria 7506
8 JGI25152J39213_1008961 3300002773 Bacteria 2425
9 JGI25150J39212_1001144 3300002774 Bacteria 7964
10 JGI25159J45721_1001875 3300002987 Bacteria 8405
11 JGI25151J46595_10004359 3300003187 Bacteria 7506
12 JGI25151J46595_10006381 3300003187 Bacteria 5930
13 JGI25151J46595_10021663 3300003187 Bacteria 2684
14 JGI25151J46595_10036647 3300003187 Bacteria 1848
15 JGI25153J46596_10001721 3300003215 Bacteria 12977
16 JGI25153J46596_10002983 3300003215 Bacteria 9573
17 JGI25153J46596_10004499 3300003215 Bacteria 7506
18 JGI25153J46596_10019874 3300003215 Bacteria 2556
19 rootH1_10321829 3300003323 Bacteria 3129
20 JGI25160J50197_1000149 3300003354 Bacteria 61868
21 JGI25160J50197_1003145 3300003354 Bacteria 7506
22 JGI25161J50226_1000149 3300003374 Bacteria 48658
23 JGI25161J50226_1000313 3300003374 Bacteria 26654
24 JGI25161J50226_1004959 3300003374 Bacteria 2692
25 Ga0006562J51391_1043718 3300003578 Bacteria 4198
26 Ga0055527_1003500 3300003760 Bacteria 2318
27 Ga0055535_1000370 3300003761 Bacteria 43378
28 Ga0055542_1000027 3300003762 Bacteria 254819
29 Ga0055526_1000806 3300003771 Bacteria 23377
30 Ga0055526_1004742 3300003771 Bacteria 8055
31 Ga0055526_1005254 3300003771 Bacteria 7506
32 Ga0055526_1005263 3300003771 Bacteria 7497
33 Ga0055537_1000115 3300003773 Bacteria 60828
34 Ga0055537_1000193 3300003773 Bacteria 45640
35 Ga0055537_1001687 3300003773 Bacteria 8178
36 Ga0055524_1000045 3300003775 Bacteria 151148
37 Ga0055524_1000186 3300003775 Bacteria 69106
38 Ga0055524_1003565 3300003775 Bacteria 7506
39 Ga0055524_1012871 3300003775 Bacteria 3188
40 Ga0055536_1001483 3300003781 Bacteria 14119
41 Ga0055536_1002616 3300003781 Bacteria 10028
42 Ga0055536_1008776 3300003781 Bacteria 4285
43 Ga0055534_1000186 3300003784 Bacteria 45640
44 Ga0055534_1002964 3300003784 Bacteria 5616
45 Ga0055534_1004985 3300003784 Bacteria 3685
46 Ga0055528_1000876 3300003790 Bacteria 20397
47 Ga0055528_1001789 3300003790 Bacteria 12328
48 Ga0055528_1003742 3300003790 Bacteria 7506
49 Ga0055530_10000208 3300003791 Bacteria 53265
50 Ga0055530_10000754 3300003791 Bacteria 26927
51 Ga0055530_10002914 3300003791 Bacteria 10365
52 Ga0055530_10020614 3300003791 Bacteria 1964
53 Ga0055540_1000002 3300003792 Bacteria 436954
54 Ga0055540_1000037 3300003792 Bacteria 162957
55 Ga0055540_1000208 3300003792 Bacteria 56164
56 Ga0055540_1002391 3300003792 Bacteria 9989
57 Ga0055540_1003178 3300003792 Bacteria 8098
58 Ga0055540_1003965 3300003792 Bacteria 6906
59 Ga0055540_1004398 3300003792 Bacteria 6377
60 Ga0055531_10000112 3300003794 Bacteria 89016
61 Ga0055531_10000985 3300003794 Bacteria 22675
62 Ga0055531_10005970 3300003794 Bacteria 6996
63 Ga0055531_10026342 3300003794 Bacteria 2077
64 Ga0055543_1000338 3300004625 Bacteria 32020
65 Ga0055543_1001675 3300004625 Bacteria 8419
66 Ga0065165_1002005 3300005262 Bacteria 19074
67 Ga0065165_1004119 3300005262 Bacteria 9346
68 Ga0065704_10220052 3300005289 Unclassified 1077
69 Ga0070690_100001484 3300005330 Bacteria 12276
70 Ga0070690_100093910 3300005330 Bacteria 1979
71 Ga0070670_100145982 3300005331 Bacteria 2047
72 Ga0070670_100245020 3300005331 Bacteria 1561
73 Ga0068869_100000273 3300005334 Bacteria 27167
74 Ga0068869_100171411 3300005334 Bacteria 1696
75 Ga0068869_100198008 3300005334 Bacteria 1583
76 Ga0070666_10004746 3300005335 Bacteria 8304
77 Ga0070680_100001733 3300005336 Bacteria 16027
78 Ga0070680_100028407 3300005336 Bacteria 4486
79 Ga0070682_100003195 3300005337 Bacteria 9076
80 Ga0068868_100003962 3300005338 Bacteria 10338
81 Ga0068868_100015847 3300005338 Bacteria 5585
82 Ga0068868_100033124 3300005338 Bacteria 3981
83 Ga0070689_100001839 3300005340 Bacteria 13675
84 Ga0070689_100019016 3300005340 Bacteria 5074
85 Ga0070689_100071304 3300005340 Bacteria 2714
86 Ga0070691_10033222 3300005341 Bacteria 2427
87 Ga0070687_100000342 3300005343 Bacteria 15848
88 Ga0070687_100006002 3300005343 Bacteria 4949
89 Ga0070687_100144579 3300005343 Bacteria 1389
90 Ga0070661_100015813 3300005344 Bacteria 5326
91 Ga0070692_10000556 3300005345 Bacteria 11641
92 Ga0070669_100240145 3300005353 Bacteria 1439
93 Ga0070675_100097957 3300005354 Bacteria 2466
94 Ga0070671_100008644 3300005355 Bacteria 8167
95 Ga0070671_100054588 3300005355 Bacteria 3322
96 Ga0070671_100239564 3300005355 Bacteria 1540
97 Ga0070673_100169020 3300005364 Bacteria 1865
98 Ga0070688_100012315 3300005365 Bacteria 4789
99 Ga0070659_100229996 3300005366 Bacteria 1532
100 Ga0070667_100013891 3300005367 Bacteria 6657
101 Ga0070667_100014378 3300005367 Bacteria 6540
102 Ga0070709_10012962 3300005434 Bacteria 4676
103 Ga0070714_100017248 3300005435 Bacteria 5847
104 Ga0070713_100000191 3300005436 Bacteria 40649
105 Ga0070713_100000621 3300005436 Bacteria 22637
106 Ga0070710_10044557 3300005437 Bacteria 2462
107 Ga0070701_10011786 3300005438 Bacteria 3925
108 Ga0070711_100000562 3300005439 Bacteria 19387
109 Ga0070705_100000256 3300005440 Bacteria 31596
110 Ga0070705_100002681 3300005440 Bacteria 8900
111 Ga0070700_100000439 3300005441 Bacteria 21062
112 Ga0070694_100001510 3300005444 Bacteria 13650
113 Ga0070694_100053156 3300005444 Bacteria 2740
114 Ga0070663_100001582 3300005455 Bacteria 12528
115 Ga0070678_100210831 3300005456 Bacteria 1609
116 Ga0070681_10044801 3300005458 Bacteria 4429
117 Ga0070681_10314483 3300005458 Bacteria 1475
118 Ga0068867_100000173 3300005459 Bacteria 42222
119 Ga0070685_10001706 3300005466 Bacteria 11541
120 Ga0070706_100135616 3300005467 Bacteria 2298
121 Ga0070707_100015406 3300005468 Bacteria 7173
122 Ga0070707_100024152 3300005468 Bacteria 5754
123 Ga0070698_100061390 3300005471 Bacteria 3793
124 Ga0070699_100016433 3300005518 Bacteria 6356
125 Ga0070679_100119770 3300005530 Bacteria 2617
126 Ga0070679_100180418 3300005530 Bacteria 2084
127 Ga0070684_100068341 3300005535 Bacteria 3123
128 Ga0070697_100011036 3300005536 Bacteria 7058
129 Ga0068853_100330213 3300005539 Bacteria 1415
130 Ga0070672_100001881 3300005543 Bacteria 13134
131 Ga0070672_100030668 3300005543 Bacteria 4042
132 Ga0070672_100315915 3300005543 Bacteria 1327
133 Ga0070686_100001277 3300005544 Bacteria 14246
134 Ga0070695_100000435 3300005545 Bacteria 21673
135 Ga0070695_100007268 3300005545 Bacteria 6564
136 Ga0070696_100001923 3300005546 Bacteria 13678
137 Ga0070693_100000767 3300005547 Bacteria 14160
138 Ga0070665_100014147 3300005548 Bacteria 8017
139 Ga0070704_100000352 3300005549 Bacteria 20863
140 Ga0068855_100003461 3300005563 Bacteria 19319
141 Ga0068855_100016738 3300005563 Bacteria 8818
142 Ga0070664_100056188 3300005564 Bacteria 3344
143 Ga0068854_100001551 3300005578 Bacteria 13934
144 Ga0068854_100050573 3300005578 Bacteria 2974
145 Ga0068856_100003478 3300005614 Bacteria 15900
146 Ga0068856_100177237 3300005614 Bacteria 2144
147 Ga0070702_100000058 3300005615 Bacteria 31819
148 Ga0068852_100020805 3300005616 Bacteria 5221
149 Ga0068852_100079476 3300005616 Bacteria 2905
150 Ga0068859_100001741 3300005617 Bacteria 22164
151 Ga0068859_100004400 3300005617 Bacteria 14376
152 Ga0068864_100004626 3300005618 Bacteria 11286
153 Ga0068864_100081136 3300005618 Bacteria 2843
154 Ga0068866_10000319 3300005718 Bacteria 22864
155 Ga0068861_100001064 3300005719 Bacteria 16897
156 Ga0068851_10041299 3300005834 Bacteria 2319
157 Ga0068870_10031696 3300005840 Bacteria 2680
158 Ga0068863_100007778 3300005841 Bacteria 10479
159 Ga0068858_100004395 3300005842 Bacteria 13831
160 Ga0068858_100025618 3300005842 Bacteria 5488
161 Ga0068860_100001660 3300005843 Bacteria 23799
162 Ga0068862_100002351 3300005844 Bacteria 16844
163 Ga0068862_100161170 3300005844 Bacteria 2002
164 Ga0081455_10052334 3300005937 Bacteria 3497
165 Ga0075368_10009373 3300006042 Bacteria 3521
166 Ga0075368_10100244 3300006042 Bacteria 1189
167 Ga0075363_100001677 3300006048 Bacteria 8573
168 Ga0075363_100007805 3300006048 Bacteria 4944
169 Ga0075363_100009044 3300006048 Bacteria 4673
170 Ga0075364_10026130 3300006051 Bacteria 3722
171 Ga0075432_10007744 3300006058 Bacteria 3661
172 Ga0075432_10008061 3300006058 Bacteria 3595
173 Ga0070712_100003612 3300006175 Bacteria 9538
174 Ga0070712_100004881 3300006175 Bacteria 8295
175 Ga0075362_10007515 3300006177 Bacteria 4131
176 Ga0075362_10018266 3300006177 Bacteria 2898
177 Ga0075366_10011360 3300006195 Bacteria 5027
178 Ga0075366_10051707 3300006195 Bacteria 2441
179 Ga0075366_10112363 3300006195 Bacteria 1639
180 Ga0097621_100002532 3300006237 Bacteria 12521
181 Ga0068871_100001204 3300006358 Bacteria 17246
182 Ga0075433_10002739 3300006852 Bacteria 13468
183 Ga0075434_100002699 3300006871 Bacteria 15680
184 Ga0075434_100328554 3300006871 Bacteria 1550
185 Ga0075429_100000079 3300006880 Bacteria 49596
186 Ga0068865_100000581 3300006881 Bacteria 20472
187 Ga0075436_100000279 3300006914 Bacteria 32245
188 Ga0097620_100001741 3300006931 Bacteria 22164
189 Ga0097620_100004399 3300006931 Bacteria 14376
190 Ga0079104_1000581 3300006946 Bacteria 36802
191 Ga0099826_10041721 3300006948 Bacteria 3181
192 Ga0075435_100000137 3300007076 Bacteria 41370
193 Ga0075435_100300352 3300007076 Bacteria 1373
194 Ga0105244_10002269 3300009036 Bacteria 14621
195 Ga0105240_10646004 3300009093 Bacteria 1160
196 Ga0105245_10003062 3300009098 Bacteria 14968
197 Ga0105245_10009415 3300009098 Bacteria 8519
198 Ga0105245_10035818 3300009098 Bacteria 4406
199 Ga0105247_10018997 3300009101 Bacteria 4128
200 Ga0105243_10002968 3300009148 Bacteria 14014
201 Ga0105243_10004809 3300009148 Bacteria 10613
202 Ga0105243_10009022 3300009148 Bacteria 7616
203 Ga0105243_10010608 3300009148 Bacteria 6994
204 Ga0105243_10068236 3300009148 Bacteria 2866
205 Ga0105242_10000847 3300009176 Bacteria 23789
206 Ga0105242_10029669 3300009176 Bacteria 4362
207 Ga0105248_10000917 3300009177 Bacteria 32799
208 Ga0105248_10013308 3300009177 Bacteria 9056
209 Ga0105248_10029005 3300009177 Bacteria 6169
210 Ga0105237_10053862 3300009545 Bacteria 4034
211 Ga0105237_10103598 3300009545 Bacteria 2837
212 Ga0105238_10059889 3300009551 Bacteria 3813
213 Ga0105238_10396176 3300009551 Bacteria 1373
214 Ga0105249_10007388 3300009553 Bacteria 9587
215 Ga0105239_10190462 3300010375 Bacteria 2296
216 Ga0157347_1007863 3300012502 Bacteria 1074
217 Ga0157373_10055307 3300013100 Bacteria 2819
