F476545
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 707 | 296 | 1414 | 136 |
Family's Representative Sequence
| Representative Sequence | 3300014326|Ga0157380_10863756|Ga0157380_108637562 |
| Length | 152 |
| Sequence | MNAVDSARGHSMRTITVIITGLAVLLSGAGTAIAHHSFAAEFDSTKPVSLQGVVTKMEWINPHSWIHLDVKNADGTVTKWMIEGGTPNTLVRRGFTKDSLKVGTEIRVEGFRAKNGANRANGRDLVLPDGKRLFLGSSGTGAPKDGRDPSDK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 2 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 3 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 4 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 5 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 6 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 52 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 53 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 54 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 55 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 56 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 57 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 58 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 59 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 64 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 65 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 66 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 67 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 68 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 69 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 70 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 71 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 72 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 74 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 75 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 76 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 89 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300019188 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE2 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 104 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 105 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 106 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 154 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 158 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 159 | 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 160 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 161 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 162 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 163 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 164 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 165 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 166 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 167 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 168 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 169 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 170 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 171 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 172 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 173 | 3300032120 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 174 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 175 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 176 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 177 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 178 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 179 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 180 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 181 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 182 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 183 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 184 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 185 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 186 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 187 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 188 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 189 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 190 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 191 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 192 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 193 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 194 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 195 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 196 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 197 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 198 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 199 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 200 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 201 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 202 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 203 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 204 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 205 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 206 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 207 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 208 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 209 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 210 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 211 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 251 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 252 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 253 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 254 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 255 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 256 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 257 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 258 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 259 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 260 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 261 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 262 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 294 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.73 |
| Metatranscriptomes | 1.27 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.14 |
| Nodule | 0 |
| Rhizoplane | 3.96 |
| Rhizosphere | 92.93 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 23.9 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0157380_10863756 | 3300014326 | Unclassified | 928 |
| 2 | JGI24743J22301_10127712 | 3300001991 | Unclassified | 560 |
| 3 | Ga0058859_11547489 | 3300004798 | Unclassified | 719 |
| 4 | Ga0058860_12144590 | 3300004801 | Unclassified | 750 |
| 5 | Ga0058862_12827608 | 3300004803 | Unclassified | 672 |
| 6 | Ga0058862_12841748 | 3300004803 | Bacteria | 1871 |
| 7 | Ga0065712_10068186 | 3300005290 | Bacteria | 13337 |
| 8 | Ga0065712_10353139 | 3300005290 | Bacteria | 785 |
| 9 | Ga0065715_10495466 | 3300005293 | Bacteria | 784 |
| 10 | Ga0065707_10257919 | 3300005295 | Bacteria | 1102 |
| 11 | Ga0070658_10557524 | 3300005327 | Bacteria | 992 |
| 12 | Ga0070676_10511361 | 3300005328 | Bacteria | 854 |
| 13 | Ga0070683_100159465 | 3300005329 | Bacteria | 2140 |
| 14 | Ga0070683_100464459 | 3300005329 | Unclassified | 1208 |
| 15 | Ga0070683_100486858 | 3300005329 | Bacteria | 1178 |
| 16 | Ga0070683_101455734 | 3300005329 | Bacteria | 658 |
| 17 | Ga0070690_100015296 | 3300005330 | Bacteria | 4574 |
| 18 | Ga0070670_100281425 | 3300005331 | Bacteria | 1452 |
| 19 | Ga0070670_101758835 | 3300005331 | Bacteria | 571 |
| 20 | Ga0070677_10330331 | 3300005333 | Bacteria | 784 |
| 21 | Ga0068869_100089643 | 3300005334 | Unclassified | 2310 |
| 22 | Ga0068869_100581786 | 3300005334 | Bacteria | 944 |
| 23 | Ga0070666_10056850 | 3300005335 | Bacteria | 2643 |
| 24 | Ga0070666_10197375 | 3300005335 | Bacteria | 1415 |
| 25 | Ga0070666_10434905 | 3300005335 | Bacteria | 946 |
| 26 | Ga0070666_11046732 | 3300005335 | Unclassified | 606 |
| 27 | Ga0070682_101230543 | 3300005337 | Unclassified | 633 |
