F476549

General Info

Members Datasets Scaffolds Average Seq Length
707 240 1414 150

Family's Representative Sequence

Representative Sequence 3300025899|Ga0207642_10365102|Ga0207642_103651022
Length 182
Sequence MRIAYVVLGAVFGFILSRSGAADYDFIQGMFLFSNLQLYGIMGVAVIVGAPGIWLIKRRGRTLDGQPLSIEMKSRHRGNVAGGVLFGVGWSLAGMCPGPILVNIGEGKVYAIAALAGALVGAGAFGTLYERLQGFFGLPPLKVDGRSFFVSRRISIIRSRSAAERRAYFGARTLPDSTSHSR

Samples

Sample ID Description Type Environment
1 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
5 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
131 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
132 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
136 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
137 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
138 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
139 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
140 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
141 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
142 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
143 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
144 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
145 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
146 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
147 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
150 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
151 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
152 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
153 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
154 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
155 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
156 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
157 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
158 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
159 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
160 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
161 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
162 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
163 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
164 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
165 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
166 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
167 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
168 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
169 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
170 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
171 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
172 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
173 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
174 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
175 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
176 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
177 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
178 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
179 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
180 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
181 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
182 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
183 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
184 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
185 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
186 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
187 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
188 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
189 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
190 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
191 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
192 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
205 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
206 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
207 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
208 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
209 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
210 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
211 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
212 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
213 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
214 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
215 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
216 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
217 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
218 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
219 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
220 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
221 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
222 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
223 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
226 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
227 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
228 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
229 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
230 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
231 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
232 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
233 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
234 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
235 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
236 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
237 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
238 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
239 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
240 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.57
Rhizosphere 99.29
Stem 0
Stem Tuber 0
Unclassified 30.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207642_10365102 3300025899 Unclassified 855
2 SwRhRL3b_contig_408515 2162886006 Bacteria 900
3 SwRhRL2b_contig_2082529 2162886007 Bacteria 1210
4 SwRhRL2b_contig_3196757 2162886007 Bacteria 1263
5 MBSR1b_contig_12615748 2162886012 Unclassified 908
6 JGI24746J21847_1041888 3300001977 Unclassified 638
7 JGI24751J29686_10064371 3300002459 Unclassified 755
8 Ga0065704_10081093 3300005289 Bacteria 3821
9 Ga0065712_10004893 3300005290 Bacteria 4999
10 Ga0065712_10072653 3300005290 Unclassified 4666
11 Ga0065715_10091667 3300005293 Bacteria 5637
12 Ga0065715_10135667 3300005293 Bacteria 1935
13 Ga0065715_10473249 3300005293 Bacteria 804
14 Ga0065707_10003125 3300005295 Bacteria 9578
15 Ga0065707_10003579 3300005295 Bacteria 3674
16 Ga0065707_10155616 3300005295 Unclassified 1612
17 Ga0070676_10174191 3300005328 Bacteria 1394
18 Ga0070676_10176101 3300005328 Unclassified 1387
19 Ga0070676_10366063 3300005328 Unclassified 995
20 Ga0070690_100059735 3300005330 Unclassified 2452
21 Ga0070690_100420029 3300005330 Unclassified 986
22 Ga0070670_100010884 3300005331 Bacteria 7770
23 Ga0070670_100240290 3300005331 Bacteria 1577
24 Ga0070677_10016386 3300005333 Bacteria 2638
25 Ga0070677_10141123 3300005333 Viruses 1111
26 Ga0070677_10459676 3300005333 Bacteria 683
27 Ga0068869_100011615 3300005334 Bacteria 5783
28 Ga0068869_100085452 3300005334 Bacteria 2363
29 Ga0068869_101853006 3300005334 Unclassified 540