218 Ga0157373_10143725 3300013100 Bacteria 1678
219 Ga0157371_10051373 3300013102 Bacteria 2929
220 Ga0157370_10023603 3300013104 Bacteria 6104
221 Ga0157374_10001809 3300013296 Bacteria 18004
222 Ga0157374_10006440 3300013296 Bacteria 9967
223 Ga0157378_10001080 3300013297 Bacteria 24937
224 Ga0157378_10009954 3300013297 Bacteria 8288
225 Ga0163162_10011811 3300013306 Bacteria 8518
226 Ga0163162_10058649 3300013306 Bacteria 3879
227 Ga0157372_10028243 3300013307 Bacteria 6122
228 Ga0157375_10008616 3300013308 Bacteria 8929
229 Ga0163163_10001352 3300014325 Bacteria 20693
230 Ga0182008_10004955 3300014497 Bacteria 7667
231 Ga0182008_10018136 3300014497 Bacteria 3645
232 Ga0157377_10000039 3300014745 Bacteria 112711
233 Ga0157377_10067845 3300014745 Bacteria 2054
234 Ga0157379_10006078 3300014968 Bacteria 10396
235 Ga0157376_10002188 3300014969 Bacteria 13173
236 Ga0157376_10006034 3300014969 Bacteria 8519
237 Ga0157376_10036556 3300014969 Bacteria 3980
238 Ga0182007_10002945 3300015262 Bacteria 8263
239 Ga0182007_10003185 3300015262 Bacteria 7844
240 Ga0163161_10002684 3300017792 Bacteria 12648
241 Ga0163161_10159225 3300017792 Bacteria 1721
242 Ga0209435_100002 3300025206 Bacteria 794178
243 Ga0209436_107042 3300025208 Bacteria 2399
244 Ga0209672_100222 3300025228 Bacteria 44005
245 Ga0209147_103012 3300025229 Bacteria 3589
246 Ga0209258_100048 3300025242 Bacteria 365881
247 Ga0207425_1000168 3300025245 Bacteria 55214
248 Ga0207425_1000759 3300025245 Bacteria 16712
249 Ga0207425_1002246 3300025245 Bacteria 6985
250 Ga0207425_1011245 3300025245 Bacteria 2143
251 Ga0209646_1000001 3300025246 Bacteria 3092932
252 Ga0209026_1000001 3300025250 Bacteria 1228671
253 Ga0209148_1000040 3300025254 Bacteria 473531
254 Ga0209759_1000001 3300025256 Bacteria 2799452
255 Ga0209129_1000007 3300025258 Bacteria 771325
256 Ga0209129_1000215 3300025258 Bacteria 66656
257 Ga0209129_1005590 3300025258 Bacteria 4381
258 Ga0209565_1000143 3300025263 Bacteria 99302
259 Ga0209565_1000153 3300025263 Bacteria 92909
260 Ga0209565_1000178 3300025263 Bacteria 80603
261 Ga0209565_1000997 3300025263 Bacteria 14548
262 Ga0209565_1014611 3300025263 Bacteria 1796
263 Ga0209673_1000008 3300025273 Bacteria 626013
264 Ga0209673_1000423 3300025273 Bacteria 73682
265 Ga0209673_1000566 3300025273 Bacteria 59095
266 Ga0209673_1000801 3300025273 Bacteria 41669
267 Ga0209673_1021758 3300025273 Bacteria 2233
268 Ga0209130_1000072 3300025284 Bacteria 175726
269 Ga0209130_1000315 3300025284 Bacteria 56958
270 Ga0209130_1000953 3300025284 Bacteria 22898
271 Ga0209130_1001540 3300025284 Bacteria 14698
272 Ga0209675_1000150 3300025291 Bacteria 92909
273 Ga0209675_1000221 3300025291 Bacteria 59141
274 Ga0209675_1000616 3300025291 Bacteria 25512
275 Ga0209675_1004134 3300025291 Bacteria 6593
276 Ga0209676_1000004 3300025292 Bacteria 1138360
277 Ga0209676_1000023 3300025292 Bacteria 589732
278 Ga0209676_1000172 3300025292 Bacteria 153664
279 Ga0209676_1002134 3300025292 Bacteria 15055
280 Ga0209676_1015835 3300025292 Bacteria 2754
281 Ga0209025_1000217 3300025294 Bacteria 137909
282 Ga0209025_1000278 3300025294 Bacteria 117718
283 Ga0209025_1001179 3300025294 Bacteria 36980
284 Ga0209025_1006049 3300025294 Bacteria 9569
285 Ga0209025_1013953 3300025294 Bacteria 4999
286 Ga0209025_1027208 3300025294 Bacteria 2843
287 Ga0209025_1028857 3300025294 Bacteria 2704
288 Ga0209025_1030848 3300025294 Bacteria 2553
289 Ga0209564_1000057 3300025295 Bacteria 340400
290 Ga0209564_1000200 3300025295 Bacteria 137503
291 Ga0209564_1000318 3300025295 Bacteria 93851
292 Ga0209564_1000435 3300025295 Bacteria 72434
293 Ga0209564_1001509 3300025295 Bacteria 23296
294 Ga0209758_1000025 3300025297 Bacteria 586687
295 Ga0209758_1000096 3300025297 Bacteria 231496
296 Ga0209758_1000174 3300025297 Bacteria 147347
297 Ga0209758_1030740 3300025297 Bacteria 2218
298 Ga0209758_1039909 3300025297 Bacteria 1778
299 Ga0209050_1000002 3300025298 Bacteria 1792849
300 Ga0209050_1000022 3300025298 Bacteria 565239
301 Ga0209050_1000861 3300025298 Bacteria 41048
302 Ga0209050_1001035 3300025298 Bacteria 34509
303 Ga0209050_1001442 3300025298 Bacteria 25546
304 Ga0209050_1016424 3300025298 Bacteria 3030
305 Ga0209050_1020413 3300025298 Bacteria 2466
306 Ga0209050_1037215 3300025298 Bacteria 1407
307 Ga0209256_1000001 3300025299 Bacteria 2166974
308 Ga0209256_1000067 3300025299 Bacteria 246812
309 Ga0209256_1000143 3300025299 Bacteria 151331
310 Ga0209256_1000366 3300025299 Bacteria 72685
311 Ga0209256_1019399 3300025299 Bacteria 2165
312 Ga0207426_1000001 3300025302 Bacteria 1341301
313 Ga0207426_1000028 3300025302 Bacteria 483955
314 Ga0207426_1000320 3300025302 Bacteria 92467
315 Ga0207426_1001560 3300025302 Bacteria 18560
316 Ga0209051_1000002 3300025303 Bacteria 1631846
317 Ga0209051_1000013 3300025303 Bacteria 565239
318 Ga0209051_1000024 3300025303 Bacteria 437007
319 Ga0209051_1000049 3300025303 Bacteria 287483
320 Ga0209051_1000096 3300025303 Bacteria 167399
321 Ga0209051_1000532 3300025303 Bacteria 47250
322 Ga0209051_1000913 3300025303 Bacteria 29387
323 Ga0209051_1019034 3300025303 Bacteria 3012
324 Ga0209051_1031963 3300025303 Bacteria 2016
325 Ga0209257_1000002 3300025304 Bacteria 1767052
326 Ga0209257_1000042 3300025304 Bacteria 537149
327 Ga0209257_1000072 3300025304 Bacteria 332791
328 Ga0209257_1000079 3300025304 Bacteria 316420
329 Ga0209257_1006089 3300025304 Bacteria 8015
330 Ga0209257_1016578 3300025304 Bacteria 2969
331 Ga0209257_1021389 3300025304 Bacteria 2352
332 Ga0207655_1001406 3300025728 Bacteria 22426
333 Ga0207653_10036318 3300025885 Bacteria 1605
334 Ga0207682_10012063 3300025893 Bacteria 3375
335 Ga0207642_10000402 3300025899 Bacteria 12999
336 Ga0207710_10053288 3300025900 Bacteria 1820
337 Ga0207688_10070124 3300025901 Bacteria 1987
338 Ga0207680_10002576 3300025903 Bacteria 8460
339 Ga0207685_10010476 3300025905 Bacteria 2740
340 Ga0207699_10041907 3300025906 Bacteria 2648
341 Ga0207684_10149641 3300025910 Bacteria 2008
342 Ga0207684_10189600 3300025910 Bacteria 1773
343 Ga0207654_10065441 3300025911 Bacteria 2140
344 Ga0207707_10178781 3300025912 Bacteria 1853
345 Ga0207671_10276528 3300025914 Bacteria 1324
346 Ga0207693_10000652 3300025915 Bacteria 31091
347 Ga0207693_10042165 3300025915 Bacteria 3593
348 Ga0207663_10002608 3300025916 Bacteria 8679
349 Ga0207660_10001944 3300025917 Bacteria 13785
350 Ga0207662_10000751 3300025918 Bacteria 14865
351 Ga0207662_10015878 3300025918 Bacteria 4242
352 Ga0207657_10007901 3300025919 Bacteria 10850
353 Ga0207649_10009738 3300025920 Bacteria 5263
354 Ga0207652_10026578 3300025921 Bacteria 4823
355 Ga0207646_10067407 3300025922 Bacteria 3195
356 Ga0207646_10072450 3300025922 Bacteria 3077
357 Ga0207659_10071906 3300025926 Bacteria 2527
358 Ga0207659_10233268 3300025926 Bacteria 1485
359 Ga0207687_10002319 3300025927 Bacteria 12956
360 Ga0207687_10018162 3300025927 Bacteria 4640
361 Ga0207700_10000073 3300025928 Bacteria 61784
362 Ga0207700_10006059 3300025928 Bacteria 7282
363 Ga0207664_10000912 3300025929 Bacteria 19958
364 Ga0207644_10001544 3300025931 Bacteria 14840
365 Ga0207644_10069639 3300025931 Bacteria 2569
366 Ga0207644_10324098 3300025931 Bacteria 1246
367 Ga0207690_10102277 3300025932 Bacteria 2048
368 Ga0207690_10148162 3300025932 Bacteria 1737
369 Ga0207706_10198497 3300025933 Bacteria 1760
370 Ga0207686_10004552 3300025934 Bacteria 7432
371 Ga0207686_10206482 3300025934 Bacteria 1410
372 Ga0207709_10000131 3300025935 Bacteria 109649
373 Ga0207709_10001069 3300025935 Bacteria 20157
374 Ga0207709_10001551 3300025935 Bacteria 15784
375 Ga0207709_10004986 3300025935 Bacteria 7592
376 Ga0207709_10035493 3300025935 Bacteria 2948
377 Ga0207709_10044875 3300025935 Bacteria 2674
378 Ga0207670_10001137 3300025936 Bacteria 14023
379 Ga0207670_10008447 3300025936 Bacteria 5817
380 Ga0207665_10006908 3300025939 Bacteria 7511
381 Ga0207665_10007620 3300025939 Bacteria 7150
382 Ga0207711_10000087 3300025941 Bacteria 98302
383 Ga0207711_10152172 3300025941 Bacteria 2088
384 Ga0207711_10153085 3300025941 Bacteria 2082
385 Ga0207689_10000992 3300025942 Bacteria 27226
386 Ga0207689_10020777 3300025942 Bacteria 5522
387 Ga0207689_10184956 3300025942 Bacteria 1718
388 Ga0207661_10179536 3300025944 Bacteria 1848
389 Ga0207679_10003068 3300025945 Bacteria 10343
390 Ga0207667_10014837 3300025949 Bacteria 8860
391 Ga0207667_10044873 3300025949 Bacteria 4682
392 Ga0207651_10006656 3300025960 Bacteria 6080
393 Ga0207651_10058537 3300025960 Bacteria 2663
394 Ga0207712_10008840 3300025961 Bacteria 6368
395 Ga0207658_10030693 3300025986 Bacteria 3808
396 Ga0207677_10003281 3300026023 Bacteria 8554
397 Ga0207677_10006769 3300026023 Bacteria 6296
398 Ga0207677_10013554 3300026023 Bacteria 4730
399 Ga0207703_10001430 3300026035 Bacteria 21789
400 Ga0207703_10003435 3300026035 Bacteria 13293
401 Ga0207639_10175397 3300026041 Bacteria 1819
402 Ga0207678_10000693 3300026067 Bacteria 30761
403 Ga0207708_10002049 3300026075 Bacteria 14857
404 Ga0207702_10263599 3300026078 Bacteria 1623
405 Ga0207641_10008086 3300026088 Bacteria 8714
406 Ga0207648_10000836 3300026089 Bacteria 34689
407 Ga0207648_10004380 3300026089 Bacteria 14518
408 Ga0207676_10000294 3300026095 Bacteria 43081
409 Ga0207676_10066848 3300026095 Bacteria 2869
410 Ga0207674_10002122 3300026116 Bacteria 25063
411 Ga0207675_100003887 3300026118 Bacteria 14518
412 Ga0207675_100485590 3300026118 Bacteria 1228
413 Ga0207698_10077590 3300026142 Bacteria 2664
414 Ga0207698_10093298 3300026142 Bacteria 2471
415 Ga0209281_1000005 3300027111 Bacteria 1242284
416 Ga0209968_1000940 3300027526 Bacteria 4503
417 Ga0209282_1003159 3300027666 Bacteria 9734
418 Ga0209966_1000014 3300027695 Bacteria 81913
419 Ga0207428_10317618 3300027907 Bacteria 1151
420 Ga0268266_10098208 3300028379 Bacteria 2576
421 Ga0268265_10007388 3300028380 Bacteria 7419
422 Ga0268265_10101148 3300028380 Bacteria 2328
423 Ga0268264_10000994 3300028381 Bacteria 28892
424 Ga0268264_10014173 3300028381 Bacteria 6556
425 Ga0265337_1009732 3300028556 Bacteria 3415
426 Ga0307515_10000221 3300028794 Bacteria 141099
427 Ga0307515_10000391 3300028794 Bacteria 106353
428 Ga0307515_10000777 3300028794 Bacteria 73454
429 Ga0307515_10001032 3300028794 Bacteria 63662