| 28 | Ga0070682_101587716 | 3300005337 | Unclassified | 565 |
| 29 | Ga0068868_100014728 | 3300005338 | Bacteria | 5769 |
| 30 | Ga0068868_101145356 | 3300005338 | Bacteria | 717 |
| 31 | Ga0070660_100461806 | 3300005339 | Bacteria | 1054 |
| 32 | Ga0070689_100081212 | 3300005340 | Bacteria | 2545 |
| 33 | Ga0070689_102076563 | 3300005340 | Unclassified | 520 |
| 34 | Ga0070661_100874445 | 3300005344 | Unclassified | 741 |
| 35 | Ga0070668_100173191 | 3300005347 | Bacteria | 1758 |
| 36 | Ga0070668_101592023 | 3300005347 | Bacteria | 598 |
| 37 | Ga0070669_100018199 | 3300005353 | Bacteria | 5018 |
| 38 | Ga0070669_100158924 | 3300005353 | Bacteria | 1755 |
| 39 | Ga0070669_100833803 | 3300005353 | Unclassified | 785 |
| 40 | Ga0070675_100004550 | 3300005354 | Bacteria | 10588 |
| 41 | Ga0070675_100020502 | 3300005354 | Bacteria | 5274 |
| 42 | Ga0070675_100096550 | 3300005354 | Bacteria | 2483 |
| 43 | Ga0070675_100190229 | 3300005354 | Unclassified | 1778 |
| 44 | Ga0070675_101117276 | 3300005354 | Bacteria | 725 |
| 45 | Ga0070671_100037673 | 3300005355 | Bacteria | 4011 |
| 46 | Ga0070671_100088144 | 3300005355 | Bacteria | 2597 |
| 47 | Ga0070671_100914167 | 3300005355 | Bacteria | 767 |
| 48 | Ga0070671_101091366 | 3300005355 | Bacteria | 701 |
| 49 | Ga0070674_100017416 | 3300005356 | Bacteria | 4520 |
| 50 | Ga0070674_100632677 | 3300005356 | Bacteria | 908 |
| 51 | Ga0070674_100641587 | 3300005356 | Bacteria | 902 |
| 52 | Ga0070674_100996041 | 3300005356 | Bacteria | 735 |
| 53 | Ga0070673_101074385 | 3300005364 | Unclassified | 751 |
| 54 | Ga0070673_101326912 | 3300005364 | Bacteria | 676 |
| 55 | Ga0070688_100054435 | 3300005365 | Bacteria | 2506 |
| 56 | Ga0070688_100975801 | 3300005365 | Unclassified | 672 |
| 57 | Ga0070688_101342155 | 3300005365 | Unclassified | 578 |
| 58 | Ga0070703_10085358 | 3300005406 | Unclassified | 1084 |
| 59 | Ga0070713_100202348 | 3300005436 | Bacteria | 1794 |
| 60 | Ga0070713_100299102 | 3300005436 | Bacteria | 1481 |
| 61 | Ga0070713_100809956 | 3300005436 | Bacteria | 898 |
| 62 | Ga0070701_10883619 | 3300005438 | Bacteria | 616 |
| 63 | Ga0070711_100070201 | 3300005439 | Bacteria | 2466 |
| 64 | Ga0070711_100393474 | 3300005439 | Unclassified | 1123 |
| 65 | Ga0070711_100585793 | 3300005439 | Bacteria | 929 |
| 66 | Ga0070705_100764171 | 3300005440 | Unclassified | 765 |
| 67 | Ga0070708_100413415 | 3300005445 | Unclassified | 1272 |
| 68 | Ga0070663_100235633 | 3300005455 | Bacteria | 1443 |
| 69 | Ga0070678_100177199 | 3300005456 | Bacteria | 1742 |
| 70 | Ga0070678_100269575 | 3300005456 | Bacteria | 1435 |
| 71 | Ga0070678_101491158 | 3300005456 | Bacteria | 633 |
| 72 | Ga0070681_10052512 | 3300005458 | Unclassified | 4065 |
| 73 | Ga0070681_10179624 | 3300005458 | Unclassified | 2038 |
| 74 | Ga0070681_10522379 | 3300005458 | Unclassified | 1100 |
| 75 | Ga0068867_100045993 | 3300005459 | Bacteria | 3203 |
| 76 | Ga0068867_102241395 | 3300005459 | Unclassified | 519 |
| 77 | Ga0070685_10455532 | 3300005466 | Bacteria | 897 |
| 78 | Ga0070699_100493992 | 3300005518 | Bacteria | 1111 |
| 79 | Ga0070699_100842875 | 3300005518 | Unclassified | 839 |
| 80 | Ga0070699_101660652 | 3300005518 | Bacteria | 585 |
| 81 | Ga0070684_100446974 | 3300005535 | Bacteria | 1194 |
| 82 | Ga0070684_100488292 | 3300005535 | Unclassified | 1140 |
| 83 | Ga0070697_100047066 | 3300005536 | Bacteria | 3498 |
| 84 | Ga0068853_100195466 | 3300005539 | Bacteria | 1839 |
| 85 | Ga0068853_100428954 | 3300005539 | Bacteria | 1241 |
| 86 | Ga0068853_101180170 | 3300005539 | Unclassified | 739 |
| 87 | Ga0070672_100819038 | 3300005543 | Bacteria | 820 |
| 88 | Ga0070672_100877228 | 3300005543 | Bacteria | 792 |
| 89 | Ga0070665_100333317 | 3300005548 | Bacteria | 1522 |
| 90 | Ga0070665_100561398 | 3300005548 | Bacteria | 1154 |
| 91 | Ga0068855_100001733 | 3300005563 | Bacteria | 27220 |
| 92 | Ga0068855_100062911 | 3300005563 | Bacteria | 4331 |
| 93 | Ga0068855_100154677 | 3300005563 | Bacteria | 2606 |
| 94 | Ga0068855_100407513 | 3300005563 | Unclassified | 1489 |
| 95 | Ga0068855_100809441 | 3300005563 | Unclassified | 995 |
| 96 | Ga0070664_101192026 | 3300005564 | Bacteria | 718 |
| 97 | Ga0070664_101423273 | 3300005564 | Unclassified | 655 |
| 98 | Ga0068857_100002727 | 3300005577 | Bacteria | 14490 |
| 99 | Ga0068857_100003583 | 3300005577 | Bacteria | 12991 |
| 100 | Ga0068857_100101545 | 3300005577 | Bacteria | 2581 |
| 101 | Ga0068857_102499806 | 3300005577 | Unclassified | 507 |
| 102 | Ga0068856_100004088 | 3300005614 | Bacteria | 14583 |
| 103 | Ga0068856_100017451 | 3300005614 | Bacteria | 6954 |
| 104 | Ga0068856_100034816 | 3300005614 | Bacteria | 4934 |
| 105 | Ga0068856_100353515 | 3300005614 | Bacteria | 1488 |
| 106 | Ga0070702_101557164 | 3300005615 | Unclassified | 545 |
| 107 | Ga0068859_100025969 | 3300005617 | Bacteria | 5876 |
| 108 | Ga0068859_100087789 | 3300005617 | Bacteria | 3159 |
| 109 | Ga0068859_100613346 | 3300005617 | Bacteria | 1181 |
| 110 | Ga0068859_100809629 | 3300005617 | Bacteria | 1024 |
| 111 | Ga0068859_102783497 | 3300005617 | Unclassified | 537 |
| 112 | Ga0068864_100001500 | 3300005618 | Bacteria | 19242 |
| 113 | Ga0068864_100149681 | 3300005618 | Unclassified | 2113 |
| 114 | Ga0068864_100590589 | 3300005618 | Bacteria | 1077 |
| 115 | Ga0068866_10490495 | 3300005718 | Bacteria | 811 |
| 116 | Ga0068866_10602723 | 3300005718 | Bacteria | 742 |
| 117 | Ga0068861_100023381 | 3300005719 | Bacteria | 4456 |
| 118 | Ga0068861_100231580 | 3300005719 | Bacteria | 1567 |
| 119 | Ga0068861_101599022 | 3300005719 | Unclassified | 642 |
| 120 | Ga0068861_101736901 | 3300005719 | Bacteria | 618 |
| 121 | Ga0068863_100019107 | 3300005841 | Bacteria | 6559 |
| 122 | Ga0068863_100035530 | 3300005841 | Bacteria | 4747 |
| 123 | Ga0068863_100068603 | 3300005841 | Bacteria | 3354 |
| 124 | Ga0068863_100494393 | 3300005841 | Bacteria | 1204 |
| 125 | Ga0068863_100649022 | 3300005841 | Bacteria | 1047 |
| 126 | Ga0068863_100920657 | 3300005841 | Bacteria | 875 |
| 127 | Ga0068863_101524604 | 3300005841 | Bacteria | 677 |
| 128 | Ga0068858_100009936 | 3300005842 | Bacteria | 9039 |
| 129 | Ga0068858_100068244 | 3300005842 | Unclassified | 3294 |
| 130 | Ga0068858_100127205 | 3300005842 | Bacteria | 2387 |
| 131 | Ga0068858_100192462 | 3300005842 | Bacteria | 1927 |
| 132 | Ga0068858_100494363 | 3300005842 | Bacteria | 1181 |
| 133 | Ga0068858_100547860 | 3300005842 | Bacteria | 1120 |
| 134 | Ga0068858_101151376 | 3300005842 | Bacteria | 762 |
| 135 | Ga0068858_102308920 | 3300005842 | Unclassified | 532 |
| 136 | Ga0068860_100038493 | 3300005843 | Bacteria | 4575 |
| 137 | Ga0068860_100038598 | 3300005843 | Bacteria | 4568 |
| 138 | Ga0068860_100112679 | 3300005843 | Unclassified | 2601 |
| 139 | Ga0068860_100171880 | 3300005843 | Unclassified | 2093 |
| 140 | Ga0068860_100648112 | 3300005843 | Bacteria | 1064 |
| 141 | Ga0068862_100616971 | 3300005844 | Unclassified | 1043 |
| 142 | Ga0068862_101815921 | 3300005844 | Bacteria | 619 |
| 143 | Ga0070717_10181253 | 3300006028 | Bacteria | 1836 |
| 144 | Ga0070717_10551059 | 3300006028 | Unclassified | 1044 |
| 145 | Ga0070715_10596561 | 3300006163 | Bacteria | 647 |
| 146 | Ga0070716_100139210 | 3300006173 | Bacteria | 1545 |
| 147 | Ga0097621_100019829 | 3300006237 | Bacteria | 5171 |
| 148 | Ga0097621_100068356 | 3300006237 | Bacteria | 2930 |
| 149 | Ga0097621_100093094 | 3300006237 | Bacteria | 2525 |
| 150 | Ga0097621_100179893 | 3300006237 | Bacteria | 1827 |
| 151 | Ga0097621_100200956 | 3300006237 | Bacteria | 1730 |
| 152 | Ga0068871_100003608 | 3300006358 | Bacteria | 10632 |
| 153 | Ga0068871_100028832 | 3300006358 | Bacteria | 4356 |
| 154 | Ga0068871_100047174 | 3300006358 | Bacteria | 3473 |
| 155 | Ga0068871_100186930 | 3300006358 | Bacteria | 1783 |
| 156 | Ga0068871_100575354 | 3300006358 | Bacteria | 1022 |
| 157 | Ga0068871_101247710 | 3300006358 | Unclassified | 698 |
| 158 | Ga0075428_100047248 | 3300006844 | Bacteria | 4728 |
| 159 | Ga0075428_101115230 | 3300006844 | Bacteria | 833 |