30 Ga0068868_100119789 3300005338 Bacteria 2146
31 Ga0068868_100177829 3300005338 Bacteria 1764
32 Ga0068868_100577168 3300005338 Unclassified 994
33 Ga0070689_100007233 3300005340 Bacteria 7742
34 Ga0070689_100035649 3300005340 Unclassified 3802
35 Ga0070689_100136403 3300005340 Unclassified 1970
36 Ga0070687_100021312 3300005343 Unclassified 3044
37 Ga0070687_100170383 3300005343 Bacteria 1295
38 Ga0070661_100084245 3300005344 Bacteria 2349
39 Ga0070661_100470369 3300005344 Bacteria 1002
40 Ga0070692_10016084 3300005345 Unclassified 3553
41 Ga0070668_100337206 3300005347 Unclassified 1273
42 Ga0070668_101125663 3300005347 Unclassified 709
43 Ga0070669_100000596 3300005353 Bacteria 26785
44 Ga0070669_100082779 3300005353 Bacteria 2393
45 Ga0070669_100280664 3300005353 Bacteria 1335
46 Ga0070669_100325618 3300005353 Bacteria 1242
47 Ga0070669_100476414 3300005353 Bacteria 1032
48 Ga0070675_100002521 3300005354 Bacteria 13706
49 Ga0070675_100016388 3300005354 Bacteria 5882
50 Ga0070675_100024965 3300005354 Unclassified 4790
51 Ga0070675_100057998 3300005354 Unclassified 3193
52 Ga0070675_100604302 3300005354 Bacteria 995
53 Ga0070675_100907519 3300005354 Unclassified 807
54 Ga0070675_101165757 3300005354 Bacteria 709
55 Ga0070671_100993817 3300005355 Bacteria 735
56 Ga0070674_100000544 3300005356 Bacteria 18881
57 Ga0070674_100116236 3300005356 Bacteria 1973
58 Ga0070674_100193855 3300005356 Unclassified 1564
59 Ga0070674_100633557 3300005356 Bacteria 907
60 Ga0070673_100004314 3300005364 Bacteria 8983
61 Ga0070673_100034065 3300005364 Bacteria 3850
62 Ga0070673_100040867 3300005364 Bacteria 3561
63 Ga0070673_100066858 3300005364 Unclassified 2873
64 Ga0070673_100117358 3300005364 Unclassified 2215
65 Ga0070673_100523009 3300005364 Bacteria 1075
66 Ga0070673_100577310 3300005364 Unclassified 1023
67 Ga0070673_100718152 3300005364 Unclassified 919
68 Ga0070688_100019634 3300005365 Unclassified 3917
69 Ga0070688_100268775 3300005365 Bacteria 1221
70 Ga0070667_100214169 3300005367 Unclassified 1713
71 Ga0070667_100278516 3300005367 Bacteria 1501
72 Ga0070667_100486403 3300005367 Bacteria 1130
73 Ga0070703_10149230 3300005406 Unclassified 876
74 Ga0070703_10311741 3300005406 Bacteria 659
75 Ga0070713_100102299 3300005436 Bacteria 2484
76 Ga0070701_10026355 3300005438 Unclassified 2834
77 Ga0070701_10115099 3300005438 Unclassified 1508
78 Ga0070701_10288262 3300005438 Unclassified 1005
79 Ga0070705_100114031 3300005440 Bacteria 1733
80 Ga0070705_100536853 3300005440 Bacteria 894
81 Ga0070700_100023622 3300005441 Unclassified 3598
82 Ga0070700_100026836 3300005441 Bacteria 3407
83 Ga0070700_100140757 3300005441 Bacteria 1639
84 Ga0070700_100484525 3300005441 Bacteria 948
85 Ga0070694_100186666 3300005444 Unclassified 1537
86 Ga0070694_100192225 3300005444 Unclassified 1516
87 Ga0070694_100340747 3300005444 Bacteria 1159
88 Ga0070708_100250179 3300005445 Unclassified 1665
89 Ga0070678_100037102 3300005456 Unclassified 3419
90 Ga0070678_100601632 3300005456 Bacteria 982
91 Ga0070662_100812357 3300005457 Bacteria 795
92 Ga0070681_11442955 3300005458 Bacteria 612
93 Ga0068867_100033549 3300005459 Unclassified 3718
94 Ga0068867_100113416 3300005459 Bacteria 2085
95 Ga0068867_100578377 3300005459 Unclassified 976
96 Ga0068867_100713926 3300005459 Bacteria 886
97 Ga0070685_10044953 3300005466 Unclassified 2530
98 Ga0070685_10249674 3300005466 Bacteria 1175
99 Ga0070707_100437741 3300005468 Bacteria 1268
100 Ga0070698_100001676 3300005471 Bacteria 24723
101 Ga0070698_100135089 3300005471 Unclassified 2421
102 Ga0070699_100000326 3300005518 Bacteria 46050
103 Ga0070699_100022707 3300005518 Bacteria 5408
104 Ga0070699_100139448 3300005518 Bacteria 2140
105 Ga0070697_100724954 3300005536 Bacteria 878
106 Ga0070672_100036882 3300005543 Unclassified 3728
107 Ga0070672_100057156 3300005543 Bacteria 3062
108 Ga0070672_100073061 3300005543 Unclassified 2733
109 Ga0070672_100178507 3300005543 Bacteria 1769
110 Ga0070672_100308187 3300005543 Bacteria 1343
111 Ga0070686_100024347 3300005544 Bacteria 3628
112 Ga0070686_100822457 3300005544 Bacteria 750
113 Ga0070686_100828178 3300005544 Unclassified 748
114 Ga0070695_100350248 3300005545 Bacteria 1106
115 Ga0070696_100000832 3300005546 Bacteria 19889
116 Ga0070696_100034575 3300005546 Bacteria 3477
117 Ga0070696_100085031 3300005546 Unclassified 2245
118 Ga0070696_100717516 3300005546 Unclassified 816
119 Ga0070693_100205385 3300005547 Bacteria 1282
120 Ga0070693_100796812 3300005547 Unclassified 700
121 Ga0070704_100016355 3300005549 Unclassified 4685
122 Ga0070704_100031158 3300005549 Bacteria 3583
123 Ga0070704_100679279 3300005549 Bacteria 911
124 Ga0070704_100825509 3300005549 Bacteria 830
125 Ga0070704_101070053 3300005549 Bacteria 732
126 Ga0070704_101475032 3300005549 Bacteria 625
127 Ga0070664_100069517 3300005564 Bacteria 3013
128 Ga0070664_100292027 3300005564 Unclassified 1472
129 Ga0070664_100808996 3300005564 Bacteria 876
130 Ga0068857_100273675 3300005577 Unclassified 1552
131 Ga0068857_100438608 3300005577 Unclassified 1220
132 Ga0068854_100049903 3300005578 Unclassified 2991
133 Ga0068859_100001112 3300005617 Bacteria 27444
134 Ga0068859_100024181 3300005617 Bacteria 6095
135 Ga0068859_100069848 3300005617 Bacteria 3548
136 Ga0068859_100072615 3300005617 Unclassified 3478
137 Ga0068859_100091271 3300005617 Unclassified 3097
138 Ga0068859_100132075 3300005617 Bacteria 2569
139 Ga0068859_100380383 3300005617 Bacteria 1507
140 Ga0068859_100877205 3300005617 Bacteria 983
141 Ga0068864_100015556 3300005618 Bacteria 6328
142 Ga0068864_100073738 3300005618 Unclassified 2976
143 Ga0068864_100192769 3300005618 Bacteria 1869
144 Ga0068864_100756325 3300005618 Unclassified 953
145 Ga0068866_10346106 3300005718 Bacteria 943
146 Ga0068866_10939488 3300005718 Unclassified 611
147 Ga0068861_100011836 3300005719 Bacteria 6072
148 Ga0068861_100079425 3300005719 Unclassified 2564
149 Ga0068861_101027910 3300005719 Unclassified 788
150 Ga0068870_10004437 3300005840 Bacteria 6043
151 Ga0068870_10106278 3300005840 Bacteria 1595
152 Ga0068870_10106743 3300005840 Bacteria 1592
153 Ga0068870_10121428 3300005840 Unclassified 1505
154 Ga0068870_10192705 3300005840 Bacteria 1231
155 Ga0068863_100011384 3300005841 Bacteria 8609
156 Ga0068863_100823848 3300005841 Bacteria 926
157 Ga0068858_100132036 3300005842 Unclassified 2342
158 Ga0068858_100297542 3300005842 Unclassified 1539
159 Ga0068860_100009826 3300005843 Bacteria 9492
160 Ga0068860_100040090 3300005843 Bacteria 4478
161 Ga0068860_100040241 3300005843 Bacteria 4468
162 Ga0068860_100499905 3300005843 Unclassified 1214
163 Ga0068862_100021671 3300005844 Bacteria 5373
164 Ga0068862_100114272 3300005844 Bacteria 2373
165 Ga0068862_100126927 3300005844 Unclassified 2253
166 Ga0068862_100234874 3300005844 Bacteria 1665
167 Ga0068862_101028271 3300005844 Unclassified 816
168 Ga0097621_100007251 3300006237 Bacteria 7916
169 Ga0097621_100150718 3300006237 Bacteria 1994
170 Ga0097621_101007361 3300006237 Bacteria 779
171 Ga0097621_101034967 3300006237 Unclassified 769
172 Ga0097621_101123210 3300006237 Unclassified 738
173 Ga0097621_101642700 3300006237 Unclassified 611
174 Ga0068871_100001274 3300006358 Bacteria 16844
175 Ga0068871_100159892 3300006358 Bacteria 1926
176 Ga0068871_100302467 3300006358 Bacteria 1404