430 Ga0307515_10309162 3300028794 Bacteria 1257
431 Ga0307512_10134503 3300030522 Bacteria 1537
432 Ga0316179_1046105 3300030734 Bacteria 2465
433 Ga0316178_1087589 3300030735 Bacteria 3810
434 Ga0316183_1013492 3300030742 Bacteria 2217
435 Ga0316182_1139966 3300030745 Bacteria 2149
436 Ga0316182_1439692 3300030745 Bacteria 2375
437 Ga0265330_10000054 3300031235 Bacteria 101420
438 Ga0265332_10000002 3300031238 Bacteria 709510
439 Ga0265332_10001660 3300031238 Bacteria 12164
440 Ga0265332_10014881 3300031238 Bacteria 3439
441 Ga0265325_10008722 3300031241 Bacteria 5963
442 Ga0265327_10090123 3300031251 Bacteria 1497
443 Ga0307513_10000064 3300031456 Bacteria 141845
444 Ga0307513_10000117 3300031456 Bacteria 110951
445 Ga0307513_10011810 3300031456 Bacteria 10824
446 Ga0307513_10038333 3300031456 Bacteria 5321
447 Ga0307408_100003978 3300031548 Bacteria 10069
448 Ga0307408_100105627 3300031548 Bacteria 2153
449 Ga0307408_100325994 3300031548 Bacteria 1295
450 Ga0307508_10000141 3300031616 Bacteria 85739
451 Ga0307514_10000619 3300031649 Bacteria 65719
452 Ga0307514_10001825 3300031649 Bacteria 23710
453 Ga0307514_10022591 3300031649 Bacteria 5110
454 Ga0307514_10090309 3300031649 Bacteria 2235
455 Ga0265314_10000012 3300031711 Bacteria 415184
456 Ga0307516_10018878 3300031730 Bacteria 7157
457 Ga0307516_10022473 3300031730 Bacteria 6476
458 Ga0307516_10269106 3300031730 Bacteria 1391
459 Ga0307405_10091851 3300031731 Bacteria 2012
460 Ga0307406_10024169 3300031901 Bacteria 3626
461 Ga0307412_10090870 3300031911 Bacteria 2135
462 Ga0307412_10122221 3300031911 Bacteria 1876
463 Ga0307409_100415289 3300031995 Bacteria 1289
464 Ga0307416_100135118 3300032002 Bacteria 2229
465 Ga0307411_10033503 3300032005 Bacteria 3186
466 Ga0307411_10177718 3300032005 Bacteria 1612
467 Ga0373948_0007406 3300034817 Bacteria 1845
468 Ga0373934_0001028 3300035086 Bacteria 10066
469 Ga0373923_0000349 3300035111 Bacteria 10443
470 Ga0373936_0066391 3300035113 Bacteria 1481
471 Ga0373945_0038931 3300035116 Bacteria 1712
472 Ga0373953_0011995 3300035117 Bacteria 3057
473 Ga0373954_0001030 3300035118 Bacteria 11058
474 Ga0373956_0002915 3300035119 Bacteria 6921
475 Ga0373957_0000571 3300035120 Bacteria 9332
476 Ga0373943_0006181 3300035170 Bacteria 5374
477 Ga0373943_0020255 3300035170 Bacteria 3065
478 Ga0373955_0007208 3300035172 Bacteria 5099
479 Ga0373955_0021182 3300035172 Bacteria 3278
480 Ga0373955_0046738 3300035172 Bacteria 2341
481 Ga0373924_0001043 3300035410 Bacteria 8806
482 Ga0373931_0003841 3300035691 Bacteria 6792
483 Ga0373935_0008949 3300035692 Bacteria 5993
484 Ga0373927_0012584 3300035695 Bacteria 5631
485 Ga0373927_0052206 3300035695 Bacteria 2645
486 Ga0373933_0010132 3300035724 Bacteria 5160
487 Ga0373947_0060050 3300035725 Bacteria 2307
488 Ga0373947_0209411 3300035725 Bacteria 1278
489 Ga0373937_0001093 3300036401 Bacteria 22840
490 Ga0373937_0016376 3300036401 Bacteria 6582
491 Ga0373937_0029114 3300036401 Bacteria 5001
492 Ga0373925_0007281 3300037068 Bacteria 8088
493 Ga0373925_0033878 3300037068 Bacteria 3763
494 Ga0395900_0105102 3300037418 Bacteria 2901
495 Ga0395900_0336470 3300037418 Bacteria 1486
496 Ga0395900_0440732 3300037418 Bacteria 1260
497 Ga0395905_0000591 3300037471 Bacteria 48762
498 Ga0395905_0010912 3300037471 Bacteria 8795
499 Ga0395905_0030328 3300037471 Bacteria 5097
500 Ga0395905_0048079 3300037471 Bacteria 3998
501 Ga0395905_0051257 3300037471 Bacteria 3865
502 Ga0395905_0081455 3300037471 Bacteria 3033
503 Ga0395901_0015526 3300038443 Bacteria 7756
504 Ga0395901_0319040 3300038443 Bacteria 1608
505 Ga0436361_0474781 3300039447 Bacteria 20263
506 Ga0439436_0003637 3300041404 Bacteria 4698
507 Ga0451793_0289666 3300041452 Bacteria 1518
508 Ga0451845_0922826 3300041501 Bacteria 1282
509 Ga0439431_0000855 3300041997 Bacteria 6588
510 Ga0439433_0001033 3300041999 Bacteria 5640
511 Ga0439445_0001269 3300042004 Bacteria 5473
512 Ga0439432_002176 3300042006 Bacteria 7396
513 Ga0439432_023205 3300042006 Bacteria 2045
514 Ga0439449_0000689 3300042007 Bacteria 12872
515 Ga0439449_0004485 3300042007 Bacteria 5392
516 Ga0439462_0007528 3300042015 Bacteria 2727
517 Ga0450911_000462 3300042115 Bacteria 13085
518 Ga0450919_003632 3300042121 Bacteria 1914
519 Ga0439434_0004638 3300042435 Bacteria 4027
520 Ga0450918_002118 3300042531 Bacteria 3786
521 Ga0450918_004819 3300042531 Bacteria 2441
522 Ga0450893_0003992 3300042532 Bacteria 2341
523 Ga0453683_0124268 3300044673 Bacteria 1625
524 Ga0453683_0191719 3300044673 Bacteria 1297
525 Ga0453684_0287309 3300044712 Bacteria 1874
526 Ga0451576_0005283 3300045051 Bacteria 16244
527 Ga0451576_0006297 3300045051 Bacteria 14600
528 Ga0495580_0035274 3300046472 Bacteria 3597
529 Ga0495580_0123834 3300046472 Bacteria 1794
530 Ga0495639_0013984 3300046475 Bacteria 3472
531 Ga0495639_0051418 3300046475 Bacteria 1873
532 Ga0495631_0003033 3300046518 Bacteria 9286
533 Ga0495632_0012126 3300046519 Bacteria 4985
534 Ga0495632_0016792 3300046519 Bacteria 4059
535 Ga0495654_0002952 3300046530 Bacteria 10649
536 Ga0495665_0042896 3300046531 Bacteria 2406
537 Ga0495640_0077021 3300046533 Bacteria 2224
538 Ga0495587_0041403 3300046536 Bacteria 2749
539 Ga0495609_0069207 3300046538 Bacteria 1552
540 Ga0495621_0013331 3300046539 Bacteria 2580
541 Ga0495621_0046402 3300046539 Bacteria 1541
542 Ga0495633_0005087 3300046558 Bacteria 8171
543 Ga0495625_0000714 3300046660 Bacteria 46916
544 Ga0495625_0002908 3300046660 Bacteria 17897
545 Ga0495625_0034606 3300046660 Bacteria 3727
546 Ga0495635_0012559 3300046663 Bacteria 5935
547 Ga0495659_0025570 3300046664 Bacteria 2022
548 Ga0495588_0067336 3300046674 Bacteria 1859
549 Ga0495623_0015567 3300046679 Bacteria 4919
550 Ga0495647_0006266 3300046681 Bacteria 3932
551 Ga0495613_0012714 3300046689 Bacteria 6259
552 Ga0495670_0039927 3300046691 Bacteria 2341
553 Ga0495675_0032340 3300047444 Bacteria 3338
554 Ga0495593_0028927 3300047673 Bacteria 3042
555 Ga0496100_0041212 3300048903 Bacteria 2942
556 Ga0496101_0045046 3300048904 Bacteria 3158
557 Ga0496102_0030683 3300048905 Bacteria 4812
558 Ga0496102_0071283 3300048905 Bacteria 3190
559 Ga0496102_0289783 3300048905 Bacteria 1543
560 Ga0496103_0145866 3300048906 Bacteria 1515
561 Ga0496104_0005761 3300048907 Bacteria 10844
562 Ga0496104_0015746 3300048907 Bacteria 6859
563 Ga0496104_0162360 3300048907 Bacteria 2143
564 Ga0496105_0004395 3300048908 Bacteria 10614
565 Ga0496105_0150914 3300048908 Bacteria 1910
566 Ga0496106_0015805 3300048909 Bacteria 5582
567 Ga0496108_0070131 3300048911 Bacteria 2958
568 Ga0496109_0004450 3300048912 Bacteria 11702
569 Ga0496109_0243056 3300048912 Bacteria 1694
570 Ga0496110_0185953 3300048913 Bacteria 1886
571 Ga0496110_0339103 3300048913 Bacteria 1369
572 Ga0496112_0003789 3300048915 Bacteria 12634
573 Ga0496113_0032379 3300048916 Bacteria 3800
574 Ga0496114_0000832 3300048917 Bacteria 23157
575 Ga0496114_0031962 3300048917 Bacteria 4330
576 Ga0496115_0023597 3300048918 Bacteria 4775
577 Ga0496117_0037529 3300048920 Bacteria 3608
578 Ga0496118_0051981 3300048921 Bacteria 3130
579 Ga0496121_0006019 3300048924 Bacteria 15305
580 Ga0496122_0000103 3300048925 Bacteria 196819
581 Ga0496122_0008605 3300048925 Bacteria 10958
582 Ga0496123_0000261 3300048926 Bacteria 106547
583 Ga0496123_0078382 3300048926 Bacteria 2024
584 Ga0496125_0002426 3300048928 Bacteria 24246
585 Ga0496125_0023098 3300048928 Bacteria 5752
586 Ga0496126_0010476 3300048929 Bacteria 9711
587 Ga0496126_0058653 3300048929 Bacteria 3469
588 Ga0501034_0129063 3300049571 Bacteria 2512
589 Ga0501043_0000009 3300049579 Bacteria 214823
590 Ga0501046_0000022 3300049580 Bacteria 215451
591 Ga0501047_0000021 3300049581 Bacteria 254841
592 Ga0501048_0001661 3300049582 Bacteria 16948
593 Ga0501198_000038 3300049649 Bacteria 51689
594 Ga0501222_000037 3300049662 Bacteria 51656
595 Ga0501249_003509 3300049679 Bacteria 3148
596 Ga0501265_006256 3300049762 Bacteria 1386
597 Ga0501045_0009763 3300049824 Bacteria 6711
598 nmdc:mga03683_102820_c1 3300050489 Bacteria 1257
599 nmdc:mga03683_14007_c1 3300050489 Bacteria 2959
600 nmdc:mga03n38_131027_c1 3300050490 Bacteria 1243
601 nmdc:mga03n38_69120_c1 3300050490 Bacteria 1630
602 nmdc:mga0yw44_33661_c1 3300050492 Bacteria 2996
603 nmdc:mga0k408_150712_c1 3300050493 Bacteria 1385
604 nmdc:mga0k408_17849_c1 3300050493 Bacteria 3955
605 nmdc:mga07m45_2774_c1 3300050496 Bacteria 8275
606 nmdc:mga07m45_32317_c1 3300050496 Bacteria 2902
607 nmdc:mga08y16_50799_c1 3300050511 Bacteria 4339
608 nmdc:mga0n895_2210_c1 3300050512 Bacteria 15046
609 nmdc:mga0rr50_1341_c1 3300050513 Bacteria 13434
610 nmdc:mga08x19_373_c1 3300050514 Bacteria 31469
611 nmdc:mga0a205_1959_c1 3300050515 Bacteria 17916
612 Ga0500610_0003594 3300053079 Bacteria 5989
613 Ga0495619_0005553 3300053085 Bacteria 8000
614 Ga0500644_0002640 3300053088 Bacteria 4478
615 Ga0500644_0018440 3300053088 Bacteria 2045
616 Ga0500651_0002467 3300053093 Bacteria 9782
617 Ga0500651_0008776 3300053093 Bacteria 5974
618 Ga0500651_0009481 3300053093 Bacteria 5790
619 Ga0500650_0053918 3300053098 Bacteria 1871
620 Ga0500562_013533 3300053108 Bacteria 2085
621 Ga0500571_022722 3300053110 Bacteria 3489
622 Ga0500593_001736 3300053117 Bacteria 7856
623 Ga0500593_008669 3300053117 Bacteria 4190
624 Ga0500607_008741 3300053121 Bacteria 6131
625 Ga0500628_004589 3300053129 Bacteria 2288
626 Ga0500642_0056536 3300053130 Bacteria 1748
627 Ga0500652_001345 3300053131 Bacteria 7699
628 Ga0500655_002280 3300053133 Bacteria 3523
629 Ga0500655_010298 3300053133 Bacteria 1688
630 Ga0500658_0000352 3300053134 Bacteria 20402
631 Ga0500658_0000624 3300053134 Bacteria 14656
632 Ga0500559_0009674 3300053136 Bacteria 4162
633 Ga0500568_0004463 3300053139 Bacteria 7474
634 Ga0500568_0057219 3300053139 Bacteria 1517
635 Ga0500574_002982 3300053141 Bacteria 2900
636 Ga0500616_0037254 3300053153 Bacteria 2633
637 Ga0500619_000479 3300053154 Bacteria 6999
638 Ga0500622_0000262 3300053156 Bacteria 53796
639 Ga0500627_0014790 3300053158 Bacteria 2997
640 Ga0500634_0023911 3300053161 Bacteria 3322
641 Ga0500645_001090 3300053730 Bacteria 14853
642 Ga0500645_005634 3300053730 Bacteria 4576
643 Ga0500661_008912 3300055283 Bacteria 1843