| 160 | Ga0075430_100011998 | 3300006846 | Bacteria | 7373 |
| 161 | Ga0075430_100063327 | 3300006846 | Bacteria | 3106 |
| 162 | Ga0075430_100157739 | 3300006846 | Unclassified | 1889 |
| 163 | Ga0075431_100015251 | 3300006847 | Bacteria | 7788 |
| 164 | Ga0075431_100057610 | 3300006847 | Bacteria | 4008 |
| 165 | Ga0075433_10548518 | 3300006852 | Bacteria | 1016 |
| 166 | Ga0075434_100516462 | 3300006871 | Bacteria | 1215 |
| 167 | Ga0075429_100072558 | 3300006880 | Bacteria | 2998 |
| 168 | Ga0075429_100129733 | 3300006880 | Bacteria | 2205 |
| 169 | Ga0068865_100222862 | 3300006881 | Bacteria | 1475 |
| 170 | Ga0075436_100274034 | 3300006914 | Bacteria | 1205 |
| 171 | Ga0097620_100025969 | 3300006931 | Bacteria | 5876 |
| 172 | Ga0097620_100087789 | 3300006931 | Bacteria | 3159 |
| 173 | Ga0097620_100613347 | 3300006931 | Bacteria | 1181 |
| 174 | Ga0097620_100809529 | 3300006931 | Bacteria | 1024 |
| 175 | Ga0097620_102784060 | 3300006931 | Unclassified | 537 |
| 176 | Ga0075435_100041151 | 3300007076 | Bacteria | 3693 |
| 177 | Ga0099794_10488507 | 3300007265 | Bacteria | 647 |
| 178 | Ga0099795_10200230 | 3300007788 | Bacteria | 842 |
| 179 | Ga0105240_10002654 | 3300009093 | Bacteria | 28457 |
| 180 | Ga0105240_10197379 | 3300009093 | Unclassified | 2361 |
| 181 | Ga0105240_10384330 | 3300009093 | Bacteria | 1584 |
| 182 | Ga0105240_11899005 | 3300009093 | Bacteria | 620 |
| 183 | Ga0111539_10017785 | 3300009094 | Bacteria | 8801 |
| 184 | Ga0111539_10025546 | 3300009094 | Bacteria | 7241 |
| 185 | Ga0105245_10006384 | 3300009098 | Bacteria | 10373 |
| 186 | Ga0105245_10011243 | 3300009098 | Bacteria | 7793 |
| 187 | Ga0105245_10057554 | 3300009098 | Bacteria | 3497 |
| 188 | Ga0105245_10109654 | 3300009098 | Bacteria | 2565 |
| 189 | Ga0105245_10191773 | 3300009098 | Bacteria | 1958 |
| 190 | Ga0105245_10311737 | 3300009098 | Unclassified | 1547 |
| 191 | Ga0105245_10469327 | 3300009098 | Bacteria | 1270 |
| 192 | Ga0105245_10656773 | 3300009098 | Unclassified | 1079 |
| 193 | Ga0105245_10955408 | 3300009098 | Unclassified | 900 |
| 194 | Ga0105247_10073018 | 3300009101 | Bacteria | 2149 |
| 195 | Ga0105247_10079636 | 3300009101 | Bacteria | 2062 |
| 196 | Ga0105247_11296434 | 3300009101 | Bacteria | 585 |
| 197 | Ga0114129_10161846 | 3300009147 | Bacteria | 3056 |
| 198 | Ga0114129_10181891 | 3300009147 | Bacteria | 2860 |
| 199 | Ga0114129_10202495 | 3300009147 | Bacteria | 2688 |
| 200 | Ga0105243_10054742 | 3300009148 | Bacteria | 3168 |
| 201 | Ga0105243_10089003 | 3300009148 | Unclassified | 2537 |
| 202 | Ga0105243_10107213 | 3300009148 | Bacteria | 2330 |
| 203 | Ga0105243_10581353 | 3300009148 | Bacteria | 1075 |
| 204 | Ga0105243_10968226 | 3300009148 | Bacteria | 851 |
| 205 | Ga0105241_10031242 | 3300009174 | Bacteria | 3987 |
| 206 | Ga0105241_10037061 | 3300009174 | Bacteria | 3673 |
| 207 | Ga0105241_10039911 | 3300009174 | Bacteria | 3542 |
| 208 | Ga0105241_10110444 | 3300009174 | Bacteria | 2200 |
| 209 | Ga0105241_10267709 | 3300009174 | Bacteria | 1454 |
| 210 | Ga0105241_10275327 | 3300009174 | Unclassified | 1435 |
| 211 | Ga0105242_10004936 | 3300009176 | Bacteria | 10332 |
| 212 | Ga0105242_10016108 | 3300009176 | Bacteria | 5808 |
| 213 | Ga0105242_10020384 | 3300009176 | Bacteria | 5198 |
| 214 | Ga0105242_10190195 | 3300009176 | Bacteria | 1817 |
| 215 | Ga0105242_10368641 | 3300009176 | Bacteria | 1331 |
| 216 | Ga0105242_10506306 | 3300009176 | Bacteria | 1149 |
| 217 | Ga0105242_10907025 | 3300009176 | Bacteria | 882 |
| 218 | Ga0105248_10052752 | 3300009177 | Bacteria | 4563 |
| 219 | Ga0105248_10062297 | 3300009177 | Unclassified | 4189 |
| 220 | Ga0105248_10078102 | 3300009177 | Bacteria | 3722 |
| 221 | Ga0105248_10127069 | 3300009177 | Bacteria | 2876 |
| 222 | Ga0105248_10275980 | 3300009177 | Bacteria | 1893 |
| 223 | Ga0105248_10309287 | 3300009177 | Bacteria | 1780 |
| 224 | Ga0105248_10410754 | 3300009177 | Bacteria | 1524 |
| 225 | Ga0105248_10566672 | 3300009177 | Unclassified | 1281 |
| 226 | Ga0105248_11033163 | 3300009177 | Bacteria | 928 |
| 227 | Ga0105248_11247753 | 3300009177 | Bacteria | 840 |
| 228 | Ga0105248_11264047 | 3300009177 | Bacteria | 835 |
| 229 | Ga0105248_11691770 | 3300009177 | Unclassified | 717 |
| 230 | Ga0105248_13108584 | 3300009177 | Bacteria | 528 |
| 231 | Ga0105237_10007273 | 3300009545 | Bacteria | 12148 |
| 232 | Ga0105237_10042107 | 3300009545 | Bacteria | 4606 |
| 233 | Ga0105237_10077876 | 3300009545 | Bacteria | 3305 |
| 234 | Ga0105237_10485522 | 3300009545 | Bacteria | 1242 |
| 235 | Ga0105238_10017209 | 3300009551 | Bacteria | 7343 |
| 236 | Ga0105238_10080688 | 3300009551 | Bacteria | 3242 |
| 237 | Ga0105238_10086701 | 3300009551 | Unclassified | 3118 |
| 238 | Ga0105238_10580577 | 3300009551 | Bacteria | 1127 |
| 239 | Ga0105238_12168502 | 3300009551 | Bacteria | 590 |
| 240 | Ga0105249_12133420 | 3300009553 | Bacteria | 633 |
| 241 | Ga0099796_10258889 | 3300010159 | Unclassified | 725 |
| 242 | Ga0099796_10414736 | 3300010159 | Bacteria | 593 |
| 243 | Ga0105239_10005545 | 3300010375 | Bacteria | 14772 |
| 244 | Ga0105239_10019309 | 3300010375 | Bacteria | 7527 |
| 245 | Ga0105239_10656201 | 3300010375 | Bacteria | 1198 |
| 246 | Ga0105239_10881321 | 3300010375 | Bacteria | 1027 |
| 247 | Ga0105246_10010641 | 3300011119 | Bacteria | 5699 |
| 248 | Ga0105246_11260429 | 3300011119 | Unclassified | 683 |
| 249 | Ga0105246_12060143 | 3300011119 | Bacteria | 552 |
| 250 | Ga0157370_10005685 | 3300013104 | Bacteria | 13939 |
| 251 | Ga0157370_10074105 | 3300013104 | Bacteria | 3211 |
| 252 | Ga0157370_11164208 | 3300013104 | Unclassified | 696 |
| 253 | Ga0157369_10244844 | 3300013105 | Bacteria | 1872 |
| 254 | Ga0157374_10069175 | 3300013296 | Bacteria | 3324 |
| 255 | Ga0157374_10457585 | 3300013296 | Bacteria | 1278 |
| 256 | Ga0157374_10467567 | 3300013296 | Bacteria | 1263 |
| 257 | Ga0157374_10719158 | 3300013296 | Bacteria | 1012 |
| 258 | Ga0157378_10002294 | 3300013297 | Bacteria | 17000 |
| 259 | Ga0157378_10168657 | 3300013297 | Bacteria | 2051 |
| 260 | Ga0157378_10432027 | 3300013297 | Unclassified | 1303 |
| 261 | Ga0157378_10531830 | 3300013297 | Bacteria | 1178 |
| 262 | Ga0157378_10623175 | 3300013297 | Bacteria | 1092 |
| 263 | Ga0157378_10858294 | 3300013297 | Unclassified | 936 |
| 264 | Ga0157378_11290077 | 3300013297 | Unclassified | 771 |
| 265 | Ga0163162_10157024 | 3300013306 | Bacteria | 2395 |
| 266 | Ga0163162_10637291 | 3300013306 | Bacteria | 1190 |
| 267 | Ga0163162_11579011 | 3300013306 | Bacteria | 748 |
| 268 | Ga0163162_11655021 | 3300013306 | Unclassified | 731 |
| 269 | Ga0157372_10213724 | 3300013307 | Bacteria | 2235 |
| 270 | Ga0157372_10325243 | 3300013307 | Unclassified | 1790 |
| 271 | Ga0157375_10296473 | 3300013308 | Unclassified | 1780 |
| 272 | Ga0157375_10644002 | 3300013308 | Bacteria | 1216 |
| 273 | Ga0157375_10660451 | 3300013308 | Bacteria | 1201 |
| 274 | Ga0157375_10959143 | 3300013308 | Unclassified | 997 |
| 275 | Ga0157375_11042635 | 3300013308 | Unclassified | 956 |
| 276 | Ga0157375_11462175 | 3300013308 | Bacteria | 806 |
| 277 | Ga0157375_13480772 | 3300013308 | Unclassified | 524 |
| 278 | Ga0163163_10000335 | 3300014325 | Bacteria | 45290 |
| 279 | Ga0163163_10003599 | 3300014325 | Bacteria | 13163 |
| 280 | Ga0163163_10008622 | 3300014325 | Bacteria | 9066 |
| 281 | Ga0163163_10009332 | 3300014325 | Bacteria | 8754 |
| 282 | Ga0163163_10074157 | 3300014325 | Bacteria | 3394 |
| 283 | Ga0163163_10200863 | 3300014325 | Bacteria | 2042 |
| 284 | Ga0163163_10263768 | 3300014325 | Bacteria | 1774 |
| 285 | Ga0163163_10845413 | 3300014325 | Bacteria | 979 |
| 286 | Ga0157380_10126861 | 3300014326 | Bacteria | 2170 |
| 287 | Ga0157380_10242370 | 3300014326 | Bacteria | 1626 |
| 288 | Ga0157380_10903748 | 3300014326 | Bacteria | 909 |
| 289 | Ga0157380_10960317 | 3300014326 | Unclassified | 885 |
| 290 | Ga0157377_10266017 | 3300014745 | Bacteria | 1118 |
| 291 | Ga0157379_10006591 | 3300014968 | Bacteria | 10023 |