177 Ga0068871_100485596 3300006358 Unclassified 1112
178 Ga0068871_101834154 3300006358 Bacteria 576
179 Ga0075428_100005316 3300006844 Bacteria 14310
180 Ga0075428_100186311 3300006844 Bacteria 2246
181 Ga0075430_100000072 3300006846 Bacteria 55365
182 Ga0075430_100024533 3300006846 Bacteria 5129
183 Ga0075430_100025128 3300006846 Bacteria 5066
184 Ga0075430_100079215 3300006846 Bacteria 2754
185 Ga0075430_100107290 3300006846 Unclassified 2329
186 Ga0075430_100135219 3300006846 Bacteria 2054
187 Ga0075430_100168974 3300006846 Bacteria 1819
188 Ga0075431_100004360 3300006847 Bacteria 13883
189 Ga0075431_100005750 3300006847 Bacteria 12257
190 Ga0075431_100166145 3300006847 Bacteria 2268
191 Ga0075431_100251629 3300006847 Bacteria 1795
192 Ga0075431_100537440 3300006847 Bacteria 1157
193 Ga0075431_100721589 3300006847 Bacteria 973
194 Ga0075431_101181069 3300006847 Bacteria 728
195 Ga0075431_101409116 3300006847 Unclassified 656
196 Ga0075433_10006742 3300006852 Bacteria 9099
197 Ga0075433_10011488 3300006852 Bacteria 7130
198 Ga0075434_100007785 3300006871 Bacteria 9919
199 Ga0075434_100009838 3300006871 Bacteria 8941
200 Ga0075434_100064969 3300006871 Bacteria 3634
201 Ga0075434_100103145 3300006871 Bacteria 2860
202 Ga0075434_100109549 3300006871 Unclassified 2772
203 Ga0075434_100194677 3300006871 Bacteria 2047
204 Ga0075434_100303357 3300006871 Bacteria 1617
205 Ga0075434_101198169 3300006871 Bacteria 771
206 Ga0075429_100039611 3300006880 Bacteria 4101
207 Ga0075429_100057750 3300006880 Bacteria 3379
208 Ga0075429_100069266 3300006880 Bacteria 3072
209 Ga0075429_100110847 3300006880 Unclassified 2399
210 Ga0075429_100115678 3300006880 Unclassified 2344
211 Ga0075429_100595467 3300006880 Bacteria 969
212 Ga0075429_100770973 3300006880 Bacteria 842
213 Ga0068865_100363286 3300006881 Bacteria 1176
214 Ga0068865_100600200 3300006881 Unclassified 930
215 Ga0068865_100724676 3300006881 Unclassified 852
216 Ga0097620_100001112 3300006931 Bacteria 27444
217 Ga0097620_100024182 3300006931 Bacteria 6095
218 Ga0097620_100069847 3300006931 Bacteria 3548
219 Ga0097620_100072615 3300006931 Unclassified 3478
220 Ga0097620_100091275 3300006931 Unclassified 3097
221 Ga0097620_100132070 3300006931 Bacteria 2569
222 Ga0097620_100380366 3300006931 Bacteria 1507
223 Ga0097620_100877195 3300006931 Bacteria 983
224 Ga0075435_100006920 3300007076 Bacteria 8045
225 Ga0075435_100215457 3300007076 Bacteria 1630
226 Ga0075435_100329924 3300007076 Bacteria 1307
227 Ga0075435_100926879 3300007076 Bacteria 760
228 Ga0111539_10001705 3300009094 Bacteria 29265
229 Ga0111539_10025746 3300009094 Bacteria 7205
230 Ga0111539_10052776 3300009094 Bacteria 4840
231 Ga0111539_10054902 3300009094 Unclassified 4737
232 Ga0111539_10058466 3300009094 Bacteria 4574
233 Ga0111539_10297474 3300009094 Bacteria 1878
234 Ga0111539_10433375 3300009094 Unclassified 1531
235 Ga0111539_10483460 3300009094 Bacteria 1442
236 Ga0111539_10992089 3300009094 Bacteria 976
237 Ga0111539_11699420 3300009094 Bacteria 732
238 Ga0105245_10948674 3300009098 Unclassified 903
239 Ga0105245_11352692 3300009098 Bacteria 762
240 Ga0105245_11636094 3300009098 Unclassified 696
241 Ga0105245_11859308 3300009098 Bacteria 655
242 Ga0114129_10006373 3300009147 Bacteria 16732
243 Ga0114129_10016577 3300009147 Bacteria 10494
244 Ga0114129_10051626 3300009147 Bacteria 5772
245 Ga0114129_10064402 3300009147 Bacteria 5115
246 Ga0114129_10094193 3300009147 Unclassified 4148
247 Ga0114129_10595203 3300009147 Bacteria 1433
248 Ga0114129_11513814 3300009147 Unclassified 824
249 Ga0114129_11848010 3300009147 Bacteria 734
250 Ga0105243_10047266 3300009148 Bacteria 3387
251 Ga0105248_10122928 3300009177 Unclassified 2928
252 Ga0105248_10970856 3300009177 Bacteria 960
253 Ga0105248_11024835 3300009177 Bacteria 932
254 Ga0105248_12232026 3300009177 Unclassified 623
255 Ga0105249_10009258 3300009553 Bacteria 8611
256 Ga0105249_10010566 3300009553 Bacteria 8113
257 Ga0105246_10426016 3300011119 Bacteria 1109
258 Ga0105246_11001928 3300011119 Unclassified 756
259 Ga0157378_10219987 3300013297 Unclassified 1805
260 Ga0157378_10378229 3300013297 Unclassified 1390
261 Ga0163162_10057804 3300013306 Unclassified 3906
262 Ga0163162_10070722 3300013306 Unclassified 3541
263 Ga0163162_10912103 3300013306 Bacteria 991
264 Ga0163162_11185957 3300013306 Bacteria 866
265 Ga0157375_10015796 3300013308 Bacteria 6765
266 Ga0157375_10090673 3300013308 Bacteria 3116
267 Ga0157375_10406564 3300013308 Bacteria 1528
268 Ga0157375_11104689 3300013308 Unclassified 928
269 Ga0163163_10021922 3300014325 Bacteria 6037
270 Ga0163163_10099074 3300014325 Bacteria 2936
271 Ga0157380_10000828 3300014326 Bacteria 19320
272 Ga0157380_10000884 3300014326 Bacteria 18839
273 Ga0157380_10032139 3300014326 Bacteria 4035
274 Ga0157380_10052607 3300014326 Unclassified 3225
275 Ga0157380_10061603 3300014326 Bacteria 3003
276 Ga0157380_10208427 3300014326 Bacteria 1740
277 Ga0157380_10236826 3300014326 Bacteria 1643
278 Ga0157380_10835023 3300014326 Bacteria 942
279 Ga0157380_11070670 3300014326 Bacteria 844
280 Ga0157380_11154871 3300014326 Bacteria 816
281 Ga0157380_11625739 3300014326 Bacteria 702
282 Ga0157377_10007046 3300014745 Bacteria 5399
283 Ga0157377_10032568 3300014745 Unclassified 2839
284 Ga0157377_10055819 3300014745 Bacteria 2241
285 Ga0157377_10061758 3300014745 Bacteria 2142
286 Ga0157377_10092209 3300014745 Unclassified 1791
287 Ga0157377_10118408 3300014745 Unclassified 1602
288 Ga0157376_10028660 3300014969 Bacteria 4428
289 Ga0157376_10221859 3300014969 Bacteria 1751
290 Ga0157376_10638285 3300014969 Bacteria 1064
291 Ga0157376_10816553 3300014969 Unclassified 946
292 Ga0157376_11059797 3300014969 Unclassified 835
293 Ga0163161_10028559 3300017792 Bacteria 3963
294 Ga0207697_10092769 3300025315 Bacteria 1280
295 Ga0207682_10002357 3300025893 Bacteria 8518
296 Ga0207682_10041305 3300025893 Unclassified 1882
297 Ga0207682_10082941 3300025893 Bacteria 1377
298 Ga0207682_10119259 3300025893 Viruses 1169
299 Ga0207642_10338448 3300025899 Unclassified 884
300 Ga0207688_10009353 3300025901 Bacteria 5342
301 Ga0207688_10197182 3300025901 Unclassified 1206
302 Ga0207680_10287317 3300025903 Unclassified 1144
303 Ga0207647_10354766 3300025904 Unclassified 830
304 Ga0207645_10036272 3300025907 Unclassified 3166
305 Ga0207645_10041419 3300025907 Unclassified 2948
306 Ga0207643_10017964 3300025908 Bacteria 3873
307 Ga0207643_10034784 3300025908 Unclassified 2824
308 Ga0207643_10111596 3300025908 Bacteria 1611
309 Ga0207643_10113426 3300025908 Bacteria 1599
310 Ga0207643_10158268 3300025908 Bacteria 1361
311 Ga0207643_10402351 3300025908 Unclassified 866
312 Ga0207707_11207172 3300025912 Bacteria 612
313 Ga0207662_10039797 3300025918 Unclassified 2759
314 Ga0207662_10128751 3300025918 Unclassified 1594
315 Ga0207681_10040437 3300025923 Bacteria 3103
316 Ga0207681_10081408 3300025923 Bacteria 2286
317 Ga0207681_10111911 3300025923 Bacteria 1987
318 Ga0207681_10142870 3300025923 Unclassified 1784
319 Ga0207650_10057030 3300025925 Unclassified 2904
320 Ga0207650_10140941 3300025925 Unclassified 1895
321 Ga0207650_10200503 3300025925 Bacteria 1598
322 Ga0207650_10241606 3300025925 Bacteria 1460
323 Ga0207650_11650699 3300025925 Unclassified 544
324 Ga0207659_10000237 3300025926 Bacteria 33603
325 Ga0207659_10027344 3300025926 Unclassified 3862