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014969 Ga0157376_10036556 Ga0157376_100365564 299
2 3300025893 Ga0207682_10012063 Ga0207682_100120632 299
3 3300046558 Ga0495633_0005087 Ga0495633_0005087_5165_6085 305
4 3300037471 Ga0395905_0000591 Ga0395905_0000591_22650_23573 307
5 3300038443 Ga0395901_0015526 Ga0395901_0015526_4975_5898 307
6 3300035172 Ga0373955_0021182 Ga0373955_0021182_2102_3076 309
7 3300036401 Ga0373937_0001093 Ga0373937_0001093_5786_6760 309
8 3300048909 Ga0496106_0015805 Ga0496106_0015805_4598_5542 310
9 3300050489 nmdc:mga03683_102820_c1 nmdc:mga03683_102820_c1_282_1214 310
10 iso_pu_bacteria 2786546548 2787508843 310
11 3300025298 Ga0209050_1001442 Ga0209050_100144222 311
12 3300025303 Ga0209051_1031963 Ga0209051_10319632 311
13 3300037471 Ga0395905_0010912 Ga0395905_0010912_5619_6554 311
14 3300053156 Ga0500622_0000262 Ga0500622_0000262_18294_19286 311
15 3300005331 Ga0070670_100245020 Ga0070670_1002450201 313
16 3300005336 Ga0070680_100028407 Ga0070680_1000284074 313
17 3300005338 Ga0068868_100033124 Ga0068868_1000331244 313
18 3300005344 Ga0070661_100015813 Ga0070661_1000158133 313
19 3300005366 Ga0070659_100229996 Ga0070659_1002299961 313
20 3300005435 Ga0070714_100017248 Ga0070714_1000172486 313
21 3300005437 Ga0070710_10044557 Ga0070710_100445572 313
22 3300005440 Ga0070705_100002681 Ga0070705_1000026818 313
23 3300005444 Ga0070694_100053156 Ga0070694_1000531563 313
24 3300005458 Ga0070681_10314483 Ga0070681_103144831 313
25 3300005467 Ga0070706_100135616 Ga0070706_1001356161 313
26 3300005468 Ga0070707_100015406 Ga0070707_1000154067 313
27 3300005471 Ga0070698_100061390 Ga0070698_1000613902 313
28 3300005518 Ga0070699_100016433 Ga0070699_1000164335 313
29 3300005530 Ga0070679_100119770 Ga0070679_1001197703 313
30 3300005535 Ga0070684_100068341 Ga0070684_1000683413 313
31 3300005536 Ga0070697_100011036 Ga0070697_1000110362 313
32 3300005545 Ga0070695_100007268 Ga0070695_1000072685 313
33 3300005578 Ga0068854_100050573 Ga0068854_1000505732 313
34 3300005614 Ga0068856_100177237 Ga0068856_1001772372 313
35 3300005616 Ga0068852_100020805 Ga0068852_1000208052 313
36 3300005834 Ga0068851_10041299 Ga0068851_100412991 313
37 3300006175 Ga0070712_100004881 Ga0070712_1000048813 313
38 3300009098 Ga0105245_10035818 Ga0105245_100358183 313
39 3300009545 Ga0105237_10053862 Ga0105237_100538625 313
40 3300009551 Ga0105238_10059889 Ga0105238_100598894 313
41 3300025906 Ga0207699_10041907 Ga0207699_100419072 313
42 3300025910 Ga0207684_10149641 Ga0207684_101496412 313
43 3300025915 Ga0207693_10042165 Ga0207693_100421652 313
44 3300025919 Ga0207657_10007901 Ga0207657_100079018 313
45 3300025922 Ga0207646_10072450 Ga0207646_100724503 313
46 3300025929 Ga0207664_10000912 Ga0207664_100009127 313
47 3300025932 Ga0207690_10148162 Ga0207690_101481622 313
48 3300025939 Ga0207665_10007620 Ga0207665_100076203 313
49 3300025944 Ga0207661_10179536 Ga0207661_101795361 313
50 3300026023 Ga0207677_10013554 Ga0207677_100135542 313
51 3300026041 Ga0207639_10175397 Ga0207639_101753972 313
52 3300026078 Ga0207702_10263599 Ga0207702_102635992 313
53 3300026116 Ga0207674_10002122 Ga0207674_100021227 313
54 3300026118 Ga0207675_100485590 Ga0207675_1004855902 313
55 3300026142 Ga0207698_10077590 Ga0207698_100775903 313
56 3300037418 Ga0395900_0336470 Ga0395900_0336470_34_975 313
57 3300041452 Ga0451793_0289666 Ga0451793_0289666_437_1429 313
58 3300046519 Ga0495632_0016792 Ga0495632_0016792_580_1572 313
59 3300048906 Ga0496103_0145866 Ga0496103_0145866_22_1011 313
60 3300050493 nmdc:mga0k408_150712_c1 nmdc:mga0k408_150712_c1_234_1226 313
61 3300053093 Ga0500651_0008776 Ga0500651_0008776_4754_5746 313
62 3300053129 Ga0500628_004589 Ga0500628_004589_1035_2027 313
63 3300053130 Ga0500642_0056536 Ga0500642_0056536_615_1607 313
64 3300053131 Ga0500652_001345 Ga0500652_001345_475_1467 313
65 3300053133 Ga0500655_010298 Ga0500655_010298_567_1559 313
66 3300053139 Ga0500568_0057219 Ga0500568_0057219_419_1411 313
67 3300005289 Ga0065704_10220052 Ga0065704_102200521 314
68 3300005330 Ga0070690_100001484 Ga0070690_1000014844 314
69 3300005334 Ga0068869_100000273 Ga0068869_10000027326 314
70 3300005336 Ga0070680_100001733 Ga0070680_10000173312 314
71 3300005337 Ga0070682_100003195 Ga0070682_1000031959 314
72 3300005338 Ga0068868_100003962 Ga0068868_1000039624 314
73 3300005340 Ga0070689_100001839 Ga0070689_10000183911 314
74 3300005340 Ga0070689_100071304 Ga0070689_1000713042 314
75 3300005341 Ga0070691_10033222 Ga0070691_100332222 314
76 3300005343 Ga0070687_100000342 Ga0070687_1000003427 314
77 3300005345 Ga0070692_10000556 Ga0070692_100005566 314
78 3300005354 Ga0070675_100097957 Ga0070675_1000979573 314
79 3300005355 Ga0070671_100239564 Ga0070671_1002395642 314
80 3300005364 Ga0070673_100169020 Ga0070673_1001690201 314
81 3300005440 Ga0070705_100000256 Ga0070705_10000025621 314
82 3300005441 Ga0070700_100000439 Ga0070700_10000043911 314
83 3300005444 Ga0070694_100001510 Ga0070694_1000015109 314
84 3300005458 Ga0070681_10044801 Ga0070681_100448013 314
85 3300005530 Ga0070679_100180418 Ga0070679_1001804182 314
86 3300005544 Ga0070686_100001277 Ga0070686_1000012779 314
87 3300005545 Ga0070695_100000435 Ga0070695_10000043511 314
88 3300005546 Ga0070696_100001923 Ga0070696_1000019238 314
89 3300005547 Ga0070693_100000767 Ga0070693_1000007678 314
90 3300005549 Ga0070704_100000352 Ga0070704_10000035212 314
91 3300005563 Ga0068855_100003461 Ga0068855_10000346111 314
92 3300005578 Ga0068854_100001551 Ga0068854_1000015517 314
93 3300005614 Ga0068856_100003478 Ga0068856_1000034787 314
94 3300005615 Ga0070702_100000058 Ga0070702_10000005826 314
95 3300005617 Ga0068859_100004400 Ga0068859_10000440011 314
96 3300005618 Ga0068864_100081136 Ga0068864_1000811362 314
97 3300005718 Ga0068866_10000319 Ga0068866_100003198 314
98 3300005719 Ga0068861_100001064 Ga0068861_10000106412 314
99 3300005840 Ga0068870_10031696 Ga0068870_100316962 314
100 3300005842 Ga0068858_100004395 Ga0068858_1000043958 314
101 3300005843 Ga0068860_100001660 Ga0068860_10000166022 314
102 3300005844 Ga0068862_100002351 Ga0068862_10000235112 314
103 3300005937 Ga0081455_10052334 Ga0081455_100523342 314
104 3300006237 Ga0097621_100002532 Ga0097621_1000025323 314
105 3300006358 Ga0068871_100001204 Ga0068871_1000012044 314
106 3300006852 Ga0075433_10002739 Ga0075433_100027394 314
107 3300006871 Ga0075434_100002699 Ga0075434_10000269912 314
108 3300006881 Ga0068865_100000581 Ga0068865_1000005815 314
109 3300006914 Ga0075436_100000279 Ga0075436_10000027922 314
110 3300006931 Ga0097620_100004399 Ga0097620_10000439911 314
111 3300007076 Ga0075435_100000137 Ga0075435_10000013723 314
112 3300009098 Ga0105245_10003062 Ga0105245_100030629 314
113 3300009148 Ga0105243_10002968 Ga0105243_1000296811 314
114 3300009176 Ga0105242_10000847 Ga0105242_100008478 314
115 3300009177 Ga0105248_10029005 Ga0105248_100290052 314
116 3300009553 Ga0105249_10007388 Ga0105249_100073882 314
117 3300013297 Ga0157378_10001080 Ga0157378_1000108023 314
118 3300014745 Ga0157377_10067845 Ga0157377_100678452 314
119 3300014969 Ga0157376_10002188 Ga0157376_100021884 314
120 3300025885 Ga0207653_10036318 Ga0207653_100363181 314
121 3300025899 Ga0207642_10000402 Ga0207642_100004026 314
122 3300025901 Ga0207688_10070124 Ga0207688_100701242 314
123 3300025911 Ga0207654_10065441 Ga0207654_100654412 314
124 3300025912 Ga0207707_10178781 Ga0207707_101787812 314
125 3300025917 Ga0207660_10001944 Ga0207660_100019445 314
126 3300025918 Ga0207662_10000751 Ga0207662_1000075111 314
127 3300025921 Ga0207652_10026578 Ga0207652_100265783 314
128 3300025926 Ga0207659_10071906 Ga0207659_100719063 314
129 3300025927 Ga0207687_10002319 Ga0207687_100023195 314
130 3300025931 Ga0207644_10324098 Ga0207644_103240982 314
131 3300025934 Ga0207686_10004552 Ga0207686_100045527 314
132 3300025935 Ga0207709_10001069 Ga0207709_100010696 314
133 3300025936 Ga0207670_10001137 Ga0207670_1000113711 314
134 3300025941 Ga0207711_10153085 Ga0207711_101530853 314
135 3300025942 Ga0207689_10000992 Ga0207689_100009927 314
136 3300025949 Ga0207667_10044873 Ga0207667_100448732 314
137 3300025961 Ga0207712_10008840 Ga0207712_100088408 314
138 3300026023 Ga0207677_10006769 Ga0207677_100067691 314
139 3300026035 Ga0207703_10001430 Ga0207703_1000143020 314
140 3300026075 Ga0207708_10002049 Ga0207708_100020499 314
141 3300026089 Ga0207648_10004380 Ga0207648_100043807 314
142 3300026095 Ga0207676_10066848 Ga0207676_100668482 314
143 3300026118 Ga0207675_100003887 Ga0207675_1000038877 314
144 3300028380 Ga0268265_10007388 Ga0268265_100073886 314
145 3300028381 Ga0268264_10000994 Ga0268264_100009948 314
146 3300034817 Ga0373948_0007406 Ga0373948_0007406_535_1491 314
147 3300035691 Ga0373931_0003841 Ga0373931_0003841_550_1506 314
148 3300044673 Ga0453683_0191719 Ga0453683_0191719_17_973 314
149 3300045051 Ga0451576_0006297 Ga0451576_0006297_11150_12106 314
150 3300050511 nmdc:mga08y16_50799_c1 nmdc:mga08y16_50799_c1_2881_3837 314
151 3300050512 nmdc:mga0n895_2210_c1 nmdc:mga0n895_2210_c1_7718_8674 314
152 3300050513 nmdc:mga0rr50_1341_c1 nmdc:mga0rr50_1341_c1_3612_4568 314
153 3300050514 nmdc:mga08x19_373_c1 nmdc:mga08x19_373_c1_24731_25687 314
154 3300050515 nmdc:mga0a205_1959_c1 nmdc:mga0a205_1959_c1_9944_10900 314
155 3300005335 Ga0070666_10004746 Ga0070666_100047465 315
156 3300005338 Ga0068868_100015847 Ga0068868_1000158472 315
157 3300005340 Ga0070689_100019016 Ga0070689_1000190165 315
158 3300005343 Ga0070687_100144579 Ga0070687_1001445792 315
159 3300005355 Ga0070671_100054588 Ga0070671_1000545883 315
160 3300005365 Ga0070688_100012315 Ga0070688_1000123157 315
161 3300005367 Ga0070667_100014378 Ga0070667_1000143785 315
162 3300005434 Ga0070709_10012962 Ga0070709_100129622 315
163 3300005436 Ga0070713_100000621 Ga0070713_10000062111 315
164 3300005438 Ga0070701_10011786 Ga0070701_100117862 315
165 3300005439 Ga0070711_100000562 Ga0070711_10000056219 315
166 3300005466 Ga0070685_10001706 Ga0070685_1000170611 315
167 3300005548 Ga0070665_100014147 Ga0070665_1000141476 315
168 3300005617 Ga0068859_100001741 Ga0068859_10000174113 315
169 3300005618 Ga0068864_100004626 Ga0068864_10000462611 315
170 3300005841 Ga0068863_100007778 Ga0068863_10000777814 315
171 3300005842 Ga0068858_100025618 Ga0068858_1000256181 315
172 3300006175 Ga0070712_100003612 Ga0070712_1000036129 315
173 3300006871 Ga0075434_100328554 Ga0075434_1003285542 315
174 3300006931 Ga0097620_100001741 Ga0097620_10000174117 315