| 292 | Ga0157379_10009854 | 3300014968 | Bacteria | 8326 |
| 293 | Ga0157379_10029985 | 3300014968 | Bacteria | 4837 |
| 294 | Ga0157379_10177756 | 3300014968 | Bacteria | 1922 |
| 295 | Ga0157379_10406050 | 3300014968 | Bacteria | 1253 |
| 296 | Ga0157379_10432590 | 3300014968 | Bacteria | 1213 |
| 297 | Ga0157379_10522777 | 3300014968 | Bacteria | 1102 |
| 298 | Ga0157379_10538044 | 3300014968 | Unclassified | 1086 |
| 299 | Ga0157379_10843967 | 3300014968 | Bacteria | 866 |
| 300 | Ga0157379_11161685 | 3300014968 | Unclassified | 741 |
| 301 | Ga0157376_10002397 | 3300014969 | Bacteria | 12659 |
| 302 | Ga0157376_10176725 | 3300014969 | Bacteria | 1948 |
| 303 | Ga0157376_10204365 | 3300014969 | Bacteria | 1820 |
| 304 | Ga0157376_10380985 | 3300014969 | Bacteria | 1359 |
| 305 | Ga0157376_10455452 | 3300014969 | Bacteria | 1249 |
| 306 | Ga0157376_10577145 | 3300014969 | Bacteria | 1116 |
| 307 | Ga0157376_10754389 | 3300014969 | Unclassified | 982 |
| 308 | Ga0163161_10774437 | 3300017792 | Bacteria | 804 |
| 309 | Ga0184599_119678 | 3300019188 | Unclassified | 674 |
| 310 | Ga0213876_10194170 | 3300021384 | Bacteria | 1079 |
| 311 | Ga0213875_10005308 | 3300021388 | Bacteria | 6931 |
| 312 | Ga0213875_10014846 | 3300021388 | Unclassified | 3796 |
| 313 | Ga0213875_10017533 | 3300021388 | Bacteria | 3457 |
| 314 | Ga0213875_10032502 | 3300021388 | Bacteria | 2466 |
| 315 | Ga0213875_10058045 | 3300021388 | Bacteria | 1812 |
| 316 | Ga0213875_10286644 | 3300021388 | Unclassified | 778 |
| 317 | Ga0207642_10413878 | 3300025899 | Bacteria | 809 |
| 318 | Ga0207710_10022700 | 3300025900 | Bacteria | 2693 |
| 319 | Ga0207710_10037821 | 3300025900 | Unclassified | 2133 |
| 320 | Ga0207710_10049079 | 3300025900 | Bacteria | 1890 |
| 321 | Ga0207680_10083452 | 3300025903 | Bacteria | 2014 |
| 322 | Ga0207680_10569964 | 3300025903 | Bacteria | 809 |
| 323 | Ga0207680_10950848 | 3300025903 | Unclassified | 616 |
| 324 | Ga0207699_10272349 | 3300025906 | Bacteria | 1174 |
| 325 | Ga0207699_10332190 | 3300025906 | Bacteria | 1069 |
| 326 | Ga0207645_10147242 | 3300025907 | Archaea | 1536 |
| 327 | Ga0207643_10319099 | 3300025908 | Unclassified | 970 |
| 328 | Ga0207654_10008274 | 3300025911 | Bacteria | 5252 |
| 329 | Ga0207654_10014623 | 3300025911 | Bacteria | 4057 |
| 330 | Ga0207654_10016503 | 3300025911 | Bacteria | 3846 |
| 331 | Ga0207654_10186474 | 3300025911 | Bacteria | 1356 |
| 332 | Ga0207654_10189863 | 3300025911 | Bacteria | 1346 |
| 333 | Ga0207707_10019292 | 3300025912 | Bacteria | 5950 |
| 334 | Ga0207707_10154899 | 3300025912 | Unclassified | 2004 |
| 335 | Ga0207695_10001831 | 3300025913 | Bacteria | 33414 |
| 336 | Ga0207695_10024176 | 3300025913 | Bacteria | 6844 |
| 337 | Ga0207695_10088726 | 3300025913 | Bacteria | 3112 |
| 338 | Ga0207671_10041835 | 3300025914 | Bacteria | 3392 |
| 339 | Ga0207671_10278320 | 3300025914 | Bacteria | 1319 |
| 340 | Ga0207663_10125415 | 3300025916 | Bacteria | 1765 |
| 341 | Ga0207663_10518942 | 3300025916 | Bacteria | 928 |
| 342 | Ga0207663_10624215 | 3300025916 | Bacteria | 849 |
| 343 | Ga0207681_10027675 | 3300025923 | Bacteria | 3668 |
| 344 | Ga0207681_10466117 | 3300025923 | Bacteria | 1030 |
| 345 | Ga0207694_10001340 | 3300025924 | Bacteria | 21217 |
| 346 | Ga0207694_10025836 | 3300025924 | Bacteria | 4465 |
| 347 | Ga0207694_10585184 | 3300025924 | Bacteria | 938 |
| 348 | Ga0207694_10781435 | 3300025924 | Unclassified | 806 |
| 349 | Ga0207650_11363980 | 3300025925 | Bacteria | 603 |
| 350 | Ga0207659_10001498 | 3300025926 | Bacteria | 13921 |
| 351 | Ga0207659_10207982 | 3300025926 | Bacteria | 1567 |
| 352 | Ga0207687_10007444 | 3300025927 | Bacteria | 7208 |
| 353 | Ga0207687_10008910 | 3300025927 | Bacteria | 6558 |
| 354 | Ga0207687_10076245 | 3300025927 | Bacteria | 2408 |
| 355 | Ga0207687_10111280 | 3300025927 | Unclassified | 2033 |
| 356 | Ga0207700_10586530 | 3300025928 | Bacteria | 991 |
| 357 | Ga0207644_10042011 | 3300025931 | Bacteria | 3238 |
| 358 | Ga0207644_10744653 | 3300025931 | Bacteria | 818 |
| 359 | Ga0207690_11612085 | 3300025932 | Unclassified | 542 |
| 360 | Ga0207686_10002390 | 3300025934 | Bacteria | 10241 |
| 361 | Ga0207686_10033591 | 3300025934 | Bacteria | 3064 |
| 362 | Ga0207686_10174912 | 3300025934 | Bacteria | 1517 |
| 363 | Ga0207686_10481552 | 3300025934 | Bacteria | 960 |
| 364 | Ga0207686_10539479 | 3300025934 | Unclassified | 910 |
| 365 | Ga0207686_10848676 | 3300025934 | Bacteria | 735 |
| 366 | Ga0207686_11670116 | 3300025934 | Bacteria | 526 |
| 367 | Ga0207709_10784115 | 3300025935 | Unclassified | 768 |
| 368 | Ga0207709_11119458 | 3300025935 | Bacteria | 647 |
| 369 | Ga0207670_10236409 | 3300025936 | Bacteria | 1405 |
| 370 | Ga0207670_10299550 | 3300025936 | Unclassified | 1259 |
| 371 | Ga0207670_10881642 | 3300025936 | Unclassified | 749 |
| 372 | Ga0207670_11101614 | 3300025936 | Bacteria | 670 |
| 373 | Ga0207669_10915248 | 3300025937 | Bacteria | 733 |
| 374 | Ga0207704_10140079 | 3300025938 | Bacteria | 1690 |
| 375 | Ga0207665_10203999 | 3300025939 | Bacteria | 1442 |
| 376 | Ga0207691_10103296 | 3300025940 | Bacteria | 2541 |
| 377 | Ga0207691_10443188 | 3300025940 | Bacteria | 1105 |
| 378 | Ga0207711_10037569 | 3300025941 | Unclassified | 4115 |
| 379 | Ga0207711_10124474 | 3300025941 | Bacteria | 2305 |
| 380 | Ga0207711_10135865 | 3300025941 | Bacteria | 2208 |
| 381 | Ga0207711_10263481 | 3300025941 | Unclassified | 1585 |
| 382 | Ga0207711_10390175 | 3300025941 | Bacteria | 1293 |
| 383 | Ga0207711_10948731 | 3300025941 | Bacteria | 799 |
| 384 | Ga0207711_10988221 | 3300025941 | Bacteria | 781 |
| 385 | Ga0207711_11136993 | 3300025941 | Bacteria | 722 |
| 386 | Ga0207711_11489534 | 3300025941 | Bacteria | 620 |
| 387 | Ga0207711_11554414 | 3300025941 | Bacteria | 605 |
| 388 | Ga0207689_10367381 | 3300025942 | Unclassified | 1197 |
| 389 | Ga0207689_10575352 | 3300025942 | Unclassified | 947 |
| 390 | Ga0207661_10142325 | 3300025944 | Bacteria | 2065 |
| 391 | Ga0207661_10331694 | 3300025944 | Bacteria | 1369 |
| 392 | Ga0207679_10083062 | 3300025945 | Bacteria | 2454 |
| 393 | Ga0207667_10002284 | 3300025949 | Bacteria | 24089 |
| 394 | Ga0207667_10132185 | 3300025949 | Bacteria | 2571 |
| 395 | Ga0207667_10240287 | 3300025949 | Bacteria | 1854 |
| 396 | Ga0207667_10388547 | 3300025949 | Bacteria | 1421 |
| 397 | Ga0207667_10618068 | 3300025949 | Unclassified | 1091 |
| 398 | Ga0207640_10829120 | 3300025981 | Bacteria | 803 |
| 399 | Ga0207658_10635916 | 3300025986 | Bacteria | 961 |
| 400 | Ga0207658_10908769 | 3300025986 | Bacteria | 802 |
| 401 | Ga0207677_10008232 | 3300026023 | Bacteria | 5812 |
| 402 | Ga0207677_10259843 | 3300026023 | Bacteria | 1415 |
| 403 | Ga0207677_10666996 | 3300026023 | Bacteria | 919 |
| 404 | Ga0207703_10009029 | 3300026035 | Bacteria | 7851 |
| 405 | Ga0207703_10009926 | 3300026035 | Bacteria | 7469 |
| 406 | Ga0207703_10157766 | 3300026035 | Bacteria | 1985 |
| 407 | Ga0207703_10168167 | 3300026035 | Unclassified | 1926 |
| 408 | Ga0207703_10271387 | 3300026035 | Bacteria | 1537 |
| 409 | Ga0207703_10600227 | 3300026035 | Bacteria | 1041 |
| 410 | Ga0207703_11877564 | 3300026035 | Bacteria | 575 |
| 411 | Ga0207639_10210846 | 3300026041 | Bacteria | 1672 |
| 412 | Ga0207678_10855431 | 3300026067 | Bacteria | 804 |
| 413 | Ga0207708_10002543 | 3300026075 | Bacteria | 13415 |
| 414 | Ga0207708_10852275 | 3300026075 | Unclassified | 787 |
| 415 | Ga0207702_10006565 | 3300026078 | Bacteria | 10003 |
| 416 | Ga0207702_10030592 | 3300026078 | Unclassified | 4485 |
| 417 | Ga0207702_10082607 | 3300026078 | Bacteria | 2794 |
| 418 | Ga0207641_10010218 | 3300026088 | Bacteria | 7719 |
| 419 | Ga0207641_10256845 | 3300026088 | Bacteria | 1634 |
| 420 | Ga0207641_10296533 | 3300026088 | Bacteria | 1526 |
| 421 | Ga0207641_10465905 | 3300026088 | Bacteria | 1223 |
| 422 | Ga0207648_10021798 | 3300026089 | Bacteria | 5756 |
| 423 | Ga0207648_10222627 | 3300026089 | Unclassified | 1677 |
| 424 | Ga0207648_10231586 | 3300026089 | Unclassified | 1643 |