326 Ga0207659_10045665 3300025926 Bacteria 3090
327 Ga0207659_10070990 3300025926 Bacteria 2541
328 Ga0207659_10090083 3300025926 Bacteria 2289
329 Ga0207659_10114807 3300025926 Unclassified 2053
330 Ga0207659_10152933 3300025926 Bacteria 1803
331 Ga0207659_10572426 3300025926 Bacteria 961
332 Ga0207687_10264092 3300025927 Bacteria 1373
333 Ga0207644_10018056 3300025931 Bacteria 4769
334 Ga0207690_10440091 3300025932 Unclassified 1046
335 Ga0207706_10029283 3300025933 Unclassified 4916
336 Ga0207706_10091139 3300025933 Bacteria 2680
337 Ga0207670_10037408 3300025936 Unclassified 3162
338 Ga0207670_10606282 3300025936 Unclassified 899
339 Ga0207669_10001028 3300025937 Bacteria 11919
340 Ga0207704_10130811 3300025938 Unclassified 1737
341 Ga0207704_10264122 3300025938 Unclassified 1299
342 Ga0207704_10359979 3300025938 Bacteria 1136
343 Ga0207704_10579707 3300025938 Bacteria 915
344 Ga0207704_11151126 3300025938 Unclassified 660
345 Ga0207691_10034384 3300025940 Bacteria 4713
346 Ga0207691_10038097 3300025940 Unclassified 4448
347 Ga0207691_10047584 3300025940 Bacteria 3935
348 Ga0207691_10135150 3300025940 Bacteria 2176
349 Ga0207691_10158020 3300025940 Bacteria 1990
350 Ga0207691_10185771 3300025940 Bacteria 1814
351 Ga0207691_10278089 3300025940 Bacteria 1441
352 Ga0207711_10025384 3300025941 Unclassified 4972
353 Ga0207711_10930152 3300025941 Bacteria 808
354 Ga0207689_10017818 3300025942 Bacteria 6000
355 Ga0207689_10102866 3300025942 Bacteria 2347
356 Ga0207689_10667290 3300025942 Bacteria 876
357 Ga0207679_10009451 3300025945 Bacteria 6247
358 Ga0207679_10261177 3300025945 Unclassified 1477
359 Ga0207679_10763587 3300025945 Bacteria 880
360 Ga0207679_10863262 3300025945 Unclassified 827
361 Ga0207651_10003521 3300025960 Bacteria 7696
362 Ga0207651_10024769 3300025960 Bacteria 3718
363 Ga0207651_10073737 3300025960 Unclassified 2428
364 Ga0207651_10144489 3300025960 Bacteria 1842
365 Ga0207651_10191134 3300025960 Unclassified 1633
366 Ga0207651_10246458 3300025960 Bacteria 1459
367 Ga0207651_10576304 3300025960 Unclassified 981
368 Ga0207651_10968767 3300025960 Unclassified 759
369 Ga0207712_10032467 3300025961 Unclassified 3525
370 Ga0207712_10070308 3300025961 Bacteria 2514
371 Ga0207668_10337346 3300025972 Unclassified 1256
372 Ga0207668_10400285 3300025972 Unclassified 1161
373 Ga0207640_10318741 3300025981 Unclassified 1237
374 Ga0207658_10165531 3300025986 Unclassified 1816
375 Ga0207658_10349074 3300025986 Unclassified 1288
376 Ga0207658_10836615 3300025986 Bacteria 837
377 Ga0207677_10054252 3300026023 Bacteria 2734
378 Ga0207677_10097396 3300026023 Bacteria 2155
379 Ga0207677_10498307 3300026023 Bacteria 1052
380 Ga0207703_10193168 3300026035 Bacteria 1804
381 Ga0207703_10258726 3300026035 Unclassified 1572
382 Ga0207678_10778064 3300026067 Unclassified 844
383 Ga0207678_10946518 3300026067 Bacteria 762
384 Ga0207708_10033155 3300026075 Unclassified 3922
385 Ga0207708_10066710 3300026075 Unclassified 2751
386 Ga0207708_10174180 3300026075 Bacteria 1705
387 Ga0207708_10329297 3300026075 Bacteria 1248
388 Ga0207708_10612981 3300026075 Unclassified 923
389 Ga0207708_10649137 3300026075 Bacteria 898
390 Ga0207641_10321598 3300026088 Unclassified 1467
391 Ga0207641_10656581 3300026088 Unclassified 1030
392 Ga0207648_10000784 3300026089 Bacteria 35793
393 Ga0207648_10115734 3300026089 Bacteria 2356
394 Ga0207648_10144082 3300026089 Bacteria 2101
395 Ga0207648_10240878 3300026089 Bacteria 1610
396 Ga0207676_10257660 3300026095 Unclassified 1573
397 Ga0207676_10390745 3300026095 Bacteria 1297
398 Ga0207674_10019967 3300026116 Bacteria 7251
399 Ga0207674_10033926 3300026116 Bacteria 5339
400 Ga0207674_10045406 3300026116 Bacteria 4519
401 Ga0207674_10212825 3300026116 Bacteria 1882
402 Ga0207675_100000123 3300026118 Bacteria 63809
403 Ga0207675_100493536 3300026118 Bacteria 1218
404 Ga0207675_100524135 3300026118 Unclassified 1181
405 Ga0207675_101106324 3300026118 Unclassified 812
406 Ga0207675_101263491 3300026118 Unclassified 759
407 Ga0207683_10009303 3300026121 Bacteria 8372
408 Ga0207683_10109845 3300026121 Bacteria 2468
409 Ga0207683_10230059 3300026121 Bacteria 1690
410 Ga0207683_10231549 3300026121 Bacteria 1685
411 Ga0207683_10354439 3300026121 Bacteria 1347
412 Ga0207428_10000344 3300027907 Bacteria 60501
413 Ga0207428_10003636 3300027907 Bacteria 14864
414 Ga0207428_10014490 3300027907 Bacteria 6844
415 Ga0207428_10016452 3300027907 Bacteria 6362
416 Ga0268265_10007820 3300028380 Bacteria 7214
417 Ga0268265_10024408 3300028380 Bacteria 4277
418 Ga0268265_10079632 3300028380 Bacteria 2581
419 Ga0268265_10537136 3300028380 Unclassified 1108
420 Ga0268265_10549190 3300028380 Bacteria 1096
421 Ga0268265_10775751 3300028380 Bacteria 932
422 Ga0268264_10008871 3300028381 Bacteria 8335
423 Ga0268264_10046389 3300028381 Bacteria 3609
424 Ga0268264_10070572 3300028381 Bacteria 2957
425 Ga0268264_11076093 3300028381 Unclassified 812
426 Ga0307408_100748737 3300031548 Unclassified 882
427 Ga0307405_10306579 3300031731 Unclassified 1207
428 Ga0307409_101136067 3300031995 Bacteria 803
429 Ga0307416_101516721 3300032002 Bacteria 776
430 Ga0307411_10578992 3300032005 Unclassified 962
431 Ga0307415_101737155 3300032126 Unclassified 602
432 Ga0373934_0040729 3300035086 Bacteria 1833
433 Ga0373934_0086334 3300035086 Bacteria 1263
434 Ga0373956_0391129 3300035119 Unclassified 663
435 Ga0373960_0043798 3300035121 Bacteria 1305
436 Ga0373943_0549534 3300035170 Unclassified 678
437 Ga0373943_0610557 3300035170 Unclassified 643
438 Ga0373946_0194789 3300035171 Unclassified 968
439 Ga0373955_0171468 3300035172 Bacteria 1284
440 Ga0373924_0158113 3300035410 Unclassified 993
441 Ga0373931_0068580 3300035691 Bacteria 1931
442 Ga0373935_0148120 3300035692 Bacteria 1591
443 Ga0373927_0203971 3300035695 Unclassified 1298
444 Ga0373927_0442826 3300035695 Bacteria 858
445 Ga0373947_0166956 3300035725 Unclassified 1426
446 Ga0373937_0046399 3300036401 Bacteria 3973
447 Ga0373937_0568938 3300036401 Bacteria 1076
448 Ga0373937_0708775 3300036401 Bacteria 953
449 Ga0373925_0603812 3300037068 Bacteria 904
450 Ga0395900_1556639 3300037418 Unclassified 573
451 Ga0439447_052201 3300041407 Bacteria 974
452 Ga0451853_2463058 3300041512 Bacteria 1538
453 Ga0439450_077545 3300042008 Bacteria 823
454 Ga0439446_0103276 3300042156 Bacteria 904
455 Ga0439444_0110955 3300042437 Unclassified 631
456 Ga0439464_0038112 3300042439 Unclassified 1365
457 Ga0450916_034872 3300042530 Unclassified 746
458 Ga0451577_1798810 3300042876 Bacteria 538
459 Ga0453683_0312171 3300044673 Bacteria 1007
460 Ga0453684_0437688 3300044712 Bacteria 1458
461 Ga0451576_0332627 3300045051 Unclassified 1590
462 Ga0451576_0344956 3300045051 Bacteria 1559
463 Ga0451576_1232802 3300045051 Unclassified 781
464 Ga0466967_2323544 3300045976 Unclassified 532
465 Ga0495603_0012523 3300046455 Bacteria 5135
466 Ga0495629_0627744 3300046459 Unclassified 717
467 Ga0495653_0712776 3300046463 Unclassified 609
468 Ga0495580_0130816 3300046472 Bacteria 1741
469 Ga0495584_0535502 3300046491 Bacteria 597
470 Ga0495585_0177441 3300046492 Bacteria 1097
471 Ga0495630_1206456 3300046517 Unclassified 572
472 Ga0495643_0069982 3300046522 Bacteria 1843
473 Ga0495663_0040124 3300046525 Bacteria 1420
474 Ga0495642_0054358 3300046528 Bacteria 1651
475 Ga0495642_0231966 3300046528 Bacteria 806