175 3300007076 Ga0075435_100300352 Ga0075435_1003003522 315
176 3300009098 Ga0105245_10009415 Ga0105245_100094159 315
177 3300009101 Ga0105247_10018997 Ga0105247_100189973 315
178 3300009176 Ga0105242_10029669 Ga0105242_100296692 315
179 3300009177 Ga0105248_10013308 Ga0105248_100133089 315
180 3300009551 Ga0105238_10396176 Ga0105238_103961762 315
181 3300010375 Ga0105239_10190462 Ga0105239_101904621 315
182 3300013296 Ga0157374_10001809 Ga0157374_1000180915 315
183 3300013297 Ga0157378_10009954 Ga0157378_100099548 315
184 3300013306 Ga0163162_10011811 Ga0163162_100118119 315
185 3300013308 Ga0157375_10008616 Ga0157375_100086169 315
186 3300014325 Ga0163163_10001352 Ga0163163_1000135211 315
187 3300014968 Ga0157379_10006078 Ga0157379_100060789 315
188 3300014969 Ga0157376_10006034 Ga0157376_100060349 315
189 3300025900 Ga0207710_10053288 Ga0207710_100532882 315
190 3300025903 Ga0207680_10002576 Ga0207680_1000257611 315
191 3300025905 Ga0207685_10010476 Ga0207685_100104763 315
192 3300025915 Ga0207693_10000652 Ga0207693_1000065222 315
193 3300025916 Ga0207663_10002608 Ga0207663_1000260811 315
194 3300025918 Ga0207662_10015878 Ga0207662_100158782 315
195 3300025927 Ga0207687_10018162 Ga0207687_100181622 315
196 3300025928 Ga0207700_10006059 Ga0207700_100060592 315
197 3300025931 Ga0207644_10001544 Ga0207644_1000154417 315
198 3300025934 Ga0207686_10206482 Ga0207686_102064822 315
199 3300025936 Ga0207670_10008447 Ga0207670_100084475 315
200 3300025939 Ga0207665_10006908 Ga0207665_100069084 315
201 3300025941 Ga0207711_10000087 Ga0207711_1000008784 315
202 3300025942 Ga0207689_10020777 Ga0207689_100207776 315
203 3300025960 Ga0207651_10058537 Ga0207651_100585372 315
204 3300025986 Ga0207658_10030693 Ga0207658_100306934 315
205 3300026023 Ga0207677_10003281 Ga0207677_100032816 315
206 3300026035 Ga0207703_10003435 Ga0207703_100034359 315
207 3300026088 Ga0207641_10008086 Ga0207641_1000808611 315
208 3300026095 Ga0207676_10000294 Ga0207676_1000029428 315
209 3300028379 Ga0268266_10098208 Ga0268266_100982083 315
210 3300028381 Ga0268264_10014173 Ga0268264_100141733 315
211 3300035086 Ga0373934_0001028 Ga0373934_0001028_8966_9955 315
212 3300035111 Ga0373923_0000349 Ga0373923_0000349_3783_4772 315
213 3300035113 Ga0373936_0066391 Ga0373936_0066391_361_1350 315
214 3300035116 Ga0373945_0038931 Ga0373945_0038931_245_1234 315
215 3300035117 Ga0373953_0011995 Ga0373953_0011995_1576_2565 315
216 3300035118 Ga0373954_0001030 Ga0373954_0001030_8958_9947 315
217 3300035119 Ga0373956_0002915 Ga0373956_0002915_5816_6805 315
218 3300035120 Ga0373957_0000571 Ga0373957_0000571_7354_8343 315
219 3300035170 Ga0373943_0006181 Ga0373943_0006181_2329_3318 315
220 3300035172 Ga0373955_0007208 Ga0373955_0007208_1516_2505 315
221 3300035172 Ga0373955_0046738 Ga0373955_0046738_987_1976 315
222 3300035410 Ga0373924_0001043 Ga0373924_0001043_183_1172 315
223 3300035692 Ga0373935_0008949 Ga0373935_0008949_1542_2531 315
224 3300035695 Ga0373927_0012584 Ga0373927_0012584_2999_3988 315
225 3300035695 Ga0373927_0052206 Ga0373927_0052206_1307_2296 315
226 3300035724 Ga0373933_0010132 Ga0373933_0010132_2873_3862 315
227 3300035725 Ga0373947_0060050 Ga0373947_0060050_1058_2047 315
228 3300035725 Ga0373947_0209411 Ga0373947_0209411_139_1128 315
229 3300036401 Ga0373937_0016376 Ga0373937_0016376_3033_4022 315
230 3300036401 Ga0373937_0029114 Ga0373937_0029114_2328_3317 315
231 3300037068 Ga0373925_0007281 Ga0373925_0007281_284_1273 315
232 3300037068 Ga0373925_0033878 Ga0373925_0033878_2210_3199 315
233 3300046472 Ga0495580_0035274 Ga0495580_0035274_2207_3196 315
234 3300046472 Ga0495580_0123834 Ga0495580_0123834_745_1734 315
235 3300046475 Ga0495639_0051418 Ga0495639_0051418_634_1623 315
236 3300046531 Ga0495665_0042896 Ga0495665_0042896_1304_2293 315
237 3300046533 Ga0495640_0077021 Ga0495640_0077021_927_1916 315
238 3300046536 Ga0495587_0041403 Ga0495587_0041403_978_1967 315
239 3300046663 Ga0495635_0012559 Ga0495635_0012559_4721_5710 315
240 3300046664 Ga0495659_0025570 Ga0495659_0025570_256_1245 315
241 3300046674 Ga0495588_0067336 Ga0495588_0067336_699_1688 315
242 3300046679 Ga0495623_0015567 Ga0495623_0015567_3310_4299 315
243 3300046681 Ga0495647_0006266 Ga0495647_0006266_2082_3071 315
244 3300046689 Ga0495613_0012714 Ga0495613_0012714_4010_4999 315
245 3300047444 Ga0495675_0032340 Ga0495675_0032340_2122_3111 315
246 3300048907 Ga0496104_0015746 Ga0496104_0015746_4483_5472 315
247 3300048908 Ga0496105_0004395 Ga0496105_0004395_4833_5822 315
248 3300048912 Ga0496109_0004450 Ga0496109_0004450_2193_3182 315
249 3300048915 Ga0496112_0003789 Ga0496112_0003789_780_1769 315
250 3300048917 Ga0496114_0031962 Ga0496114_0031962_1146_2135 315
251 3300048918 Ga0496115_0023597 Ga0496115_0023597_848_1837 315
252 3300053085 Ga0495619_0005553 Ga0495619_0005553_4094_5083 315
253 3300035170 Ga0373943_0020255 Ga0373943_0020255_1641_2630 316
254 3300003323 rootH1_10321829 rootH1_103218292 318
255 3300037418 Ga0395900_0440732 Ga0395900_0440732_154_1110 318
256 3300038443 Ga0395901_0319040 Ga0395901_0319040_625_1581 318
257 3300053088 Ga0500644_0018440 Ga0500644_0018440_620_1678 319
258 3300028556 Ga0265337_1009732 Ga0265337_10097322 320
259 3300005334 Ga0068869_100198008 Ga0068869_1001980082 321
260 3300005543 Ga0070672_100001881 Ga0070672_1000018817 321
261 3300031238 Ga0265332_10014881 Ga0265332_100148812 323
262 iso_pu_bacteria 2585428062 2587754381 324
263 3300005436 Ga0070713_100000191 Ga0070713_10000019112 325
264 3300006042 Ga0075368_10100244 Ga0075368_101002441 325
265 3300006195 Ga0075366_10011360 Ga0075366_100113604 325
266 3300025928 Ga0207700_10000073 Ga0207700_1000007310 325
267 3300027526 Ga0209968_1000940 Ga0209968_10009403 325
268 3300027695 Ga0209966_1000014 Ga0209966_100001436 325
269 3300031238 Ga0265332_10001660 Ga0265332_1000166011 325
270 3300050493 nmdc:mga0k408_17849_c1 nmdc:mga0k408_17849_c1_959_2011 325
271 3300053133 Ga0500655_002280 Ga0500655_002280_99_1097 325
272 iso_pu_bacteria 2643221660 2644337923 325
273 3300005455 Ga0070663_100001582 Ga0070663_1000015821 326
274 3300005459 Ga0068867_100000173 Ga0068867_10000017325 326
275 3300005616 Ga0068852_100079476 Ga0068852_1000794763 326
276 3300009148 Ga0105243_10068236 Ga0105243_100682362 326
277 3300014745 Ga0157377_10000039 Ga0157377_1000003982 326
278 3300025910 Ga0207684_10189600 Ga0207684_101896002 326
279 3300025935 Ga0207709_10001551 Ga0207709_1000155116 326
280 3300026067 Ga0207678_10000693 Ga0207678_1000069327 326
281 3300026089 Ga0207648_10000836 Ga0207648_1000083625 326
282 3300031730 Ga0307516_10269106 Ga0307516_102691062 326
283 3300037471 Ga0395905_0048079 Ga0395905_0048079_76_1056 326
284 3300049649 Ga0501198_000038 Ga0501198_000038_10625_11605 326
285 3300049662 Ga0501222_000037 Ga0501222_000037_10586_11566 326
286 iso_pu_bacteria 2585428057 2587729949 326
287 iso_pu_bacteria 2585428058 2587734334 326
288 iso_pu_bacteria 2588253510 2588295217 326
289 iso_pu_bacteria 2643221592 2643969829 326
290 iso_pu_bacteria 2643221625 2644141950 326
291 iso_pu_bacteria 2643221648 2644273328 326
292 3300005343 Ga0070687_100006002 Ga0070687_1000060023 327
293 3300005355 Ga0070671_100008644 Ga0070671_1000086443 327
294 3300009177 Ga0105248_10000917 Ga0105248_1000091726 327
295 3300025931 Ga0207644_10069639 Ga0207644_100696392 327
296 3300025941 Ga0207711_10152172 Ga0207711_101521722 327
297 3300037418 Ga0395900_0105102 Ga0395900_0105102_729_1712 327
298 3300037471 Ga0395905_0051257 Ga0395905_0051257_946_1929 327
299 3300048905 Ga0496102_0289783 Ga0496102_0289783_188_1180 327
300 3300048907 Ga0496104_0162360 Ga0496104_0162360_341_1333 327
301 3300048912 Ga0496109_0243056 Ga0496109_0243056_110_1102 327
302 3300048913 Ga0496110_0339103 Ga0496110_0339103_248_1240 327
303 3300048916 Ga0496113_0032379 Ga0496113_0032379_1858_2850 327
304 iso_pu_bacteria 2643221644 2644247564 327
305 iso_pu_bacteria 2894023352 2894025621 327
306 3300003215 JGI25153J46596_10002983 JGI25153J46596_100029837 328
307 3300005262 Ga0065165_1002005 Ga0065165_10020057 328
308 3300005330 Ga0070690_100093910 Ga0070690_1000939101 328
309 3300005563 Ga0068855_100016738 Ga0068855_1000167383 328
310 3300012502 Ga0157347_1007863 Ga0157347_10078631 328
311 3300025273 Ga0209673_1021758 Ga0209673_10217582 328
312 3300025297 Ga0209758_1000096 Ga0209758_100009626 328
313 3300025949 Ga0207667_10014837 Ga0207667_100148375 328
314 3300026142 Ga0207698_10093298 Ga0207698_100932982 328
315 3300028794 Ga0307515_10000221 Ga0307515_1000022130 328
316 3300028794 Ga0307515_10000777 Ga0307515_1000077750 328
317 3300028794 Ga0307515_10309162 Ga0307515_103091622 328
318 3300030522 Ga0307512_10134503 Ga0307512_101345032 328
319 3300031456 Ga0307513_10038333 Ga0307513_100383332 328
320 3300031616 Ga0307508_10000141 Ga0307508_1000014152 328
321 3300031649 Ga0307514_10022591 Ga0307514_100225914 328
322 3300031730 Ga0307516_10018878 Ga0307516_100188784 328
323 3300046519 Ga0495632_0012126 Ga0495632_0012126_1143_2129 328
324 3300046660 Ga0495625_0002908 Ga0495625_0002908_2403_3389 328
325 3300048925 Ga0496122_0008605 Ga0496122_0008605_8998_10005 328
326 3300048926 Ga0496123_0078382 Ga0496123_0078382_813_1820 328
327 3300048928 Ga0496125_0002426 Ga0496125_0002426_9889_10896 328
328 3300048929 Ga0496126_0010476 Ga0496126_0010476_6863_7870 328
329 3300049579 Ga0501043_0000009 Ga0501043_0000009_157805_158791 328
330 3300049580 Ga0501046_0000022 Ga0501046_0000022_157794_158780 328
331 3300049581 Ga0501047_0000021 Ga0501047_0000021_157852_158838 328
332 3300049582 Ga0501048_0001661 Ga0501048_0001661_14895_15881 328
333 3300049824 Ga0501045_0009763 Ga0501045_0009763_5506_6492 328
334 iso_pu_bacteria 2738543013 2739248788 328
335 iso_pu_bacteria 2816332133 2816473282 328
336 iso_pu_bacteria 2954767861 2954772703 328
337 3300002773 JGI25152J39213_1001039 JGI25152J39213_10010397 329
338 3300003215 JGI25153J46596_10001721 JGI25153J46596_100017216 329
339 3300003771 Ga0055526_1004742 Ga0055526_10047424 329
340 3300005331 Ga0070670_100145982 Ga0070670_1001459821 329
341 3300005543 Ga0070672_100030668 Ga0070672_1000306683 329
342 3300025245 Ga0207425_1000168 Ga0207425_10001687 329
343 3300025258 Ga0209129_1000215 Ga0209129_100021548 329
344 3300025295 Ga0209564_1000057 Ga0209564_1000057254 329
345 3300025295 Ga0209564_1000435 Ga0209564_100043517 329
346 3300025297 Ga0209758_1000174 Ga0209758_100017424 329
347 3300025299 Ga0209256_1019399 Ga0209256_10193992 329
348 3300025926 Ga0207659_10233268 Ga0207659_102332682 329