| 425 | Ga0207648_10502576 | 3300026089 | Bacteria | 1109 |
| 426 | Ga0207648_10794992 | 3300026089 | Bacteria | 880 |
| 427 | Ga0207676_10064022 | 3300026095 | Bacteria | 2922 |
| 428 | Ga0207676_10144052 | 3300026095 | Unclassified | 2044 |
| 429 | Ga0207674_10003879 | 3300026116 | Bacteria | 18231 |
| 430 | Ga0207674_10066551 | 3300026116 | Bacteria | 3629 |
| 431 | Ga0207675_100106463 | 3300026118 | Unclassified | 2644 |
| 432 | Ga0207675_100266881 | 3300026118 | Bacteria | 1660 |
| 433 | Ga0207675_100410907 | 3300026118 | Unclassified | 1335 |
| 434 | Ga0207675_101643934 | 3300026118 | Bacteria | 662 |
| 435 | Ga0207683_10200905 | 3300026121 | Bacteria | 1812 |
| 436 | Ga0207683_10292903 | 3300026121 | Bacteria | 1488 |
| 437 | Ga0210000_1038920 | 3300027462 | Unclassified | 752 |
| 438 | Ga0209974_10275489 | 3300027876 | Unclassified | 639 |
| 439 | Ga0207428_10176002 | 3300027907 | Bacteria | 1618 |
| 440 | Ga0268266_10437937 | 3300028379 | Bacteria | 1241 |
| 441 | Ga0268266_10449845 | 3300028379 | Bacteria | 1224 |
| 442 | Ga0268266_10947042 | 3300028379 | Bacteria | 833 |
| 443 | Ga0268265_10242350 | 3300028380 | Bacteria | 1592 |
| 444 | Ga0268265_10397397 | 3300028380 | Bacteria | 1273 |
| 445 | Ga0268265_11933348 | 3300028380 | Unclassified | 597 |
| 446 | Ga0268264_10127214 | 3300028381 | Bacteria | 2254 |
| 447 | Ga0268264_10506050 | 3300028381 | Bacteria | 1179 |
| 448 | Ga0268264_10834302 | 3300028381 | Bacteria | 922 |
| 449 | Ga0268264_11323579 | 3300028381 | Unclassified | 731 |
| 450 | Ga0265322_10098231 | 3300028654 | Unclassified | 833 |
| 451 | Ga0265338_10535244 | 3300028800 | Bacteria | 822 |
| 452 | Ga0265766_1021483 | 3300030863 | Unclassified | 534 |
| 453 | Ga0265332_10352325 | 3300031238 | Unclassified | 607 |
| 454 | Ga0265328_10064828 | 3300031239 | Bacteria | 1342 |
| 455 | Ga0265339_10153668 | 3300031249 | Bacteria | 1162 |
| 456 | Ga0265331_10412052 | 3300031250 | Unclassified | 606 |
| 457 | Ga0307408_101886436 | 3300031548 | Bacteria | 573 |
| 458 | Ga0265314_10000373 | 3300031711 | Bacteria | 61369 |
| 459 | Ga0265342_10064848 | 3300031712 | Bacteria | 2142 |
| 460 | Ga0307405_10446570 | 3300031731 | Unclassified | 1024 |
| 461 | Ga0307413_10548519 | 3300031824 | Bacteria | 937 |
| 462 | Ga0307406_10239251 | 3300031901 | Bacteria | 1361 |
| 463 | Ga0307409_100647663 | 3300031995 | Bacteria | 1050 |
| 464 | Ga0307416_102589758 | 3300032002 | Unclassified | 605 |
| 465 | Ga0307411_10094624 | 3300032005 | Archaea | 2095 |
| 466 | Ga0316053_103706 | 3300032120 | Bacteria | 917 |
| 467 | Ga0307415_100288238 | 3300032126 | Bacteria | 1354 |
| 468 | Ga0373926_0141225 | 3300035083 | Bacteria | 915 |
| 469 | Ga0373926_0422991 | 3300035083 | Unclassified | 527 |
| 470 | Ga0373934_0044115 | 3300035086 | Bacteria | 1762 |
| 471 | Ga0373934_0085935 | 3300035086 | Bacteria | 1266 |
| 472 | Ga0373951_0153924 | 3300035091 | Unclassified | 646 |
| 473 | Ga0373923_0123014 | 3300035111 | Bacteria | 1161 |
| 474 | Ga0373936_0096620 | 3300035113 | Bacteria | 1243 |
| 475 | Ga0373936_0118052 | 3300035113 | Bacteria | 1131 |
| 476 | Ga0373936_0397343 | 3300035113 | Bacteria | 632 |
| 477 | Ga0373945_0035055 | 3300035116 | Bacteria | 1792 |
| 478 | Ga0373945_0258824 | 3300035116 | Bacteria | 737 |
| 479 | Ga0373954_0393916 | 3300035118 | Unclassified | 685 |
| 480 | Ga0373956_0048818 | 3300035119 | Bacteria | 1897 |
| 481 | Ga0373956_0150559 | 3300035119 | Bacteria | 1095 |
| 482 | Ga0373956_0170606 | 3300035119 | Bacteria | 1027 |
| 483 | Ga0373956_0229852 | 3300035119 | Unclassified | 881 |
| 484 | Ga0373956_0292651 | 3300035119 | Bacteria | 775 |
| 485 | Ga0373956_0490973 | 3300035119 | Bacteria | 586 |
| 486 | Ga0373957_0108810 | 3300035120 | Bacteria | 1115 |
| 487 | Ga0373957_0119475 | 3300035120 | Unclassified | 1066 |
| 488 | Ga0373943_0027769 | 3300035170 | Bacteria | 2662 |
| 489 | Ga0373943_0494209 | 3300035170 | Bacteria | 714 |
| 490 | Ga0373946_0066739 | 3300035171 | Bacteria | 1543 |
| 491 | Ga0373946_0604935 | 3300035171 | Bacteria | 569 |
| 492 | Ga0373946_0754587 | 3300035171 | Unclassified | 511 |
| 493 | Ga0373955_0119596 | 3300035172 | Bacteria | 1530 |
| 494 | Ga0373955_0147054 | 3300035172 | Unclassified | 1385 |
| 495 | Ga0373955_0170191 | 3300035172 | Bacteria | 1289 |
| 496 | Ga0373955_0381947 | 3300035172 | Unclassified | 855 |
| 497 | Ga0373955_0959011 | 3300035172 | Unclassified | 526 |
| 498 | Ga0373924_0006729 | 3300035410 | Bacteria | 4128 |
| 499 | Ga0373935_0235228 | 3300035692 | Bacteria | 1277 |
| 500 | Ga0373927_0066964 | 3300035695 | Bacteria | 2324 |
| 501 | Ga0373927_0069353 | 3300035695 | Bacteria | 2282 |
| 502 | Ga0373927_0160132 | 3300035695 | Bacteria | 1474 |
| 503 | Ga0373927_0488128 | 3300035695 | Bacteria | 814 |
| 504 | Ga0373933_0022280 | 3300035724 | Bacteria | 3606 |
| 505 | Ga0373933_0129743 | 3300035724 | Bacteria | 1584 |
| 506 | Ga0373933_0236110 | 3300035724 | Bacteria | 1175 |
| 507 | Ga0373933_0712080 | 3300035724 | Unclassified | 660 |
| 508 | Ga0373947_0297556 | 3300035725 | Bacteria | 1075 |
| 509 | Ga0373937_0002529 | 3300036401 | Bacteria | 15180 |
| 510 | Ga0373937_0016010 | 3300036401 | Bacteria | 6650 |
| 511 | Ga0373937_0021590 | 3300036401 | Bacteria | 5777 |
| 512 | Ga0373937_0376941 | 3300036401 | Unclassified | 1345 |
| 513 | Ga0373937_0600242 | 3300036401 | Bacteria | 1045 |
| 514 | Ga0373937_0627772 | 3300036401 | Bacteria | 1020 |
| 515 | Ga0265778_001995 | 3300036457 | Bacteria | 1923 |
| 516 | Ga0265778_052307 | 3300036457 | Bacteria | 561 |
| 517 | Ga0373925_0015240 | 3300037068 | Bacteria | 5558 |
| 518 | Ga0373925_0119653 | 3300037068 | Bacteria | 2043 |
| 519 | Ga0373925_0476274 | 3300037068 | Bacteria | 1024 |
| 520 | Ga0436364_0095879 | 3300037853 | Unclassified | 1770 |
| 521 | Ga0436364_0416069 | 3300037853 | Bacteria | 11246 |
| 522 | Ga0436364_0539637 | 3300037853 | Unclassified | 760 |
| 523 | Ga0436364_0594990 | 3300037853 | Bacteria | 1648 |
| 524 | Ga0436364_0612439 | 3300037853 | Plasmid | 2901 |
| 525 | Ga0436364_0631782 | 3300037853 | Unclassified | 740 |
| 526 | Ga0436364_0741686 | 3300037853 | Bacteria | 2695 |
| 527 | Ga0436364_0900852 | 3300037853 | Bacteria | 1555 |
| 528 | Ga0436364_0955889 | 3300037853 | Bacteria | 3097 |
| 529 | Ga0436365_0973300 | 3300039437 | Bacteria | 4029 |
| 530 | Ga0436363_1200123 | 3300039450 | Bacteria | 1474 |
| 531 | Ga0439439_0125188 | 3300041406 | Bacteria | 719 |
| 532 | Ga0439439_0167613 | 3300041406 | Bacteria | 629 |
| 533 | Ga0439453_0003914 | 3300041408 | Bacteria | 2181 |
| 534 | Ga0451853_2760430 | 3300041512 | Unclassified | 948 |
| 535 | Ga0439433_0114675 | 3300041999 | Unclassified | 676 |
| 536 | Ga0450923_103917 | 3300042125 | Bacteria | 658 |
| 537 | Ga0450888_072451 | 3300042126 | Unclassified | 520 |
| 538 | Ga0450896_016390 | 3300042133 | Bacteria | 1064 |
| 539 | Ga0439446_0140832 | 3300042156 | Bacteria | 788 |
| 540 | Ga0439434_0080510 | 3300042435 | Bacteria | 1033 |
| 541 | Ga0439435_0074507 | 3300042436 | Unclassified | 1010 |
| 542 | Ga0439464_0160072 | 3300042439 | Unclassified | 707 |
| 543 | Ga0439460_0338023 | 3300042461 | Unclassified | 530 |
| 544 | Ga0466967_0756503 | 3300045976 | Unclassified | 964 |
| 545 | Ga0495592_0016047 | 3300046454 | Bacteria | 5684 |
| 546 | Ga0495592_0029498 | 3300046454 | Bacteria | 4154 |
| 547 | Ga0495592_0090439 | 3300046454 | Unclassified | 2196 |
| 548 | Ga0495629_0104467 | 3300046459 | Bacteria | 1976 |
| 549 | Ga0495629_0245236 | 3300046459 | Bacteria | 1233 |
| 550 | Ga0495651_0147120 | 3300046462 | Bacteria | 1702 |
| 551 | Ga0495653_0225375 | 3300046463 | Bacteria | 1258 |
| 552 | Ga0495653_0501248 | 3300046463 | Unclassified | 757 |
| 553 | Ga0495580_0019830 | 3300046472 | Bacteria | 4989 |
| 554 | Ga0495580_0050111 | 3300046472 | Unclassified | 2953 |
| 555 | Ga0495580_0708650 | 3300046472 | Bacteria | 658 |
| 556 | Ga0495582_0171508 | 3300046473 | Bacteria | 1235 |
| 557 | Ga0495639_0173486 | 3300046475 | Bacteria | 1047 |
| 558 | Ga0495639_0536049 | 3300046475 | Bacteria | 599 |