476 Ga0495587_0433448 3300046536 Unclassified 729
477 Ga0495598_0004449 3300046537 Bacteria 3035
478 Ga0495609_0042955 3300046538 Bacteria 2030
479 Ga0495621_0020462 3300046539 Bacteria 2172
480 Ga0495621_0050133 3300046539 Unclassified 1491
481 Ga0495621_0201378 3300046539 Bacteria 801
482 Ga0495667_0504562 3300046559 Unclassified 758
483 Ga0495656_0111397 3300046615 Bacteria 1281
484 Ga0495659_0002582 3300046664 Bacteria 5839
485 Ga0495659_0004253 3300046664 Bacteria 4513
486 Ga0495659_0039190 3300046664 Bacteria 1685
487 Ga0495659_0057494 3300046664 Bacteria 1429
488 Ga0495659_0264653 3300046664 Bacteria 719
489 Ga0495659_0410957 3300046664 Unclassified 585
490 Ga0495599_0444743 3300046678 Bacteria 768
491 Ga0495670_0224048 3300046691 Bacteria 999
492 Ga0495670_0279422 3300046691 Bacteria 893
493 Ga0495581_0342383 3300047315 Bacteria 873
494 Ga0495672_0386109 3300047320 Unclassified 643
495 Ga0495677_0302187 3300047445 Bacteria 629
496 Ga0495602_0156236 3300048088 Bacteria 1786
497 Ga0495614_0214209 3300048089 Unclassified 874
498 Ga0496104_0238902 3300048907 Bacteria 1729
499 Ga0496112_1136214 3300048915 Unclassified 699
500 Ga0496113_0332602 3300048916 Bacteria 1218
501 Ga0496114_0360894 3300048917 Bacteria 1285
502 Ga0501298_044824 3300049521 Unclassified 904
503 Ga0501300_039046 3300049523 Unclassified 713
504 Ga0501033_0003280 3300049570 Bacteria 13387
505 Ga0501034_0001012 3300049571 Bacteria 40282
506 Ga0501034_0006266 3300049571 Bacteria 12796
507 Ga0501034_0068785 3300049571 Bacteria 3551
508 Ga0501034_0374505 3300049571 Bacteria 1349
509 Ga0501034_0513695 3300049571 Bacteria 1110
510 Ga0501034_1076826 3300049571 Bacteria 685
511 Ga0501036_0001138 3300049572 Bacteria 20220
512 Ga0501036_0006920 3300049572 Bacteria 9219
513 Ga0501036_0236195 3300049572 Bacteria 1533
514 Ga0501036_0317831 3300049572 Unclassified 1301
515 Ga0501036_0468171 3300049572 Bacteria 1049
516 Ga0501036_0703456 3300049572 Unclassified 835
517 Ga0501037_0033329 3300049573 Bacteria 3804
518 Ga0501037_0193015 3300049573 Bacteria 1441
519 Ga0501037_0204551 3300049573 Bacteria 1394
520 Ga0501037_0210854 3300049573 Bacteria 1370
521 Ga0501037_0236534 3300049573 Bacteria 1281
522 Ga0501038_0002121 3300049574 Bacteria 18409
523 Ga0501038_0021541 3300049574 Bacteria 5783
524 Ga0501038_0064181 3300049574 Bacteria 3132
525 Ga0501038_0172566 3300049574 Bacteria 1749
526 Ga0501039_0005899 3300049575 Bacteria 9277
527 Ga0501039_0054606 3300049575 Bacteria 3092
528 Ga0501039_0130879 3300049575 Bacteria 1969
529 Ga0501039_0335440 3300049575 Bacteria 1188
530 Ga0501039_0766112 3300049575 Unclassified 753
531 Ga0501040_0023982 3300049576 Unclassified 4093
532 Ga0501040_0070144 3300049576 Bacteria 2418
533 Ga0501040_0130288 3300049576 Bacteria 1768
534 Ga0501040_0457682 3300049576 Bacteria 919
535 Ga0501042_0003847 3300049578 Bacteria 9494
536 Ga0501043_0000888 3300049579 Bacteria 26531
537 Ga0501043_0003229 3300049579 Bacteria 13458
538 Ga0501043_0034675 3300049579 Bacteria 3969
539 Ga0501043_0060909 3300049579 Bacteria 2963
540 Ga0501043_0223488 3300049579 Bacteria 1456
541 Ga0501043_1144394 3300049579 Unclassified 548
542 Ga0501043_1235150 3300049579 Bacteria 523
543 Ga0501046_0003278 3300049580 Bacteria 14863
544 Ga0501046_0025132 3300049580 Bacteria 4877
545 Ga0501046_0862945 3300049580 Bacteria 632
546 Ga0501047_0000928 3300049581 Bacteria 29951
547 Ga0501047_0005704 3300049581 Bacteria 11713
548 Ga0501047_0089912 3300049581 Bacteria 2947
549 Ga0501047_0192265 3300049581 Bacteria 1903
550 Ga0501047_0224859 3300049581 Bacteria 1732
551 Ga0501047_0749671 3300049581 Bacteria 792
552 Ga0501047_1161399 3300049581 Bacteria 585
553 Ga0501048_0001253 3300049582 Bacteria 19210
554 Ga0501048_0020035 3300049582 Bacteria 4906
555 Ga0501048_0047961 3300049582 Bacteria 3047
556 Ga0501048_0103129 3300049582 Bacteria 2013
557 Ga0501048_0245276 3300049582 Bacteria 1271
558 Ga0501048_0367792 3300049582 Unclassified 1026
559 Ga0501067_0003815 3300049583 Bacteria 8315
560 Ga0501067_0039903 3300049583 Unclassified 2607
561 Ga0501067_0242838 3300049583 Bacteria 1002
562 Ga0501068_0011254 3300049584 Bacteria 5046
563 Ga0501068_0020249 3300049584 Bacteria 3873
564 Ga0501068_0397207 3300049584 Bacteria 889
565 Ga0501069_0022480 3300049585 Bacteria 3431
566 Ga0501069_0025082 3300049585 Bacteria 3256
567 Ga0501069_0113311 3300049585 Unclassified 1546
568 Ga0501070_0000530 3300049586 Bacteria 35045
569 Ga0501070_0450667 3300049586 Bacteria 1037
570 Ga0501071_0232050 3300049587 Bacteria 1390
571 Ga0501071_0260848 3300049587 Bacteria 1309
572 Ga0501072_0011444 3300049588 Bacteria 6781
573 Ga0501072_0200773 3300049588 Bacteria 1590
574 Ga0501073_0000121 3300049589 Bacteria 50301
575 Ga0501073_0028632 3300049589 Bacteria 3980
576 Ga0501073_0043403 3300049589 Bacteria 3170
577 Ga0501073_0099013 3300049589 Bacteria 2024
578 Ga0501073_0322423 3300049589 Bacteria 1066
579 Ga0501073_0596980 3300049589 Bacteria 763
580 Ga0501074_0066748 3300049590 Bacteria 2587
581 Ga0501074_0080142 3300049590 Bacteria 2343
582 Ga0501075_0099625 3300049591 Bacteria 2207
583 Ga0501075_0178749 3300049591 Bacteria 1619
584 Ga0501075_0180245 3300049591 Bacteria 1612
585 Ga0501075_0596114 3300049591 Unclassified 843
586 Ga0501076_0023955 3300049592 Bacteria 4711
587 Ga0501076_0147407 3300049592 Bacteria 1914
588 Ga0501076_0391084 3300049592 Unclassified 1143
589 Ga0501076_0989594 3300049592 Bacteria 693
590 Ga0501077_0069511 3300049593 Bacteria 2232
591 Ga0501077_0085213 3300049593 Unclassified 2003
592 Ga0501077_0685352 3300049593 Unclassified 658
593 Ga0501249_031228 3300049679 Unclassified 1188
594 Ga0501257_157112 3300049686 Unclassified 631
595 Ga0501079_0199659 3300049741 Bacteria 1562
596 Ga0501079_0720340 3300049741 Bacteria 785
597 Ga0501079_1567154 3300049741 Unclassified 518
598 Ga0501080_0005526 3300049742 Bacteria 11283
599 Ga0501080_0099501 3300049742 Bacteria 2698
600 Ga0501080_0221912 3300049742 Bacteria 1729
601 Ga0501080_0492600 3300049742 Bacteria 1096
602 Ga0501080_0661929 3300049742 Bacteria 923
603 Ga0501081_0013897 3300049743 Bacteria 5300
604 Ga0501081_0165858 3300049743 Bacteria 1593
605 Ga0501081_0274556 3300049743 Bacteria 1233
606 Ga0501081_0580053 3300049743 Bacteria 839
607 Ga0501081_0667694 3300049743 Unclassified 779
608 Ga0501083_0002195 3300049744 Bacteria 13342
609 Ga0501083_0058868 3300049744 Bacteria 2570
610 Ga0501083_0070326 3300049744 Bacteria 2327
611 Ga0501083_0234300 3300049744 Bacteria 1195
612 Ga0501083_0494087 3300049744 Unclassified 796
613 Ga0501279_008711 3300049775 Unclassified 1357
614 Ga0501283_004651 3300049779 Unclassified 1861
615 Ga0501035_0006278 3300049822 Bacteria 11178
616 Ga0501035_0019769 3300049822 Bacteria 6187
617 Ga0501035_0197989 3300049822 Bacteria 1724
618 Ga0501035_0352872 3300049822 Unclassified 1230
619 Ga0501035_1036281 3300049822 Unclassified 644
620 Ga0501035_1062766 3300049822 Bacteria 634
621 Ga0501044_0002378 3300049823 Bacteria 21429
622 Ga0501044_0006552 3300049823 Bacteria 12855
623 Ga0501044_0050870 3300049823 Bacteria 4274
624 Ga0501044_0256089 3300049823 Unclassified 1689
625 Ga0501044_0352710 3300049823 Bacteria 1390
626 Ga0501044_1194693 3300049823 Bacteria 628
627 Ga0501045_0023091 3300049824 Bacteria 4457
628 Ga0501045_0032900 3300049824 Bacteria 3759
629 Ga0501045_0078126 3300049824 Bacteria 2440