349 3300025960 Ga0207651_10006656 Ga0207651_100066562 329
350 3300031548 Ga0307408_100325994 Ga0307408_1003259941 329
351 3300037471 Ga0395905_0030328 Ga0395905_0030328_3779_4768 329
352 3300041501 Ga0451845_0922826 Ga0451845_0922826_261_1262 329
353 3300046539 Ga0495621_0013331 Ga0495621_0013331_435_1433 329
354 3300046539 Ga0495621_0046402 Ga0495621_0046402_214_1212 329
355 3300049571 Ga0501034_0129063 Ga0501034_0129063_755_1768 329
356 3300049762 Ga0501265_006256 Ga0501265_006256_307_1296 329
357 iso_pu_bacteria 2513020051 2513226623 329
358 iso_pu_bacteria 2643221658 2644329259 329
359 iso_pu_bacteria 2643221672 2644401132 329
360 iso_pu_bacteria 2818991446 2819596902 329
361 iso_pu_bacteria 2831265667 2831265985 329
362 iso_pu_bacteria 2838054893 2838057886 329
363 iso_pu_bacteria 2842677519 2842681065 329
364 iso_pu_bacteria 2885198086 2885203644 329
365 iso_pu_bacteria 2885211737 2885217006 329
366 iso_pu_bacteria 2899924645 2899930356 329
367 iso_pu_bacteria 2904449895 2904455114 329
368 iso_pu_bacteria 2904456579 2904457530 329
369 iso_pu_bacteria 2919462493 2919466886 329
370 iso_pu_bacteria 2928037797 2928039469 329
371 iso_pu_bacteria 2928044640 2928044926 329
372 iso_pu_bacteria 2928051484 2928052727 329
373 iso_pu_bacteria 2928064002 2928064599 329
374 iso_pu_bacteria 2928070936 2928074985 329
375 iso_pu_bacteria 2932422444 2932425947 329
376 iso_pu_bacteria 2945909444 2945911243 329
377 iso_pu_bacteria 2945984333 2945986469 329
378 3300005353 Ga0070669_100240145 Ga0070669_1002401451 330
379 3300017792 Ga0163161_10159225 Ga0163161_101592252 330
380 3300031235 Ga0265330_10000054 Ga0265330_1000005493 330
381 3300031238 Ga0265332_10000002 Ga0265332_10000002287 330
382 3300031241 Ga0265325_10008722 Ga0265325_100087224 330
383 3300031548 Ga0307408_100105627 Ga0307408_1001056272 330
384 3300031649 Ga0307514_10001825 Ga0307514_1000182523 330
385 3300031711 Ga0265314_10000012 Ga0265314_1000001298 330
386 3300031995 Ga0307409_100415289 Ga0307409_1004152892 330
387 3300032005 Ga0307411_10177718 Ga0307411_101777182 330
388 3300042531 Ga0450918_004819 Ga0450918_004819_628_1653 330
389 3300048905 Ga0496102_0071283 Ga0496102_0071283_624_1616 330
390 3300048908 Ga0496105_0150914 Ga0496105_0150914_260_1369 330
391 3300053154 Ga0500619_000479 Ga0500619_000479_50_1042 330
392 iso_pu_bacteria 2599185214 2599624948 330
393 iso_pu_bacteria 2599185226 2599672960 330
394 iso_pu_bacteria 2599185227 2599682590 330
395 iso_pu_bacteria 2599185229 2599694568 330
396 iso_pu_bacteria 2643221628 2644159332 330
397 iso_pu_bacteria 2643221683 2644467880 330
398 iso_pu_bacteria 2842733646 2842735905 330
399 iso_pu_bacteria 2885192300 2885197415 330
400 iso_pu_bacteria 2904541872 2904543718 330
401 iso_pu_bacteria 2929520902 2929527427 330
402 iso_pu_bacteria 2945945610 2945947258 330
403 iso_pu_bacteria 2945972063 2945977723 330
404 3300003775 Ga0055524_1000045 Ga0055524_100004550 331
405 3300003791 Ga0055530_10002914 Ga0055530_1000291410 331
406 3300003792 Ga0055540_1000002 Ga0055540_100000230 331
407 3300005564 Ga0070664_100056188 Ga0070664_1000561885 331
408 3300005844 Ga0068862_100161170 Ga0068862_1001611702 331
409 3300006048 Ga0075363_100001677 Ga0075363_1000016777 331
410 3300006051 Ga0075364_10026130 Ga0075364_100261302 331
411 3300006058 Ga0075432_10008061 Ga0075432_100080615 331
412 3300006177 Ga0075362_10018266 Ga0075362_100182662 331
413 3300025263 Ga0209565_1014611 Ga0209565_10146112 331
414 3300025298 Ga0209050_1001035 Ga0209050_10010357 331
415 3300025299 Ga0209256_1000143 Ga0209256_100014399 331
416 3300025303 Ga0209051_1000024 Ga0209051_100002430 331
417 3300025304 Ga0209257_1000079 Ga0209257_100007930 331
418 3300025920 Ga0207649_10009738 Ga0207649_100097382 331
419 3300025933 Ga0207706_10198497 Ga0207706_101984972 331
420 3300025945 Ga0207679_10003068 Ga0207679_100030682 331
421 3300028380 Ga0268265_10101148 Ga0268265_101011482 331
422 3300030745 Ga0316182_1139966 Ga0316182_11399662 331
423 3300042115 Ga0450911_000462 Ga0450911_000462_11001_12056 331
424 3300042121 Ga0450919_003632 Ga0450919_003632_465_1460 331
425 3300042531 Ga0450918_002118 Ga0450918_002118_1479_2474 331
426 3300048917 Ga0496114_0000832 Ga0496114_0000832_3677_4672 331
427 3300048924 Ga0496121_0006019 Ga0496121_0006019_3903_4958 331
428 3300050489 nmdc:mga03683_14007_c1 nmdc:mga03683_14007_c1_1464_2492 331
429 3300050490 nmdc:mga03n38_131027_c1 nmdc:mga03n38_131027_c1_117_1145 331
430 3300050492 nmdc:mga0yw44_33661_c1 nmdc:mga0yw44_33661_c1_144_1172 331
431 iso_pu_bacteria 2643221570 2643865887 331
432 iso_pu_bacteria 2643221596 2643993169 331
433 iso_pu_bacteria 2643221609 2644061878 331
434 iso_pu_bacteria 2643221611 2644073539 331
435 iso_pu_bacteria 2643221652 2644294240 331
436 iso_pu_bacteria 2738541277 2738717394 331
437 iso_pu_bacteria 2738543012 2739243027 331
438 iso_pu_bacteria 2738543019 2739278080 331
439 iso_pu_bacteria 2928084124 2928088166 331
440 iso_pu_bacteria 2928115317 2928119940 331
441 iso_pu_bacteria 2929160207 2929162730 331
442 iso_pu_bacteria 2990710928 2990712395 331
443 3300002773 JGI25152J39213_1002236 JGI25152J39213_10022368 332
444 3300002773 JGI25152J39213_1008961 JGI25152J39213_10089612 332
445 3300002774 JGI25150J39212_1001144 JGI25150J39212_10011448 332
446 3300002987 JGI25159J45721_1001875 JGI25159J45721_10018752 332
447 3300003187 JGI25151J46595_10004359 JGI25151J46595_100043598 332
448 3300003187 JGI25151J46595_10006381 JGI25151J46595_100063814 332
449 3300003215 JGI25153J46596_10004499 JGI25153J46596_100044998 332
450 3300003215 JGI25153J46596_10019874 JGI25153J46596_100198742 332
451 3300003354 JGI25160J50197_1003145 JGI25160J50197_10031458 332
452 3300003374 JGI25161J50226_1004959 JGI25161J50226_10049592 332
453 3300003578 Ga0006562J51391_1043718 Ga0006562J51391_10437182 332
454 3300003760 Ga0055527_1003500 Ga0055527_10035002 332
455 3300003761 Ga0055535_1000370 Ga0055535_10003709 332
456 3300003762 Ga0055542_1000027 Ga0055542_1000027141 332
457 3300003771 Ga0055526_1005254 Ga0055526_10052548 332
458 3300003771 Ga0055526_1005263 Ga0055526_10052638 332
459 3300003773 Ga0055537_1000193 Ga0055537_100019332 332
460 3300003773 Ga0055537_1001687 Ga0055537_10016878 332
461 3300003775 Ga0055524_1003565 Ga0055524_10035652 332
462 3300003775 Ga0055524_1012871 Ga0055524_10128713 332
463 3300003781 Ga0055536_1002616 Ga0055536_10026169 332
464 3300003784 Ga0055534_1000186 Ga0055534_100018632 332
465 3300003784 Ga0055534_1004985 Ga0055534_10049854 332
466 3300003790 Ga0055528_1000876 Ga0055528_100087614 332
467 3300003790 Ga0055528_1003742 Ga0055528_10037428 332
468 3300003791 Ga0055530_10000754 Ga0055530_100007542 332
469 3300003791 Ga0055530_10020614 Ga0055530_100206142 332
470 3300003792 Ga0055540_1003178 Ga0055540_10031788 332
471 3300003792 Ga0055540_1003965 Ga0055540_10039658 332
472 3300003792 Ga0055540_1004398 Ga0055540_10043987 332
473 3300003794 Ga0055531_10000985 Ga0055531_100009852 332
474 3300003794 Ga0055531_10005970 Ga0055531_100059708 332
475 3300003794 Ga0055531_10026342 Ga0055531_100263422 332
476 3300004625 Ga0055543_1001675 Ga0055543_10016752 332
477 3300005262 Ga0065165_1004119 Ga0065165_10041198 332
478 3300005334 Ga0068869_100171411 Ga0068869_1001714111 332
479 3300006048 Ga0075363_100009044 Ga0075363_1000090445 332
480 3300006177 Ga0075362_10007515 Ga0075362_100075151 332
481 3300006195 Ga0075366_10051707 Ga0075366_100517072 332
482 3300006880 Ga0075429_100000079 Ga0075429_10000007929 332
483 3300006948 Ga0099826_10041721 Ga0099826_100417212 332
484 3300009036 Ga0105244_10002269 Ga0105244_100022698 332
485 3300009148 Ga0105243_10009022 Ga0105243_100090222 332
486 3300013100 Ga0157373_10055307 Ga0157373_100553072 332
487 3300013102 Ga0157371_10051373 Ga0157371_100513732 332
488 3300013104 Ga0157370_10023603 Ga0157370_100236037 332
489 3300013296 Ga0157374_10006440 Ga0157374_100064405 332
490 3300013307 Ga0157372_10028243 Ga0157372_100282433 332
491 3300015262 Ga0182007_10002945 Ga0182007_100029452 332
492 3300017792 Ga0163161_10002684 Ga0163161_100026847 332
493 3300025228 Ga0209672_100222 Ga0209672_10022225 332
494 3300025229 Ga0209147_103012 Ga0209147_1030122 332
495 3300025242 Ga0209258_100048 Ga0209258_100048234 332
496 3300025245 Ga0207425_1000759 Ga0207425_10007597 332
497 3300025245 Ga0207425_1011245 Ga0207425_10112452 332
498 3300025254 Ga0209148_1000040 Ga0209148_1000040234 332
499 3300025258 Ga0209129_1000007 Ga0209129_1000007124 332
500 3300025258 Ga0209129_1005590 Ga0209129_10055903 332
501 3300025263 Ga0209565_1000153 Ga0209565_100015377 332
502 3300025263 Ga0209565_1000178 Ga0209565_10001788 332
503 3300025273 Ga0209673_1000423 Ga0209673_100042356 332
504 3300025273 Ga0209673_1000566 Ga0209673_100056629 332
505 3300025273 Ga0209673_1000801 Ga0209673_10008015 332
506 3300025284 Ga0209130_1000953 Ga0209130_100095325 332
507 3300025284 Ga0209130_1001540 Ga0209130_10015407 332
508 3300025291 Ga0209675_1000150 Ga0209675_100015077 332
509 3300025291 Ga0209675_1000616 Ga0209675_10006169 332
510 3300025291 Ga0209675_1004134 Ga0209675_10041343 332
511 3300025292 Ga0209676_1000004 Ga0209676_1000004874 332
512 3300025292 Ga0209676_1000172 Ga0209676_1000172133 332
513 3300025292 Ga0209676_1015835 Ga0209676_10158352 332
514 3300025294 Ga0209025_1000217 Ga0209025_100021795 332
515 3300025294 Ga0209025_1000278 Ga0209025_100027841 332
516 3300025294 Ga0209025_1030848 Ga0209025_10308482 332
517 3300025295 Ga0209564_1000200 Ga0209564_10002008 332
518 3300025295 Ga0209564_1000318 Ga0209564_10003188 332
519 3300025297 Ga0209758_1000025 Ga0209758_1000025402 332
520 3300025297 Ga0209758_1039909 Ga0209758_10399092 332
521 3300025298 Ga0209050_1000002 Ga0209050_10000021384 332
522 3300025298 Ga0209050_1000861 Ga0209050_100086126 332
523 3300025299 Ga0209256_1000067 Ga0209256_1000067191 332
524 3300025299 Ga0209256_1000366 Ga0209256_100036641 332
525 3300025302 Ga0207426_1000001 Ga0207426_1000001176 332
526 3300025302 Ga0207426_1000028 Ga0207426_100002866 332
527 3300025303 Ga0209051_1000002 Ga0209051_10000021154 332
528 3300025303 Ga0209051_1000049 Ga0209051_1000049244 332
529 3300025303 Ga0209051_1000096 Ga0209051_100009631 332
530 3300025303 Ga0209051_1000913 Ga0209051_100091326 332
531 3300025303 Ga0209051_1019034 Ga0209051_10190344 332
532 3300025304 Ga0209257_1000002 Ga0209257_10000021295 332
533 3300025304 Ga0209257_1000072 Ga0209257_1000072297 332
534 3300025304 Ga0209257_1006089 Ga0209257_10060898 332