| 559 | Ga0495662_0178979 | 3300046476 | Bacteria | 1045 |
| 560 | Ga0495664_0143588 | 3300046477 | Unclassified | 1447 |
| 561 | Ga0495594_0144841 | 3300046499 | Bacteria | 1348 |
| 562 | Ga0495594_0257846 | 3300046499 | Bacteria | 993 |
| 563 | Ga0495594_0360437 | 3300046499 | Bacteria | 828 |
| 564 | Ga0495608_0023848 | 3300046511 | Unclassified | 4187 |
| 565 | Ga0495608_0048859 | 3300046511 | Bacteria | 2810 |
| 566 | Ga0495608_0272828 | 3300046511 | Bacteria | 1051 |
| 567 | Ga0495618_0063425 | 3300046514 | Bacteria | 2346 |
| 568 | Ga0495618_0323763 | 3300046514 | Bacteria | 954 |
| 569 | Ga0495630_0004984 | 3300046517 | Bacteria | 9341 |
| 570 | Ga0495630_0202108 | 3300046517 | Bacteria | 1516 |
| 571 | Ga0495666_0164530 | 3300046526 | Unclassified | 1028 |
| 572 | Ga0495652_0201865 | 3300046529 | Bacteria | 1508 |
| 573 | Ga0495652_0312772 | 3300046529 | Bacteria | 1137 |
| 574 | Ga0495665_0239082 | 3300046531 | Bacteria | 936 |
| 575 | Ga0495665_0330199 | 3300046531 | Bacteria | 778 |
| 576 | Ga0495665_0466128 | 3300046531 | Unclassified | 638 |
| 577 | Ga0495586_0060103 | 3300046535 | Bacteria | 2066 |
| 578 | Ga0495586_0452414 | 3300046535 | Bacteria | 740 |
| 579 | Ga0495587_0580836 | 3300046536 | Unclassified | 617 |
| 580 | Ga0495645_0026526 | 3300046543 | Bacteria | 4206 |
| 581 | Ga0495645_0106650 | 3300046543 | Bacteria | 1987 |
| 582 | Ga0495633_0247278 | 3300046558 | Bacteria | 814 |
| 583 | Ga0495667_0000906 | 3300046559 | Bacteria | 19126 |
| 584 | Ga0495667_0044844 | 3300046559 | Unclassified | 2928 |
| 585 | Ga0495667_0058126 | 3300046559 | Bacteria | 2541 |
| 586 | Ga0495634_0288095 | 3300046642 | Bacteria | 996 |
| 587 | Ga0495635_0108139 | 3300046663 | Bacteria | 1900 |
| 588 | Ga0495635_0198307 | 3300046663 | Bacteria | 1362 |
| 589 | Ga0495635_0292768 | 3300046663 | Unclassified | 1092 |
| 590 | Ga0495588_0640639 | 3300046674 | Bacteria | 556 |
| 591 | Ga0495657_0164989 | 3300046675 | Unclassified | 1368 |
| 592 | Ga0495599_0093942 | 3300046678 | Bacteria | 1871 |
| 593 | Ga0495599_0396697 | 3300046678 | Unclassified | 822 |
| 594 | Ga0495647_0040113 | 3300046681 | Bacteria | 1778 |
| 595 | Ga0495658_0131508 | 3300046683 | Bacteria | 1524 |
| 596 | Ga0495658_0885624 | 3300046683 | Unclassified | 571 |
| 597 | Ga0495669_0015199 | 3300046684 | Bacteria | 3295 |
| 598 | Ga0495613_0000643 | 3300046689 | Bacteria | 27730 |
| 599 | Ga0495613_0231113 | 3300046689 | Bacteria | 1295 |
| 600 | Ga0495600_0006887 | 3300046809 | Bacteria | 6934 |
| 601 | Ga0495581_0055656 | 3300047315 | Unclassified | 2283 |
| 602 | Ga0495581_0398889 | 3300047315 | Bacteria | 802 |
| 603 | Ga0495604_0005836 | 3300047317 | Bacteria | 9761 |
| 604 | Ga0495604_0341476 | 3300047317 | Bacteria | 997 |
| 605 | Ga0495674_0048845 | 3300047319 | Bacteria | 3742 |
| 606 | Ga0495674_0059410 | 3300047319 | Bacteria | 3339 |
| 607 | Ga0495674_0073897 | 3300047319 | Bacteria | 2937 |
| 608 | Ga0495674_0169578 | 3300047319 | Bacteria | 1822 |
| 609 | Ga0495680_0085559 | 3300047322 | Unclassified | 2374 |
| 610 | Ga0495680_0381435 | 3300047322 | Bacteria | 976 |
| 611 | Ga0495684_0000494 | 3300047471 | Bacteria | 32208 |
| 612 | Ga0495684_0138532 | 3300047471 | Bacteria | 1825 |
| 613 | Ga0495684_0325688 | 3300047471 | Unclassified | 1097 |
| 614 | Ga0495684_0332238 | 3300047471 | Unclassified | 1084 |
| 615 | Ga0495602_0001193 | 3300048088 | Bacteria | 25517 |
| 616 | Ga0495602_0404632 | 3300048088 | Bacteria | 973 |
| 617 | Ga0495614_0568106 | 3300048089 | Bacteria | 543 |
| 618 | Ga0496100_0016846 | 3300048903 | Bacteria | 4299 |
| 619 | Ga0496101_0002267 | 3300048904 | Bacteria | 11752 |
| 620 | Ga0496101_0823734 | 3300048904 | Bacteria | 732 |
| 621 | Ga0496104_0095798 | 3300048907 | Bacteria | 2839 |
| 622 | Ga0496104_0353541 | 3300048907 | Unclassified | 1382 |
| 623 | Ga0496105_0392933 | 3300048908 | Bacteria | 1102 |
| 624 | Ga0496105_0606205 | 3300048908 | Bacteria | 849 |
| 625 | Ga0496105_0924951 | 3300048908 | Bacteria | 656 |
| 626 | Ga0496105_1284418 | 3300048908 | Bacteria | 535 |
| 627 | Ga0496106_0045654 | 3300048909 | Bacteria | 3292 |
| 628 | Ga0496106_0192753 | 3300048909 | Unclassified | 1621 |
| 629 | Ga0496106_0569146 | 3300048909 | Bacteria | 909 |
| 630 | Ga0496107_0664207 | 3300048910 | Bacteria | 768 |
| 631 | Ga0496108_1642057 | 3300048911 | Bacteria | 531 |
| 632 | Ga0496109_0055352 | 3300048912 | Bacteria | 3619 |
| 633 | Ga0496109_1157746 | 3300048912 | Bacteria | 710 |
| 634 | Ga0496110_0327381 | 3300048913 | Unclassified | 1396 |
| 635 | Ga0496112_0341037 | 3300048915 | Bacteria | 1442 |
| 636 | Ga0496112_0458147 | 3300048915 | Unclassified | 1213 |
| 637 | Ga0496112_1105622 | 3300048915 | Bacteria | 711 |
| 638 | Ga0496113_0106579 | 3300048916 | Bacteria | 2177 |
| 639 | Ga0496114_0041138 | 3300048917 | Bacteria | 3829 |
| 640 | Ga0496114_0570707 | 3300048917 | Bacteria | 999 |
| 641 | Ga0496114_0606960 | 3300048917 | Bacteria | 965 |
| 642 | Ga0496114_0822087 | 3300048917 | Unclassified | 808 |
| 643 | Ga0496114_1103185 | 3300048917 | Bacteria | 678 |
| 644 | Ga0496115_0710229 | 3300048918 | Bacteria | 789 |
| 645 | Ga0496115_0811945 | 3300048918 | Bacteria | 727 |
| 646 | Ga0501033_0679924 | 3300049570 | Bacteria | 701 |
| 647 | Ga0501037_0185043 | 3300049573 | Bacteria | 1477 |
| 648 | Ga0501039_0199844 | 3300049575 | Bacteria | 1572 |
| 649 | Ga0501040_0313121 | 3300049576 | Unclassified | 1122 |
| 650 | Ga0501041_0714095 | 3300049577 | Unclassified | 642 |
| 651 | Ga0501041_0927945 | 3300049577 | Unclassified | 559 |
| 652 | Ga0501042_0410609 | 3300049578 | Unclassified | 981 |
| 653 | Ga0501042_0672390 | 3300049578 | Unclassified | 753 |
| 654 | Ga0501043_0297407 | 3300049579 | Bacteria | 1234 |
| 655 | Ga0501046_0184520 | 3300049580 | Unclassified | 1558 |
| 656 | Ga0501068_0234813 | 3300049584 | Bacteria | 1166 |
| 657 | Ga0501070_1467426 | 3300049586 | Bacteria | 517 |
| 658 | Ga0501071_0065873 | 3300049587 | Bacteria | 2631 |
| 659 | Ga0501072_0101691 | 3300049588 | Unclassified | 2284 |
| 660 | Ga0501073_0901075 | 3300049589 | Unclassified | 609 |
| 661 | Ga0501075_0290918 | 3300049591 | Bacteria | 1244 |
| 662 | Ga0501076_0002896 | 3300049592 | Bacteria | 11883 |
| 663 | Ga0501076_0872333 | 3300049592 | Bacteria | 742 |
| 664 | Ga0501077_0068628 | 3300049593 | Unclassified | 2247 |
| 665 | Ga0501079_0039251 | 3300049741 | Unclassified | 3651 |
| 666 | Ga0501079_0849129 | 3300049741 | Bacteria | 719 |
| 667 | Ga0501079_0949570 | 3300049741 | Bacteria | 677 |
| 668 | Ga0501080_0073554 | 3300049742 | Bacteria | 3180 |
| 669 | Ga0501080_0141878 | 3300049742 | Unclassified | 2221 |
| 670 | Ga0501081_1051437 | 3300049743 | Bacteria | 616 |
| 671 | Ga0501045_0018244 | 3300049824 | Bacteria | 4989 |
| 672 | Ga0501045_0161148 | 3300049824 | Unclassified | 1670 |
| 673 | nmdc:mga05p37_120792_c1 | 3300050507 | Bacteria | 3219 |
| 674 | nmdc:mga05p37_2088735_c1 | 3300050507 | Bacteria | 531 |
| 675 | nmdc:mga05p37_402188_c1 | 3300050507 | Bacteria | 1599 |
| 676 | nmdc:mga05p37_79040_c1 | 3300050507 | Bacteria | 4050 |
| 677 | nmdc:mga05p37_81859_c1 | 3300050507 | Bacteria | 3977 |
| 678 | nmdc:mga09592_1024338_c1 | 3300050508 | Bacteria | 689 |
| 679 | nmdc:mga09592_112377_c1 | 3300050508 | Bacteria | 2337 |
| 680 | nmdc:mga09592_124350_c1 | 3300050508 | Bacteria | 2217 |
| 681 | nmdc:mga09592_834326_c1 | 3300050508 | Bacteria | 778 |
| 682 | nmdc:mga09592_931478_c1 | 3300050508 | Bacteria | 729 |
| 683 | nmdc:mga0qj67_19433_c1 | 3300050509 | Bacteria | 5190 |
| 684 | nmdc:mga0qj67_40622_c1 | 3300050509 | Bacteria | 3656 |
| 685 | nmdc:mga06r32_35895_c1 | 3300050510 | Bacteria | 4679 |
| 686 | nmdc:mga06r32_8103_c1 | 3300050510 | Bacteria | 9451 |
| 687 | nmdc:mga08y16_19920_c1 | 3300050511 | Bacteria | 7077 |
| 688 | nmdc:mga08y16_450401_c1 | 3300050511 | Bacteria | 1312 |
| 689 | nmdc:mga08y16_544943_c1 | 3300050511 | Bacteria | 1175 |
| 690 | nmdc:mga08y16_906319_c1 | 3300050511 | Bacteria | 867 |
| 691 | nmdc:mga0n895_128148_c1 | 3300050512 | Bacteria | 2562 |