630 Ga0501045_0186144 3300049824 Bacteria 1547
631 nmdc:mga05p37_1036874_c1 3300050507 Bacteria 867
632 nmdc:mga05p37_1184020_c1 3300050507 Bacteria 791
633 nmdc:mga05p37_18236_c1 3300050507 Bacteria 8480
634 nmdc:mga05p37_319581_c1 3300050507 Bacteria 1838
635 nmdc:mga05p37_375759_c1 3300050507 Unclassified 1667
636 nmdc:mga05p37_483321_c1 3300050507 Unclassified 1426
637 nmdc:mga05p37_5673_c1 3300050507 Bacteria 14670
638 nmdc:mga05p37_67009_c1 3300050507 Bacteria 4416
639 nmdc:mga09592_120476_c1 3300050508 Bacteria 2254
640 nmdc:mga09592_157836_c1 3300050508 Bacteria 1958
641 nmdc:mga09592_17242_c1 3300050508 Bacteria 5914
642 nmdc:mga09592_252586_c1 3300050508 Unclassified 1528
643 nmdc:mga09592_27262_c1 3300050508 Bacteria 4740
644 nmdc:mga09592_49492_c1 3300050508 Bacteria 3543
645 nmdc:mga09592_576998_c1 3300050508 Unclassified 965
646 nmdc:mga0qj67_127782_c1 3300050509 Bacteria 2057
647 nmdc:mga0qj67_249669_c1 3300050509 Bacteria 1440
648 nmdc:mga0qj67_40963_c1 3300050509 Bacteria 3642
649 nmdc:mga0qj67_598508_c1 3300050509 Bacteria 882
650 nmdc:mga0qj67_60834_c1 3300050509 Bacteria 2998
651 nmdc:mga0qj67_64152_c1 3300050509 Bacteria 2921
652 nmdc:mga06r32_106874_c1 3300050510 Bacteria 2750
653 nmdc:mga06r32_107321_c1 3300050510 Bacteria 2744
654 nmdc:mga06r32_522829_c1 3300050510 Bacteria 1162
655 nmdc:mga06r32_858990_c1 3300050510 Bacteria 866
656 nmdc:mga08y16_116640_c1 3300050511 Unclassified 2780
657 nmdc:mga08y16_11699_c1 3300050511 Bacteria 9220
658 nmdc:mga08y16_1192_c1 3300050511 Bacteria 25681
659 nmdc:mga08y16_15418_c1 3300050511 Bacteria 8038
660 nmdc:mga08y16_214872_c1 3300050511 Bacteria 1991
661 nmdc:mga08y16_586343_c1 3300050511 Viruses 1125
662 nmdc:mga08y16_66355_c1 3300050511 Bacteria 3766
663 nmdc:mga0n895_126411_c1 3300050512 Bacteria 2581
664 nmdc:mga0n895_1670473_c1 3300050512 Bacteria 600
665 nmdc:mga0n895_192530_c1 3300050512 Bacteria 2070
666 nmdc:mga0n895_37449_c1 3300050512 Bacteria 4693
667 nmdc:mga0n895_44447_c1 3300050512 Bacteria 4331
668 nmdc:mga0n895_446489_c1 3300050512 Bacteria 1306
669 nmdc:mga0n895_6536_c1 3300050512 Bacteria 9921
670 nmdc:mga0n895_65902_c1 3300050512 Bacteria 3586
671 nmdc:mga0n895_80704_c1 3300050512 Bacteria 3241
672 nmdc:mga0n895_81030_c1 3300050512 Unclassified 3234
673 nmdc:mga0rr50_168669_c1 3300050513 Bacteria 1782
674 nmdc:mga0rr50_274951_c1 3300050513 Bacteria 1404
675 nmdc:mga0rr50_6549_c1 3300050513 Bacteria 7106
676 nmdc:mga0rr50_98098_c1 3300050513 Bacteria 2296
677 nmdc:mga08x19_477252_c1 3300050514 Unclassified 879
678 nmdc:mga0a205_106701_c1 3300050515 Bacteria 2699
679 nmdc:mga0a205_1171977_c1 3300050515 Unclassified 616
680 nmdc:mga0a205_15602_c1 3300050515 Bacteria 7100
681 nmdc:mga0a205_3118_c1 3300050515 Bacteria 13313
682 nmdc:mga0a205_491810_c1 3300050515 Bacteria 1084
683 nmdc:mga0a205_69760_c2 3300050515 Bacteria 1990
684 nmdc:mga0a205_926_c1 3300050515 Bacteria 24210
685 Ga0495601_0074212 3300053077 Bacteria 2176
686 Ga0495619_0020826 3300053085 Bacteria 4183
687 Ga0495619_0144566 3300053085 Bacteria 1639
688 Ga0495619_0732466 3300053085 Unclassified 671
689 Ga0501084_0010667 3300054114 Bacteria 7606
690 Ga0501084_0018696 3300054114 Bacteria 5769
691 Ga0501084_0020582 3300054114 Bacteria 5502
692 Ga0501084_0348335 3300054114 Bacteria 1251
693 Ga0501084_0599405 3300054114 Bacteria 931
694 Ga0501084_0646281 3300054114 Unclassified 893
695 Ga0501084_0816163 3300054114 Bacteria 785
696 Ga0590071_139658 3300059421 Unclassified 625
697 Ga0501082_0010491 3300060353 Bacteria 7971
698 Ga0501082_0101360 3300060353 Bacteria 2490
699 Ga0501082_0161741 3300060353 Bacteria 1946
700 Ga0501082_0214139 3300060353 Bacteria 1676
701 Ga0501082_0568641 3300060353 Unclassified 992
702 Ga0501082_0613275 3300060353 Bacteria 952
703 Ga0530510_0019241 3300061734 Bacteria 4846
704 Ga0530510_0279967 3300061734 Bacteria 1246
705 Ga0530510_0594610 3300061734 Unclassified 841
706 Ga0530510_0776608 3300061734 Unclassified 731
707 Ga0530510_1085711 3300061734 Unclassified 613
708 Ga0207642_10365102
709 SwRhRL3b_contig_408515
710 SwRhRL2b_contig_2082529
711 SwRhRL2b_contig_3196757
712 MBSR1b_contig_12615748
713 JGI24746J21847_1041888
714 JGI24751J29686_10064371
715 Ga0065704_10081093
716 Ga0065712_10004893
717 Ga0065712_10072653
718 Ga0065715_10091667
719 Ga0065715_10135667
720 Ga0065715_10473249
721 Ga0065707_10003125
722 Ga0065707_10003579
723 Ga0065707_10155616
724 Ga0070676_10174191
725 Ga0070676_10176101
726 Ga0070676_10366063
727 Ga0070690_100059735
728 Ga0070690_100420029
729 Ga0070670_100010884
730 Ga0070670_100240290
731 Ga0070677_10016386
732 Ga0070677_10141123
733 Ga0070677_10459676
734 Ga0068869_100011615
735 Ga0068869_100085452
736 Ga0068869_101853006
737 Ga0068868_100119789
738 Ga0068868_100177829
739 Ga0068868_100577168
740 Ga0070689_100007233
741 Ga0070689_100035649
742 Ga0070689_100136403
743 Ga0070687_100021312
744 Ga0070687_100170383
745 Ga0070661_100084245
746 Ga0070661_100470369
747 Ga0070692_10016084
748 Ga0070668_100337206
749 Ga0070668_101125663
750 Ga0070669_100000596
751 Ga0070669_100082779
752 Ga0070669_100280664
753 Ga0070669_100325618
754 Ga0070669_100476414
755 Ga0070675_100002521
756 Ga0070675_100016388
757 Ga0070675_100024965
758 Ga0070675_100057998
759 Ga0070675_100604302
760 Ga0070675_100907519
761 Ga0070675_101165757
762 Ga0070671_100993817
763 Ga0070674_100000544
764 Ga0070674_100116236
765 Ga0070674_100193855
766 Ga0070674_100633557
767 Ga0070673_100004314
768 Ga0070673_100034065
769 Ga0070673_100040867
770 Ga0070673_100066858
771 Ga0070673_100117358
772 Ga0070673_100523009
773 Ga0070673_100577310
774 Ga0070673_100718152
775 Ga0070688_100019634
776 Ga0070688_100268775
777 Ga0070667_100214169
778 Ga0070667_100278516
779 Ga0070667_100486403
780 Ga0070703_10149230
781 Ga0070703_10311741
782 Ga0070713_100102299
783 Ga0070701_10026355
784 Ga0070701_10115099
785 Ga0070701_10288262
786 Ga0070705_100114031
787 Ga0070705_100536853
788 Ga0070700_100023622
789 Ga0070700_100026836
790 Ga0070700_100140757
791 Ga0070700_100484525
792 Ga0070694_100186666
793 Ga0070694_100192225
794 Ga0070694_100340747
795 Ga0070708_100250179
796 Ga0070678_100037102
797 Ga0070678_100601632
798 Ga0070662_100812357
799 Ga0070681_11442955
800 Ga0068867_100033549
801 Ga0068867_100113416
802 Ga0068867_100578377
803 Ga0068867_100713926
804 Ga0070685_10044953
805 Ga0070685_10249674
806 Ga0070707_100437741
807 Ga0070698_100001676
808 Ga0070698_100135089
809 Ga0070699_100000326
810 Ga0070699_100022707
811 Ga0070699_100139448
812 Ga0070697_100724954
813 Ga0070672_100036882
814 Ga0070672_100057156
815 Ga0070672_100073061
816 Ga0070672_100178507
817 Ga0070672_100308187
818 Ga0070686_100024347
819 Ga0070686_100822457
820 Ga0070686_100828178
821 Ga0070695_100350248
822 Ga0070696_100000832
823 Ga0070696_100034575
824 Ga0070696_100085031
825 Ga0070696_100717516
826 Ga0070693_100205385
827 Ga0070693_100796812
828 Ga0070704_100016355
829 Ga0070704_100031158
830 Ga0070704_100679279
831 Ga0070704_100825509
832 Ga0070704_101070053
833 Ga0070704_101475032
834 Ga0070664_100069517
835 Ga0070664_100292027
836 Ga0070664_100808996
837 Ga0068857_100273675
838 Ga0068857_100438608
839 Ga0068854_100049903
840 Ga0068859_100001112
841 Ga0068859_100024181
842 Ga0068859_100069848
843 Ga0068859_100072615
844 Ga0068859_100091271
845 Ga0068859_100132075
846 Ga0068859_100380383
847 Ga0068859_100877205