535 3300025728 Ga0207655_1001406 Ga0207655_10014068 332
536 3300025932 Ga0207690_10102277 Ga0207690_101022772 332
537 3300025935 Ga0207709_10035493 Ga0207709_100354934 332
538 3300025935 Ga0207709_10044875 Ga0207709_100448752 332
539 3300027666 Ga0209282_1003159 Ga0209282_10031592 332
540 3300030734 Ga0316179_1046105 Ga0316179_10461053 332
541 3300030735 Ga0316178_1087589 Ga0316178_10875892 332
542 3300030742 Ga0316183_1013492 Ga0316183_10134922 332
543 3300030745 Ga0316182_1439692 Ga0316182_14396923 332
544 3300031731 Ga0307405_10091851 Ga0307405_100918512 332
545 3300031911 Ga0307412_10090870 Ga0307412_100908702 332
546 3300031911 Ga0307412_10122221 Ga0307412_101222212 332
547 3300032002 Ga0307416_100135118 Ga0307416_1001351182 332
548 3300032005 Ga0307411_10033503 Ga0307411_100335031 332
549 3300046518 Ga0495631_0003033 Ga0495631_0003033_7373_8401 332
550 3300046538 Ga0495609_0069207 Ga0495609_0069207_297_1343 332
551 3300046691 Ga0495670_0039927 Ga0495670_0039927_816_1847 332
552 3300047673 Ga0495593_0028927 Ga0495593_0028927_812_1840 332
553 3300048920 Ga0496117_0037529 Ga0496117_0037529_2446_3474 332
554 3300048921 Ga0496118_0051981 Ga0496118_0051981_1957_2985 332
555 3300048928 Ga0496125_0023098 Ga0496125_0023098_1323_2354 332
556 3300049679 Ga0501249_003509 Ga0501249_003509_1475_2506 332
557 3300050490 nmdc:mga03n38_69120_c1 nmdc:mga03n38_69120_c1_111_1142 332
558 3300050496 nmdc:mga07m45_2774_c1 nmdc:mga07m45_2774_c1_3171_4217 332
559 3300050496 nmdc:mga07m45_32317_c1 nmdc:mga07m45_32317_c1_454_1485 332
560 3300053079 Ga0500610_0003594 Ga0500610_0003594_978_2009 332
561 3300053093 Ga0500651_0002467 Ga0500651_0002467_5704_6732 332
562 3300053110 Ga0500571_022722 Ga0500571_022722_13_1041 332
563 3300053117 Ga0500593_001736 Ga0500593_001736_5376_6407 332
564 3300053134 Ga0500658_0000624 Ga0500658_0000624_3203_4234 332
565 3300053158 Ga0500627_0014790 Ga0500627_0014790_842_1873 332
566 iso_pu_bacteria 2738541307 2738878998 332
567 3300003187 JGI25151J46595_10036647 JGI25151J46595_100366473 333
568 3300014497 Ga0182008_10018136 Ga0182008_100181363 333
569 3300025294 Ga0209025_1001179 Ga0209025_10011796 333
570 3300028794 Ga0307515_10001032 Ga0307515_1000103229 333
571 3300031649 Ga0307514_10090309 Ga0307514_100903093 333
572 3300041404 Ga0439436_0003637 Ga0439436_0003637_3241_4272 333
573 3300041997 Ga0439431_0000855 Ga0439431_0000855_1827_2858 333
574 3300041999 Ga0439433_0001033 Ga0439433_0001033_3888_4919 333
575 3300042004 Ga0439445_0001269 Ga0439445_0001269_1337_2368 333
576 3300042006 Ga0439432_002176 Ga0439432_002176_1383_2414 333
577 3300042006 Ga0439432_023205 Ga0439432_023205_162_1193 333
578 3300042007 Ga0439449_0000689 Ga0439449_0000689_6954_7985 333
579 3300042007 Ga0439449_0004485 Ga0439449_0004485_1776_2807 333
580 3300042015 Ga0439462_0007528 Ga0439462_0007528_982_2013 333
581 3300042435 Ga0439434_0004638 Ga0439434_0004638_1785_2816 333
582 3300046660 Ga0495625_0000714 Ga0495625_0000714_32685_33734 333
583 3300048925 Ga0496122_0000103 Ga0496122_0000103_89950_90972 333
584 3300048926 Ga0496123_0000261 Ga0496123_0000261_105280_106302 333
585 3300053121 Ga0500607_008741 Ga0500607_008741_4056_5105 333
586 3300053136 Ga0500559_0009674 Ga0500559_0009674_715_1746 333
587 3300003781 Ga0055536_1008776 Ga0055536_10087763 334
588 3300003792 Ga0055540_1002391 Ga0055540_10023914 334
589 3300005367 Ga0070667_100013891 Ga0070667_1000138913 334
590 3300005456 Ga0070678_100210831 Ga0070678_1002108311 334
591 3300005539 Ga0068853_100330213 Ga0068853_1003302132 334
592 3300005543 Ga0070672_100315915 Ga0070672_1003159152 334
593 3300009093 Ga0105240_10646004 Ga0105240_106460041 334
594 3300009148 Ga0105243_10004809 Ga0105243_1000480910 334
595 3300009545 Ga0105237_10103598 Ga0105237_101035983 334
596 3300013100 Ga0157373_10143725 Ga0157373_101437252 334
597 3300013306 Ga0163162_10058649 Ga0163162_100586492 334
598 3300014497 Ga0182008_10004955 Ga0182008_100049556 334
599 3300015262 Ga0182007_10003185 Ga0182007_100031856 334
600 3300025292 Ga0209676_1002134 Ga0209676_10021346 334
601 3300025294 Ga0209025_1028857 Ga0209025_10288572 334
602 3300025298 Ga0209050_1020413 Ga0209050_10204133 334
603 3300025303 Ga0209051_1000532 Ga0209051_10005323 334
604 3300025304 Ga0209257_1016578 Ga0209257_10165783 334
605 3300025914 Ga0207671_10276528 Ga0207671_102765281 334
606 3300025935 Ga0207709_10004986 Ga0207709_100049867 334
607 3300031251 Ga0265327_10090123 Ga0265327_100901232 334
608 3300046475 Ga0495639_0013984 Ga0495639_0013984_1035_2066 334
609 3300046660 Ga0495625_0034606 Ga0495625_0034606_184_1218 334
610 3300048903 Ga0496100_0041212 Ga0496100_0041212_1245_2276 334
611 3300048904 Ga0496101_0045046 Ga0496101_0045046_937_1968 334
612 3300048905 Ga0496102_0030683 Ga0496102_0030683_1397_2428 334
613 3300048907 Ga0496104_0005761 Ga0496104_0005761_9088_10119 334
614 3300048911 Ga0496108_0070131 Ga0496108_0070131_1331_2362 334
615 3300048913 Ga0496110_0185953 Ga0496110_0185953_596_1627 334
616 3300053108 Ga0500562_013533 Ga0500562_013533_545_1573 334
617 3300053134 Ga0500658_0000352 Ga0500658_0000352_2983_4017 334
618 3300053139 Ga0500568_0004463 Ga0500568_0004463_1672_2706 334
619 3300053141 Ga0500574_002982 Ga0500574_002982_213_1247 334
620 3300053153 Ga0500616_0037254 Ga0500616_0037254_621_1655 334
621 3300053161 Ga0500634_0023911 Ga0500634_0023911_2024_3076 334
622 iso_pu_bacteria 2643221717 2644647408 334
623 3300044712 Ga0453684_0287309 Ga0453684_0287309_193_1215 335
624 3300048929 Ga0496126_0058653 Ga0496126_0058653_1622_2692 335
625 iso_pu_bacteria 2511231002 2511244564 335
626 3300006946 Ga0079104_1000581 Ga0079104_100058122 336
627 3300009148 Ga0105243_10010608 Ga0105243_100106085 336
628 3300025935 Ga0207709_10000131 Ga0207709_1000013185 336
629 3300027111 Ga0209281_1000005 Ga0209281_10000051119 336
630 3300037471 Ga0395905_0081455 Ga0395905_0081455_1476_2501 336
631 3300044673 Ga0453683_0124268 Ga0453683_0124268_564_1604 336
632 3300045051 Ga0451576_0005283 Ga0451576_0005283_2378_3418 336
633 iso_pu_bacteria 2721755523 2722883684 336
634 iso_pu_bacteria 2839138175 2839138711 336
635 3300005468 Ga0070707_100024152 Ga0070707_1000241524 337
636 3300006042 Ga0075368_10009373 Ga0075368_100093732 337
637 3300006048 Ga0075363_100007805 Ga0075363_1000078053 337
638 3300006195 Ga0075366_10112363 Ga0075366_101123632 337
639 3300025922 Ga0207646_10067407 Ga0207646_100674073 337
640 3300025942 Ga0207689_10184956 Ga0207689_101849562 337
641 3300028794 Ga0307515_10000391 Ga0307515_1000039157 337
642 3300031456 Ga0307513_10000117 Ga0307513_1000011743 337
643 3300031456 Ga0307513_10011810 Ga0307513_100118102 337
644 3300031649 Ga0307514_10000619 Ga0307514_1000061921 337
645 3300031730 Ga0307516_10022473 Ga0307516_100224732 337
646 3300039447 Ga0436361_0474781 Ga0436361_0474781_17592_18683 337
647 3300042532 Ga0450893_0003992 Ga0450893_0003992_894_1916 337
648 3300046530 Ga0495654_0002952 Ga0495654_0002952_305_1372 337
649 3300053088 Ga0500644_0002640 Ga0500644_0002640_523_1560 337
650 3300003187 JGI25151J46595_10021663 JGI25151J46595_100216633 339
651 3300003354 JGI25160J50197_1000149 JGI25160J50197_100014934 339
652 3300003374 JGI25161J50226_1000149 JGI25161J50226_100014922 339
653 3300003374 JGI25161J50226_1000313 JGI25161J50226_100031330 339
654 3300004625 Ga0055543_1000338 Ga0055543_100033811 339
655 3300025208 Ga0209436_107042 Ga0209436_1070422 339
656 3300025245 Ga0207425_1002246 Ga0207425_10022465 339
657 3300025263 Ga0209565_1000997 Ga0209565_100099713 339
658 3300025284 Ga0209130_1000072 Ga0209130_1000072130 339
659 3300025294 Ga0209025_1013953 Ga0209025_10139534 339
660 3300025294 Ga0209025_1027208 Ga0209025_10272082 339
661 3300025297 Ga0209758_1030740 Ga0209758_10307402 339
662 3300025298 Ga0209050_1016424 Ga0209050_10164242 339
663 3300025298 Ga0209050_1037215 Ga0209050_10372151 339
664 3300025302 Ga0207426_1000320 Ga0207426_100032065 339
665 3300025304 Ga0209257_1021389 Ga0209257_10213893 339
666 3300031548 Ga0307408_100003978 Ga0307408_1000039785 339
667 3300031901 Ga0307406_10024169 Ga0307406_100241692 339
668 3300053093 Ga0500651_0009481 Ga0500651_0009481_331_1353 339
669 3300053098 Ga0500650_0053918 Ga0500650_0053918_489_1508 339
670 3300053117 Ga0500593_008669 Ga0500593_008669_601_1620 339
671 3300055283 Ga0500661_008912 Ga0500661_008912_322_1341 339
672 3300002704 JGI25155J39150_1000022 JGI25155J39150_100002234 340
673 3300002705 JGI25156J39149_1000005 JGI25156J39149_100000526 340
674 3300002738 JGI25154J39366_1000017 JGI25154J39366_100001718 340
675 3300002738 JGI25154J39366_1000144 JGI25154J39366_100014434 340
676 3300002741 JGI25157J39369_1000003 JGI25157J39369_100000334 340
677 3300003771 Ga0055526_1000806 Ga0055526_100080616 340
678 3300003773 Ga0055537_1000115 Ga0055537_100011529 340
679 3300003775 Ga0055524_1000186 Ga0055524_10001868 340
680 3300003781 Ga0055536_1001483 Ga0055536_10014836 340
681 3300003784 Ga0055534_1002964 Ga0055534_10029646 340
682 3300003790 Ga0055528_1001789 Ga0055528_100178911 340
683 3300003791 Ga0055530_10000208 Ga0055530_1000020840 340
684 3300003792 Ga0055540_1000037 Ga0055540_1000037149 340
685 3300003792 Ga0055540_1000208 Ga0055540_100020838 340
686 3300003794 Ga0055531_10000112 Ga0055531_1000011218 340
687 3300006058 Ga0075432_10007744 Ga0075432_100077442 340
688 3300025206 Ga0209435_100002 Ga0209435_100002141 340
689 3300025246 Ga0209646_1000001 Ga0209646_10000012284 340
690 3300025250 Ga0209026_1000001 Ga0209026_1000001941 340
691 3300025256 Ga0209759_1000001 Ga0209759_10000011915 340
692 3300025263 Ga0209565_1000143 Ga0209565_100014359 340
693 3300025273 Ga0209673_1000008 Ga0209673_1000008170 340
694 3300025284 Ga0209130_1000315 Ga0209130_10003155 340
695 3300025291 Ga0209675_1000221 Ga0209675_100022160 340
696 3300025292 Ga0209676_1000023 Ga0209676_1000023263 340
697 3300025294 Ga0209025_1006049 Ga0209025_10060499 340
698 3300025295 Ga0209564_1001509 Ga0209564_100150916 340
699 3300025298 Ga0209050_1000022 Ga0209050_1000022245 340
700 3300025299 Ga0209256_1000001 Ga0209256_10000011731 340
701 3300025302 Ga0207426_1001560 Ga0207426_100156012 340
702 3300025303 Ga0209051_1000013 Ga0209051_1000013245 340
703 3300025304 Ga0209257_1000042 Ga0209257_1000042241 340
704 3300027907 Ga0207428_10317618 Ga0207428_103176181 340
705 3300031456 Ga0307513_10000064 Ga0307513_10000064102 340
706 3300053730 Ga0500645_001090 Ga0500645_001090_13111_14139 340
707 3300053730 Ga0500645_005634 Ga0500645_005634_1198_2226 340