| 692 | nmdc:mga0n895_159974_c1 | 3300050512 | Unclassified | 2284 |
| 693 | nmdc:mga0n895_160553_c1 | 3300050512 | Bacteria | 2279 |
| 694 | nmdc:mga0rr50_110570_c1 | 3300050513 | Unclassified | 2174 |
| 695 | nmdc:mga0rr50_82142_c1 | 3300050513 | Bacteria | 2488 |
| 696 | nmdc:mga0a205_460224_c1 | 3300050515 | Unclassified | 1132 |
| 697 | Ga0495612_0607072 | 3300053078 | Unclassified | 506 |
| 698 | Ga0495595_0122927 | 3300053084 | Bacteria | 1265 |
| 699 | Ga0495595_0706337 | 3300053084 | Unclassified | 517 |
| 700 | Ga0495619_0018251 | 3300053085 | Unclassified | 4451 |
| 701 | Ga0495619_0028742 | 3300053085 | Bacteria | 3588 |
| 702 | Ga0495619_0645696 | 3300053085 | Bacteria | 722 |
| 703 | Ga0500568_0000749 | 3300053139 | Bacteria | 23216 |
| 704 | Ga0501084_0517726 | 3300054114 | Bacteria | 1008 |
| 705 | Ga0501082_0040851 | 3300060353 | Bacteria | 3999 |
| 706 | Ga0530510_0302201 | 3300061734 | Bacteria | 1197 |
| 707 | Ga0530510_0554683 | 3300061734 | Bacteria | 873 |
| 708 | Ga0157380_10863756 | |||
| 709 | JGI24743J22301_10127712 | |||
| 710 | Ga0058859_11547489 | |||
| 711 | Ga0058860_12144590 | |||
| 712 | Ga0058862_12827608 | |||
| 713 | Ga0058862_12841748 | |||
| 714 | Ga0065712_10068186 | |||
| 715 | Ga0065712_10353139 | |||
| 716 | Ga0065715_10495466 | |||
| 717 | Ga0065707_10257919 | |||
| 718 | Ga0070658_10557524 | |||
| 719 | Ga0070676_10511361 | |||
| 720 | Ga0070683_100159465 | |||
| 721 | Ga0070683_100464459 | |||
| 722 | Ga0070683_100486858 | |||
| 723 | Ga0070683_101455734 | |||
| 724 | Ga0070690_100015296 | |||
| 725 | Ga0070670_100281425 | |||
| 726 | Ga0070670_101758835 | |||
| 727 | Ga0070677_10330331 | |||
| 728 | Ga0068869_100089643 | |||
| 729 | Ga0068869_100581786 | |||
| 730 | Ga0070666_10056850 | |||
| 731 | Ga0070666_10197375 | |||
| 732 | Ga0070666_10434905 | |||
| 733 | Ga0070666_11046732 | |||
| 734 | Ga0070682_101230543 | |||
| 735 | Ga0070682_101587716 | |||
| 736 | Ga0068868_100014728 | |||
| 737 | Ga0068868_101145356 | |||
| 738 | Ga0070660_100461806 | |||
| 739 | Ga0070689_100081212 | |||
| 740 | Ga0070689_102076563 | |||
| 741 | Ga0070661_100874445 | |||
| 742 | Ga0070668_100173191 | |||
| 743 | Ga0070668_101592023 | |||
| 744 | Ga0070669_100018199 | |||
| 745 | Ga0070669_100158924 | |||
| 746 | Ga0070669_100833803 | |||
| 747 | Ga0070675_100004550 | |||
| 748 | Ga0070675_100020502 | |||
| 749 | Ga0070675_100096550 | |||
| 750 | Ga0070675_100190229 | |||
| 751 | Ga0070675_101117276 | |||
| 752 | Ga0070671_100037673 | |||
| 753 | Ga0070671_100088144 | |||
| 754 | Ga0070671_100914167 | |||
| 755 | Ga0070671_101091366 | |||
| 756 | Ga0070674_100017416 | |||
| 757 | Ga0070674_100632677 | |||
| 758 | Ga0070674_100641587 | |||
| 759 | Ga0070674_100996041 | |||
| 760 | Ga0070673_101074385 | |||
| 761 | Ga0070673_101326912 | |||
| 762 | Ga0070688_100054435 | |||
| 763 | Ga0070688_100975801 | |||
| 764 | Ga0070688_101342155 | |||
| 765 | Ga0070703_10085358 | |||
| 766 | Ga0070713_100202348 | |||
| 767 | Ga0070713_100299102 | |||
| 768 | Ga0070713_100809956 | |||
| 769 | Ga0070701_10883619 | |||
| 770 | Ga0070711_100070201 | |||
| 771 | Ga0070711_100393474 | |||
| 772 | Ga0070711_100585793 | |||
| 773 | Ga0070705_100764171 | |||
| 774 | Ga0070708_100413415 | |||
| 775 | Ga0070663_100235633 | |||
| 776 | Ga0070678_100177199 | |||
| 777 | Ga0070678_100269575 | |||
| 778 | Ga0070678_101491158 | |||
| 779 | Ga0070681_10052512 | |||
| 780 | Ga0070681_10179624 | |||
| 781 | Ga0070681_10522379 | |||
| 782 | Ga0068867_100045993 | |||
| 783 | Ga0068867_102241395 | |||
| 784 | Ga0070685_10455532 | |||
| 785 | Ga0070699_100493992 | |||
| 786 | Ga0070699_100842875 | |||
| 787 | Ga0070699_101660652 | |||
| 788 | Ga0070684_100446974 | |||
| 789 | Ga0070684_100488292 | |||
| 790 | Ga0070697_100047066 | |||
| 791 | Ga0068853_100195466 | |||
| 792 | Ga0068853_100428954 | |||
| 793 | Ga0068853_101180170 | |||
| 794 | Ga0070672_100819038 | |||
| 795 | Ga0070672_100877228 | |||
| 796 | Ga0070665_100333317 | |||
| 797 | Ga0070665_100561398 | |||
| 798 | Ga0068855_100001733 | |||
| 799 | Ga0068855_100062911 | |||
| 800 | Ga0068855_100154677 | |||
| 801 | Ga0068855_100407513 | |||
| 802 | Ga0068855_100809441 | |||
| 803 | Ga0070664_101192026 | |||
| 804 | Ga0070664_101423273 | |||
| 805 | Ga0068857_100002727 | |||
| 806 | Ga0068857_100003583 | |||
| 807 | Ga0068857_100101545 | |||
| 808 | Ga0068857_102499806 | |||
| 809 | Ga0068856_100004088 | |||
| 810 | Ga0068856_100017451 | |||
| 811 | Ga0068856_100034816 | |||
| 812 | Ga0068856_100353515 | |||
| 813 | Ga0070702_101557164 | |||
| 814 | Ga0068859_100025969 | |||
| 815 | Ga0068859_100087789 | |||
| 816 | Ga0068859_100613346 | |||
| 817 | Ga0068859_100809629 | |||
| 818 | Ga0068859_102783497 | |||
| 819 | Ga0068864_100001500 | |||
| 820 | Ga0068864_100149681 | |||
| 821 | Ga0068864_100590589 | |||
| 822 | Ga0068866_10490495 | |||
| 823 | Ga0068866_10602723 | |||
| 824 | Ga0068861_100023381 | |||
| 825 | Ga0068861_100231580 | |||
| 826 | Ga0068861_101599022 | |||
| 827 | Ga0068861_101736901 | |||
| 828 | Ga0068863_100019107 | |||
| 829 | Ga0068863_100035530 | |||
| 830 | Ga0068863_100068603 | |||
| 831 | Ga0068863_100494393 | |||
| 832 | Ga0068863_100649022 | |||
| 833 | Ga0068863_100920657 | |||
| 834 | Ga0068863_101524604 | |||
| 835 | Ga0068858_100009936 | |||
| 836 | Ga0068858_100068244 | |||
| 837 | Ga0068858_100127205 | |||
| 838 | Ga0068858_100192462 | |||
| 839 | Ga0068858_100494363 | |||
| 840 | Ga0068858_100547860 | |||
| 841 | Ga0068858_101151376 | |||
| 842 | Ga0068858_102308920 | |||
| 843 | Ga0068860_100038493 | |||
| 844 | Ga0068860_100038598 | |||
| 845 | Ga0068860_100112679 | |||
| 846 | Ga0068860_100171880 | |||
| 847 | Ga0068860_100648112 | |||
| 848 | Ga0068862_100616971 | |||
| 849 | Ga0068862_101815921 | |||
| 850 | Ga0070717_10181253 | |||
| 851 | Ga0070717_10551059 | |||
| 852 | Ga0070715_10596561 | |||
| 853 | Ga0070716_100139210 | |||
| 854 | Ga0097621_100019829 | |||
| 855 | Ga0097621_100068356 | |||
| 856 | Ga0097621_100093094 | |||
| 857 | Ga0097621_100179893 | |||
| 858 | Ga0097621_100200956 | |||
| 859 | Ga0068871_100003608 | |||
| 860 | Ga0068871_100028832 | |||
| 861 | Ga0068871_100047174 | |||
| 862 | Ga0068871_100186930 | |||
| 863 | Ga0068871_100575354 | |||
| 864 | Ga0068871_101247710 | |||
| 865 | Ga0075428_100047248 | |||
| 866 | Ga0075428_101115230 | |||
| 867 | Ga0075430_100011998 | |||
| 868 | Ga0075430_100063327 | |||
| 869 | Ga0075430_100157739 | |||
| 870 | Ga0075431_100015251 | |||
| 871 | Ga0075431_100057610 | |||
| 872 | Ga0075433_10548518 | |||
| 873 | Ga0075434_100516462 | |||
| 874 | Ga0075429_100072558 | |||
| 875 | Ga0075429_100129733 | |||
| 876 | Ga0068865_100222862 | |||
| 877 | Ga0075436_100274034 | |||
| 878 | Ga0097620_100025969 | |||
| 879 | Ga0097620_100087789 | |||
| 880 | Ga0097620_100613347 | |||
| 881 | Ga0097620_100809529 | |||
| 882 | Ga0097620_102784060 | |||
| 883 | Ga0075435_100041151 | |||
| 884 | Ga0099794_10488507 | |||
| 885 | Ga0099795_10200230 | |||
| 886 | Ga0105240_10002654 | |||
| 887 | Ga0105240_10197379 | |||
| 888 | Ga0105240_10384330 | |||
| 889 | Ga0105240_11899005 | |||
| 890 | Ga0111539_10017785 | |||
| 891 | Ga0111539_10025546 | |||
| 892 | Ga0105245_10006384 | |||
| 893 | Ga0105245_10011243 | |||
| 894 | Ga0105245_10057554 | |||
| 895 | Ga0105245_10109654 | |||
| 896 | Ga0105245_10191773 | |||
| 897 | Ga0105245_10311737 | |||
| 898 | Ga0105245_10469327 | |||
| 899 | Ga0105245_10656773 | |||
| 900 | Ga0105245_10955408 | |||
| 901 | Ga0105247_10073018 | |||
| 902 | Ga0105247_10079636 | |||
| 903 | Ga0105247_11296434 | |||
| 904 | Ga0114129_10161846 | |||
| 905 | Ga0114129_10181891 | |||
| 906 | Ga0114129_10202495 | |||
| 907 | Ga0105243_10054742 | |||
| 908 | Ga0105243_10089003 | |||
| 909 | Ga0105243_10107213 | |||
| 910 | Ga0105243_10581353 | |||
| 911 | Ga0105243_10968226 | |||
| 912 | Ga0105241_10031242 | |||
| 913 | Ga0105241_10037061 | |||
| 914 | Ga0105241_10039911 | |||
| 915 | Ga0105241_10110444 | |||
| 916 | Ga0105241_10267709 | |||