848 Ga0068864_100015556
849 Ga0068864_100073738
850 Ga0068864_100192769
851 Ga0068864_100756325
852 Ga0068866_10346106
853 Ga0068866_10939488
854 Ga0068861_100011836
855 Ga0068861_100079425
856 Ga0068861_101027910
857 Ga0068870_10004437
858 Ga0068870_10106278
859 Ga0068870_10106743
860 Ga0068870_10121428
861 Ga0068870_10192705
862 Ga0068863_100011384
863 Ga0068863_100823848
864 Ga0068858_100132036
865 Ga0068858_100297542
866 Ga0068860_100009826
867 Ga0068860_100040090
868 Ga0068860_100040241
869 Ga0068860_100499905
870 Ga0068862_100021671
871 Ga0068862_100114272
872 Ga0068862_100126927
873 Ga0068862_100234874
874 Ga0068862_101028271
875 Ga0097621_100007251
876 Ga0097621_100150718
877 Ga0097621_101007361
878 Ga0097621_101034967
879 Ga0097621_101123210
880 Ga0097621_101642700
881 Ga0068871_100001274
882 Ga0068871_100159892
883 Ga0068871_100302467
884 Ga0068871_100485596
885 Ga0068871_101834154
886 Ga0075428_100005316
887 Ga0075428_100186311
888 Ga0075430_100000072
889 Ga0075430_100024533
890 Ga0075430_100025128
891 Ga0075430_100079215
892 Ga0075430_100107290
893 Ga0075430_100135219
894 Ga0075430_100168974
895 Ga0075431_100004360
896 Ga0075431_100005750
897 Ga0075431_100166145
898 Ga0075431_100251629
899 Ga0075431_100537440
900 Ga0075431_100721589
901 Ga0075431_101181069
902 Ga0075431_101409116
903 Ga0075433_10006742
904 Ga0075433_10011488
905 Ga0075434_100007785
906 Ga0075434_100009838
907 Ga0075434_100064969
908 Ga0075434_100103145
909 Ga0075434_100109549
910 Ga0075434_100194677
911 Ga0075434_100303357
912 Ga0075434_101198169
913 Ga0075429_100039611
914 Ga0075429_100057750
915 Ga0075429_100069266
916 Ga0075429_100110847
917 Ga0075429_100115678
918 Ga0075429_100595467
919 Ga0075429_100770973
920 Ga0068865_100363286
921 Ga0068865_100600200
922 Ga0068865_100724676
923 Ga0097620_100001112
924 Ga0097620_100024182
925 Ga0097620_100069847
926 Ga0097620_100072615
927 Ga0097620_100091275
928 Ga0097620_100132070
929 Ga0097620_100380366
930 Ga0097620_100877195
931 Ga0075435_100006920
932 Ga0075435_100215457
933 Ga0075435_100329924
934 Ga0075435_100926879
935 Ga0111539_10001705
936 Ga0111539_10025746
937 Ga0111539_10052776
938 Ga0111539_10054902
939 Ga0111539_10058466
940 Ga0111539_10297474
941 Ga0111539_10433375
942 Ga0111539_10483460
943 Ga0111539_10992089
944 Ga0111539_11699420
945 Ga0105245_10948674
946 Ga0105245_11352692
947 Ga0105245_11636094
948 Ga0105245_11859308
949 Ga0114129_10006373
950 Ga0114129_10016577
951 Ga0114129_10051626
952 Ga0114129_10064402
953 Ga0114129_10094193
954 Ga0114129_10595203
955 Ga0114129_11513814
956 Ga0114129_11848010
957 Ga0105243_10047266
958 Ga0105248_10122928
959 Ga0105248_10970856
960 Ga0105248_11024835
961 Ga0105248_12232026
962 Ga0105249_10009258
963 Ga0105249_10010566
964 Ga0105246_10426016
965 Ga0105246_11001928
966 Ga0157378_10219987
967 Ga0157378_10378229
968 Ga0163162_10057804
969 Ga0163162_10070722
970 Ga0163162_10912103
971 Ga0163162_11185957
972 Ga0157375_10015796
973 Ga0157375_10090673
974 Ga0157375_10406564
975 Ga0157375_11104689
976 Ga0163163_10021922
977 Ga0163163_10099074
978 Ga0157380_10000828
979 Ga0157380_10000884
980 Ga0157380_10032139
981 Ga0157380_10052607
982 Ga0157380_10061603
983 Ga0157380_10208427
984 Ga0157380_10236826
985 Ga0157380_10835023
986 Ga0157380_11070670
987 Ga0157380_11154871
988 Ga0157380_11625739
989 Ga0157377_10007046
990 Ga0157377_10032568
991 Ga0157377_10055819
992 Ga0157377_10061758
993 Ga0157377_10092209
994 Ga0157377_10118408
995 Ga0157376_10028660
996 Ga0157376_10221859
997 Ga0157376_10638285
998 Ga0157376_10816553
999 Ga0157376_11059797
1000 Ga0163161_10028559
1001 Ga0207697_10092769
1002 Ga0207682_10002357
1003 Ga0207682_10041305
1004 Ga0207682_10082941
1005 Ga0207682_10119259
1006 Ga0207642_10338448
1007 Ga0207688_10009353
1008 Ga0207688_10197182
1009 Ga0207680_10287317
1010 Ga0207647_10354766
1011 Ga0207645_10036272
1012 Ga0207645_10041419
1013 Ga0207643_10017964
1014 Ga0207643_10034784
1015 Ga0207643_10111596
1016 Ga0207643_10113426
1017 Ga0207643_10158268
1018 Ga0207643_10402351
1019 Ga0207707_11207172
1020 Ga0207662_10039797
1021 Ga0207662_10128751
1022 Ga0207681_10040437
1023 Ga0207681_10081408
1024 Ga0207681_10111911
1025 Ga0207681_10142870
1026 Ga0207650_10057030
1027 Ga0207650_10140941
1028 Ga0207650_10200503
1029 Ga0207650_10241606
1030 Ga0207650_11650699
1031 Ga0207659_10000237
1032 Ga0207659_10027344
1033 Ga0207659_10045665
1034 Ga0207659_10070990
1035 Ga0207659_10090083
1036 Ga0207659_10114807
1037 Ga0207659_10152933
1038 Ga0207659_10572426
1039 Ga0207687_10264092
1040 Ga0207644_10018056
1041 Ga0207690_10440091
1042 Ga0207706_10029283
1043 Ga0207706_10091139
1044 Ga0207670_10037408
1045 Ga0207670_10606282
1046 Ga0207669_10001028
1047 Ga0207704_10130811
1048 Ga0207704_10264122
1049 Ga0207704_10359979
1050 Ga0207704_10579707
1051 Ga0207704_11151126
1052 Ga0207691_10034384
1053 Ga0207691_10038097
1054 Ga0207691_10047584
1055 Ga0207691_10135150
1056 Ga0207691_10158020
1057 Ga0207691_10185771
1058 Ga0207691_10278089
1059 Ga0207711_10025384
1060 Ga0207711_10930152
1061 Ga0207689_10017818
1062 Ga0207689_10102866
1063 Ga0207689_10667290
1064 Ga0207679_10009451
1065 Ga0207679_10261177
1066 Ga0207679_10763587
1067 Ga0207679_10863262
1068 Ga0207651_10003521
1069 Ga0207651_10024769
1070 Ga0207651_10073737
1071 Ga0207651_10144489
1072 Ga0207651_10191134
1073 Ga0207651_10246458
1074 Ga0207651_10576304
1075 Ga0207651_10968767
1076 Ga0207712_10032467
1077 Ga0207712_10070308
1078 Ga0207668_10337346
1079 Ga0207668_10400285
1080 Ga0207640_10318741
1081 Ga0207658_10165531
1082 Ga0207658_10349074
1083 Ga0207658_10836615
1084 Ga0207677_10054252
1085 Ga0207677_10097396
1086 Ga0207677_10498307
1087 Ga0207703_10193168
1088 Ga0207703_10258726
1089 Ga0207678_10778064
1090 Ga0207678_10946518
1091 Ga0207708_10033155
1092 Ga0207708_10066710
1093 Ga0207708_10174180
1094 Ga0207708_10329297
1095 Ga0207708_10612981
1096 Ga0207708_10649137
1097 Ga0207641_10321598
1098 Ga0207641_10656581
1099 Ga0207648_10000784
1100 Ga0207648_10115734
1101 Ga0207648_10144082
1102 Ga0207648_10240878
1103 Ga0207676_10257660
1104 Ga0207676_10390745
1105 Ga0207674_10019967
1106 Ga0207674_10033926
1107 Ga0207674_10045406
1108 Ga0207674_10212825
1109 Ga0207675_100000123
1110 Ga0207675_100493536
1111 Ga0207675_100524135
1112 Ga0207675_101106324
1113 Ga0207675_101263491
1114 Ga0207683_10009303
1115 Ga0207683_10109845
1116 Ga0207683_10230059
1117 Ga0207683_10231549
1118 Ga0207683_10354439
1119 Ga0207428_10000344
1120 Ga0207428_10003636
1121 Ga0207428_10014490
1122 Ga0207428_10016452
1123 Ga0268265_10007820
1124 Ga0268265_10024408
1125 Ga0268265_10079632
1126 Ga0268265_10537136
1127 Ga0268265_10549190
1128 Ga0268265_10775751
1129 Ga0268264_10008871
1130 Ga0268264_10046389
1131 Ga0268264_10070572
1132 Ga0268264_11076093
1133 Ga0307408_100748737
1134 Ga0307405_10306579
1135 Ga0307409_101136067
1136 Ga0307416_101516721
1137 Ga0307411_10578992
1138 Ga0307415_101737155
1139 Ga0373934_0040729
1140 Ga0373934_0086334
1141 Ga0373956_0391129
1142 Ga0373960_0043798
1143 Ga0373943_0549534
1144 Ga0373943_0610557
1145 Ga0373946_0194789
1146 Ga0373955_0171468
1147 Ga0373924_0158113
1148 Ga0373931_0068580
1149 Ga0373935_0148120
1150 Ga0373927_0203971
1151 Ga0373927_0442826
1152 Ga0373947_0166956
1153 Ga0373937_0046399
1154 Ga0373937_0568938
1155 Ga0373937_0708775
1156 Ga0373925_0603812
1157 Ga0395900_1556639