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06968

BATS

Biotin and Thiamin Synthesis associated domain

249

340

0.99

PF04055

Radical_SAM

Radical SAM superfamily

75

237

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1r30-assembly1.cif.gz_A the crystal structure of biotin synthase, an s-adenosylmethionine-dependent radical enzyme 0.9743 26 340
1r30-assembly1.cif.gz_A the crystal structure of biotin synthase, an s-adenosylmethionine-dependent radical enzyme 0.9712 26 340
5fep-assembly1.cif.gz_A hyde from t. maritima in complex with (2r,4r)-metda 0.8766 30 340
7o26-assembly1.cif.gz_A complex-b bound [fefe]-hydrogenase maturase hyde fromt. maritima (5'da + methionine) 0.8731 30 340
7o1p-assembly1.cif.gz_A [fefe]-hydrogenase maturase hyde from t. maritima (c-ter stretch absent) 0.8709 29 332
ID Description Score Start End Superfamily
af_O59778_20_335_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9834 26 335 3.20.20.70
af_O59778_20_335_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9619 26 335 3.20.20.70
af_Q2FVJ7_11_319_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9401 27 336 3.20.20.70
af_Q2FVJ7_11_319_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9372 27 336 3.20.20.70
af_P9WPQ7_39_344_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9334 32 336 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A379WY99-F1-model_v4 Biotin synthetase (EC 2.8.1.6) 0.9975 135 234 GO:0004076
GO:0009102
GO:0046872
GO:0051537
GO:0051539
AF-A0A7W2B6P5-F1-model_v4 Biotin synthase (EC 2.8.1.6) 0.9973 44 335 GO:0004076
GO:0005506
GO:0009102
GO:0051537
GO:0051539
AF-A0A7U8WRY7-F1-model_v4 deleted 0.9969 146 309
AF-A0A6L3X339-F1-model_v4 biotin synthase (EC 2.8.1.6) 0.9968 136 304 GO:0004076
GO:0009102
GO:0046872
GO:0051537
GO:0051539
AF-A0A356IQT1-F1-model_v4 biotin synthase (EC 2.8.1.6) 0.9956 135 274 GO:0004076
GO:0009102
GO:0046872
GO:0051537
GO:0051539

Feature Viewer

pLDDT pTM Quality
89.42 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map