1158 Ga0439447_052201
1159 Ga0451853_2463058
1160 Ga0439450_077545
1161 Ga0439446_0103276
1162 Ga0439444_0110955
1163 Ga0439464_0038112
1164 Ga0450916_034872
1165 Ga0451577_1798810
1166 Ga0453683_0312171
1167 Ga0453684_0437688
1168 Ga0451576_0332627
1169 Ga0451576_0344956
1170 Ga0451576_1232802
1171 Ga0466967_2323544
1172 Ga0495603_0012523
1173 Ga0495629_0627744
1174 Ga0495653_0712776
1175 Ga0495580_0130816
1176 Ga0495584_0535502
1177 Ga0495585_0177441
1178 Ga0495630_1206456
1179 Ga0495643_0069982
1180 Ga0495663_0040124
1181 Ga0495642_0054358
1182 Ga0495642_0231966
1183 Ga0495587_0433448
1184 Ga0495598_0004449
1185 Ga0495609_0042955
1186 Ga0495621_0020462
1187 Ga0495621_0050133
1188 Ga0495621_0201378
1189 Ga0495667_0504562
1190 Ga0495656_0111397
1191 Ga0495659_0002582
1192 Ga0495659_0004253
1193 Ga0495659_0039190
1194 Ga0495659_0057494
1195 Ga0495659_0264653
1196 Ga0495659_0410957
1197 Ga0495599_0444743
1198 Ga0495670_0224048
1199 Ga0495670_0279422
1200 Ga0495581_0342383
1201 Ga0495672_0386109
1202 Ga0495677_0302187
1203 Ga0495602_0156236
1204 Ga0495614_0214209
1205 Ga0496104_0238902
1206 Ga0496112_1136214
1207 Ga0496113_0332602
1208 Ga0496114_0360894
1209 Ga0501298_044824
1210 Ga0501300_039046
1211 Ga0501033_0003280
1212 Ga0501034_0001012
1213 Ga0501034_0006266
1214 Ga0501034_0068785
1215 Ga0501034_0374505
1216 Ga0501034_0513695
1217 Ga0501034_1076826
1218 Ga0501036_0001138
1219 Ga0501036_0006920
1220 Ga0501036_0236195
1221 Ga0501036_0317831
1222 Ga0501036_0468171
1223 Ga0501036_0703456
1224 Ga0501037_0033329
1225 Ga0501037_0193015
1226 Ga0501037_0204551
1227 Ga0501037_0210854
1228 Ga0501037_0236534
1229 Ga0501038_0002121
1230 Ga0501038_0021541
1231 Ga0501038_0064181
1232 Ga0501038_0172566
1233 Ga0501039_0005899
1234 Ga0501039_0054606
1235 Ga0501039_0130879
1236 Ga0501039_0335440
1237 Ga0501039_0766112
1238 Ga0501040_0023982
1239 Ga0501040_0070144
1240 Ga0501040_0130288
1241 Ga0501040_0457682
1242 Ga0501042_0003847
1243 Ga0501043_0000888
1244 Ga0501043_0003229
1245 Ga0501043_0034675
1246 Ga0501043_0060909
1247 Ga0501043_0223488
1248 Ga0501043_1144394
1249 Ga0501043_1235150
1250 Ga0501046_0003278
1251 Ga0501046_0025132
1252 Ga0501046_0862945
1253 Ga0501047_0000928
1254 Ga0501047_0005704
1255 Ga0501047_0089912
1256 Ga0501047_0192265
1257 Ga0501047_0224859
1258 Ga0501047_0749671
1259 Ga0501047_1161399
1260 Ga0501048_0001253
1261 Ga0501048_0020035
1262 Ga0501048_0047961
1263 Ga0501048_0103129
1264 Ga0501048_0245276
1265 Ga0501048_0367792
1266 Ga0501067_0003815
1267 Ga0501067_0039903
1268 Ga0501067_0242838
1269 Ga0501068_0011254
1270 Ga0501068_0020249
1271 Ga0501068_0397207
1272 Ga0501069_0022480
1273 Ga0501069_0025082
1274 Ga0501069_0113311
1275 Ga0501070_0000530
1276 Ga0501070_0450667
1277 Ga0501071_0232050
1278 Ga0501071_0260848
1279 Ga0501072_0011444
1280 Ga0501072_0200773
1281 Ga0501073_0000121
1282 Ga0501073_0028632
1283 Ga0501073_0043403
1284 Ga0501073_0099013
1285 Ga0501073_0322423
1286 Ga0501073_0596980
1287 Ga0501074_0066748
1288 Ga0501074_0080142
1289 Ga0501075_0099625
1290 Ga0501075_0178749
1291 Ga0501075_0180245
1292 Ga0501075_0596114
1293 Ga0501076_0023955
1294 Ga0501076_0147407
1295 Ga0501076_0391084
1296 Ga0501076_0989594
1297 Ga0501077_0069511
1298 Ga0501077_0085213
1299 Ga0501077_0685352
1300 Ga0501249_031228
1301 Ga0501257_157112
1302 Ga0501079_0199659
1303 Ga0501079_0720340
1304 Ga0501079_1567154
1305 Ga0501080_0005526
1306 Ga0501080_0099501
1307 Ga0501080_0221912
1308 Ga0501080_0492600
1309 Ga0501080_0661929
1310 Ga0501081_0013897
1311 Ga0501081_0165858
1312 Ga0501081_0274556
1313 Ga0501081_0580053
1314 Ga0501081_0667694
1315 Ga0501083_0002195
1316 Ga0501083_0058868
1317 Ga0501083_0070326
1318 Ga0501083_0234300
1319 Ga0501083_0494087
1320 Ga0501279_008711
1321 Ga0501283_004651
1322 Ga0501035_0006278
1323 Ga0501035_0019769
1324 Ga0501035_0197989
1325 Ga0501035_0352872
1326 Ga0501035_1036281
1327 Ga0501035_1062766
1328 Ga0501044_0002378
1329 Ga0501044_0006552
1330 Ga0501044_0050870
1331 Ga0501044_0256089
1332 Ga0501044_0352710
1333 Ga0501044_1194693
1334 Ga0501045_0023091
1335 Ga0501045_0032900
1336 Ga0501045_0078126
1337 Ga0501045_0186144
1338 nmdc:mga05p37_1036874_c1
1339 nmdc:mga05p37_1184020_c1
1340 nmdc:mga05p37_18236_c1
1341 nmdc:mga05p37_319581_c1
1342 nmdc:mga05p37_375759_c1
1343 nmdc:mga05p37_483321_c1
1344 nmdc:mga05p37_5673_c1
1345 nmdc:mga05p37_67009_c1
1346 nmdc:mga09592_120476_c1
1347 nmdc:mga09592_157836_c1
1348 nmdc:mga09592_17242_c1
1349 nmdc:mga09592_252586_c1
1350 nmdc:mga09592_27262_c1
1351 nmdc:mga09592_49492_c1
1352 nmdc:mga09592_576998_c1
1353 nmdc:mga0qj67_127782_c1
1354 nmdc:mga0qj67_249669_c1
1355 nmdc:mga0qj67_40963_c1
1356 nmdc:mga0qj67_598508_c1
1357 nmdc:mga0qj67_60834_c1
1358 nmdc:mga0qj67_64152_c1
1359 nmdc:mga06r32_106874_c1
1360 nmdc:mga06r32_107321_c1
1361 nmdc:mga06r32_522829_c1
1362 nmdc:mga06r32_858990_c1
1363 nmdc:mga08y16_116640_c1
1364 nmdc:mga08y16_11699_c1
1365 nmdc:mga08y16_1192_c1
1366 nmdc:mga08y16_15418_c1
1367 nmdc:mga08y16_214872_c1
1368 nmdc:mga08y16_586343_c1
1369 nmdc:mga08y16_66355_c1
1370 nmdc:mga0n895_126411_c1
1371 nmdc:mga0n895_1670473_c1
1372 nmdc:mga0n895_192530_c1
1373 nmdc:mga0n895_37449_c1
1374 nmdc:mga0n895_44447_c1
1375 nmdc:mga0n895_446489_c1
1376 nmdc:mga0n895_6536_c1
1377 nmdc:mga0n895_65902_c1
1378 nmdc:mga0n895_80704_c1
1379 nmdc:mga0n895_81030_c1
1380 nmdc:mga0rr50_168669_c1
1381 nmdc:mga0rr50_274951_c1
1382 nmdc:mga0rr50_6549_c1
1383 nmdc:mga0rr50_98098_c1
1384 nmdc:mga08x19_477252_c1
1385 nmdc:mga0a205_106701_c1
1386 nmdc:mga0a205_1171977_c1
1387 nmdc:mga0a205_15602_c1
1388 nmdc:mga0a205_3118_c1
1389 nmdc:mga0a205_491810_c1
1390 nmdc:mga0a205_69760_c2
1391 nmdc:mga0a205_926_c1
1392 Ga0495601_0074212
1393 Ga0495619_0020826
1394 Ga0495619_0144566
1395 Ga0495619_0732466
1396 Ga0501084_0010667
1397 Ga0501084_0018696
1398 Ga0501084_0020582
1399 Ga0501084_0348335
1400 Ga0501084_0599405
1401 Ga0501084_0646281
1402 Ga0501084_0816163
1403 Ga0590071_139658
1404 Ga0501082_0010491
1405 Ga0501082_0101360
1406 Ga0501082_0161741
1407 Ga0501082_0214139
1408 Ga0501082_0568641
1409 Ga0501082_0613275
1410 Ga0530510_0019241
1411 Ga0530510_0279967
1412 Ga0530510_0594610
1413 Ga0530510_0776608
1414 Ga0530510_1085711

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04143

Sulf_transp

Sulphur transport

18

138

0.89

PF20398

DUF6691

Family of unknown function (DUF6691)

1

135

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End Superfamily
af_Q9FWA6_497_619_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.3404 6 122 1.25.40.10
af_Q4DIR0_79_279_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.3321 22 118 1.25.40.10
1nf6F00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.2928 13 137 1.20.1260.10
af_Q9FWA6_497_619_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.2902 6 122 1.25.40.10
af_P19658_157_324_1.20.1310.30 Mainly Alpha;Up-down Bundle;5 helical Cullin repeat like; 0.2763 20 136 1.20.1310.30
ID Description Score Start End GO Terms
AF-A0A2H5ZQ11-F1-model_v4 Uncharacterized protein 0.7903 2 131 GO:0016020
AF-A0A2S6MXS1-F1-model_v4 Uncharacterized protein 0.7757 2 134 GO:0005886
AF-A0A432SPC1-F1-model_v4 Uncharacterized protein 0.7693 1 130 GO:0005886
AF-A0A838XUJ2-F1-model_v4 YeeE/YedE family protein 0.7653 2 135 GO:0005886
AF-A0A066ZP42-F1-model_v4 Uncharacterized protein 0.765 2 133 GO:0005886

Map