| 917 | Ga0105241_10275327 | |||
| 918 | Ga0105242_10004936 | |||
| 919 | Ga0105242_10016108 | |||
| 920 | Ga0105242_10020384 | |||
| 921 | Ga0105242_10190195 | |||
| 922 | Ga0105242_10368641 | |||
| 923 | Ga0105242_10506306 | |||
| 924 | Ga0105242_10907025 | |||
| 925 | Ga0105248_10052752 | |||
| 926 | Ga0105248_10062297 | |||
| 927 | Ga0105248_10078102 | |||
| 928 | Ga0105248_10127069 | |||
| 929 | Ga0105248_10275980 | |||
| 930 | Ga0105248_10309287 | |||
| 931 | Ga0105248_10410754 | |||
| 932 | Ga0105248_10566672 | |||
| 933 | Ga0105248_11033163 | |||
| 934 | Ga0105248_11247753 | |||
| 935 | Ga0105248_11264047 | |||
| 936 | Ga0105248_11691770 | |||
| 937 | Ga0105248_13108584 | |||
| 938 | Ga0105237_10007273 | |||
| 939 | Ga0105237_10042107 | |||
| 940 | Ga0105237_10077876 | |||
| 941 | Ga0105237_10485522 | |||
| 942 | Ga0105238_10017209 | |||
| 943 | Ga0105238_10080688 | |||
| 944 | Ga0105238_10086701 | |||
| 945 | Ga0105238_10580577 | |||
| 946 | Ga0105238_12168502 | |||
| 947 | Ga0105249_12133420 | |||
| 948 | Ga0099796_10258889 | |||
| 949 | Ga0099796_10414736 | |||
| 950 | Ga0105239_10005545 | |||
| 951 | Ga0105239_10019309 | |||
| 952 | Ga0105239_10656201 | |||
| 953 | Ga0105239_10881321 | |||
| 954 | Ga0105246_10010641 | |||
| 955 | Ga0105246_11260429 | |||
| 956 | Ga0105246_12060143 | |||
| 957 | Ga0157370_10005685 | |||
| 958 | Ga0157370_10074105 | |||
| 959 | Ga0157370_11164208 | |||
| 960 | Ga0157369_10244844 | |||
| 961 | Ga0157374_10069175 | |||
| 962 | Ga0157374_10457585 | |||
| 963 | Ga0157374_10467567 | |||
| 964 | Ga0157374_10719158 | |||
| 965 | Ga0157378_10002294 | |||
| 966 | Ga0157378_10168657 | |||
| 967 | Ga0157378_10432027 | |||
| 968 | Ga0157378_10531830 | |||
| 969 | Ga0157378_10623175 | |||
| 970 | Ga0157378_10858294 | |||
| 971 | Ga0157378_11290077 | |||
| 972 | Ga0163162_10157024 | |||
| 973 | Ga0163162_10637291 | |||
| 974 | Ga0163162_11579011 | |||
| 975 | Ga0163162_11655021 | |||
| 976 | Ga0157372_10213724 | |||
| 977 | Ga0157372_10325243 | |||
| 978 | Ga0157375_10296473 | |||
| 979 | Ga0157375_10644002 | |||
| 980 | Ga0157375_10660451 | |||
| 981 | Ga0157375_10959143 | |||
| 982 | Ga0157375_11042635 | |||
| 983 | Ga0157375_11462175 | |||
| 984 | Ga0157375_13480772 | |||
| 985 | Ga0163163_10000335 | |||
| 986 | Ga0163163_10003599 | |||
| 987 | Ga0163163_10008622 | |||
| 988 | Ga0163163_10009332 | |||
| 989 | Ga0163163_10074157 | |||
| 990 | Ga0163163_10200863 | |||
| 991 | Ga0163163_10263768 | |||
| 992 | Ga0163163_10845413 | |||
| 993 | Ga0157380_10126861 | |||
| 994 | Ga0157380_10242370 | |||
| 995 | Ga0157380_10903748 | |||
| 996 | Ga0157380_10960317 | |||
| 997 | Ga0157377_10266017 | |||
| 998 | Ga0157379_10006591 | |||
| 999 | Ga0157379_10009854 | |||
| 1000 | Ga0157379_10029985 | |||
| 1001 | Ga0157379_10177756 | |||
| 1002 | Ga0157379_10406050 | |||
| 1003 | Ga0157379_10432590 | |||
| 1004 | Ga0157379_10522777 | |||
| 1005 | Ga0157379_10538044 | |||
| 1006 | Ga0157379_10843967 | |||
| 1007 | Ga0157379_11161685 | |||
| 1008 | Ga0157376_10002397 | |||
| 1009 | Ga0157376_10176725 | |||
| 1010 | Ga0157376_10204365 | |||
| 1011 | Ga0157376_10380985 | |||
| 1012 | Ga0157376_10455452 | |||
| 1013 | Ga0157376_10577145 | |||
| 1014 | Ga0157376_10754389 | |||
| 1015 | Ga0163161_10774437 | |||
| 1016 | Ga0184599_119678 | |||
| 1017 | Ga0213876_10194170 | |||
| 1018 | Ga0213875_10005308 | |||
| 1019 | Ga0213875_10014846 | |||
| 1020 | Ga0213875_10017533 | |||
| 1021 | Ga0213875_10032502 | |||
| 1022 | Ga0213875_10058045 | |||
| 1023 | Ga0213875_10286644 | |||
| 1024 | Ga0207642_10413878 | |||
| 1025 | Ga0207710_10022700 | |||
| 1026 | Ga0207710_10037821 | |||
| 1027 | Ga0207710_10049079 | |||
| 1028 | Ga0207680_10083452 | |||
| 1029 | Ga0207680_10569964 | |||
| 1030 | Ga0207680_10950848 | |||
| 1031 | Ga0207699_10272349 | |||
| 1032 | Ga0207699_10332190 | |||
| 1033 | Ga0207645_10147242 | |||
| 1034 | Ga0207643_10319099 | |||
| 1035 | Ga0207654_10008274 | |||
| 1036 | Ga0207654_10014623 | |||
| 1037 | Ga0207654_10016503 | |||
| 1038 | Ga0207654_10186474 | |||
| 1039 | Ga0207654_10189863 | |||
| 1040 | Ga0207707_10019292 | |||
| 1041 | Ga0207707_10154899 | |||
| 1042 | Ga0207695_10001831 | |||
| 1043 | Ga0207695_10024176 | |||
| 1044 | Ga0207695_10088726 | |||
| 1045 | Ga0207671_10041835 | |||
| 1046 | Ga0207671_10278320 | |||
| 1047 | Ga0207663_10125415 | |||
| 1048 | Ga0207663_10518942 | |||
| 1049 | Ga0207663_10624215 | |||
| 1050 | Ga0207681_10027675 | |||
| 1051 | Ga0207681_10466117 | |||
| 1052 | Ga0207694_10001340 | |||
| 1053 | Ga0207694_10025836 | |||
| 1054 | Ga0207694_10585184 | |||
| 1055 | Ga0207694_10781435 | |||
| 1056 | Ga0207650_11363980 | |||
| 1057 | Ga0207659_10001498 | |||
| 1058 | Ga0207659_10207982 | |||
| 1059 | Ga0207687_10007444 | |||
| 1060 | Ga0207687_10008910 | |||
| 1061 | Ga0207687_10076245 | |||
| 1062 | Ga0207687_10111280 | |||
| 1063 | Ga0207700_10586530 | |||
| 1064 | Ga0207644_10042011 | |||
| 1065 | Ga0207644_10744653 | |||
| 1066 | Ga0207690_11612085 | |||
| 1067 | Ga0207686_10002390 | |||
| 1068 | Ga0207686_10033591 | |||
| 1069 | Ga0207686_10174912 | |||
| 1070 | Ga0207686_10481552 | |||
| 1071 | Ga0207686_10539479 | |||
| 1072 | Ga0207686_10848676 | |||
| 1073 | Ga0207686_11670116 | |||
| 1074 | Ga0207709_10784115 | |||
| 1075 | Ga0207709_11119458 | |||
| 1076 | Ga0207670_10236409 | |||
| 1077 | Ga0207670_10299550 | |||
| 1078 | Ga0207670_10881642 | |||
| 1079 | Ga0207670_11101614 | |||
| 1080 | Ga0207669_10915248 | |||
| 1081 | Ga0207704_10140079 | |||
| 1082 | Ga0207665_10203999 | |||
| 1083 | Ga0207691_10103296 | |||
| 1084 | Ga0207691_10443188 | |||
| 1085 | Ga0207711_10037569 | |||
| 1086 | Ga0207711_10124474 | |||
| 1087 | Ga0207711_10135865 | |||
| 1088 | Ga0207711_10263481 | |||
| 1089 | Ga0207711_10390175 | |||
| 1090 | Ga0207711_10948731 | |||
| 1091 | Ga0207711_10988221 | |||
| 1092 | Ga0207711_11136993 | |||
| 1093 | Ga0207711_11489534 | |||
| 1094 | Ga0207711_11554414 | |||
| 1095 | Ga0207689_10367381 | |||
| 1096 | Ga0207689_10575352 | |||
| 1097 | Ga0207661_10142325 | |||
| 1098 | Ga0207661_10331694 | |||
| 1099 | Ga0207679_10083062 | |||
| 1100 | Ga0207667_10002284 | |||
| 1101 | Ga0207667_10132185 | |||
| 1102 | Ga0207667_10240287 | |||
| 1103 | Ga0207667_10388547 | |||
| 1104 | Ga0207667_10618068 | |||
| 1105 | Ga0207640_10829120 | |||
| 1106 | Ga0207658_10635916 | |||
| 1107 | Ga0207658_10908769 | |||
| 1108 | Ga0207677_10008232 | |||
| 1109 | Ga0207677_10259843 | |||
| 1110 | Ga0207677_10666996 | |||
| 1111 | Ga0207703_10009029 | |||
| 1112 | Ga0207703_10009926 | |||
| 1113 | Ga0207703_10157766 | |||
| 1114 | Ga0207703_10168167 | |||
| 1115 | Ga0207703_10271387 | |||
| 1116 | Ga0207703_10600227 | |||
| 1117 | Ga0207703_11877564 | |||
| 1118 | Ga0207639_10210846 | |||
| 1119 | Ga0207678_10855431 | |||
| 1120 | Ga0207708_10002543 | |||
| 1121 | Ga0207708_10852275 | |||
| 1122 | Ga0207702_10006565 | |||
| 1123 | Ga0207702_10030592 | |||
| 1124 | Ga0207702_10082607 | |||
| 1125 | Ga0207641_10010218 | |||
| 1126 | Ga0207641_10256845 | |||
| 1127 | Ga0207641_10296533 | |||
| 1128 | Ga0207641_10465905 | |||
| 1129 | Ga0207648_10021798 | |||
| 1130 | Ga0207648_10222627 | |||
| 1131 | Ga0207648_10231586 | |||
| 1132 | Ga0207648_10502576 | |||
| 1133 | Ga0207648_10794992 | |||
| 1134 | Ga0207676_10064022 | |||
| 1135 | Ga0207676_10144052 | |||
| 1136 | Ga0207674_10003879 | |||
| 1137 | Ga0207674_10066551 | |||
| 1138 | Ga0207675_100106463 | |||
| 1139 | Ga0207675_100266881 | |||
| 1140 | Ga0207675_100410907 | |||
| 1141 | Ga0207675_101643934 | |||
| 1142 | Ga0207683_10200905 | |||
| 1143 | Ga0207683_10292903 | |||
| 1144 | Ga0210000_1038920 | |||
| 1145 | Ga0209974_10275489 | |||
| 1146 | Ga0207428_10176002 | |||
| 1147 | Ga0268266_10437937 | |||
| 1148 | Ga0268266_10449845 | |||
| 1149 | Ga0268266_10947042 | |||
| 1150 | Ga0268265_10242350 | |||
| 1151 | Ga0268265_10397397 | |||
| 1152 | Ga0268265_11933348 | |||
| 1153 | Ga0268264_10127214 | |||
| 1154 | Ga0268264_10506050 | |||
| 1155 | Ga0268264_10834302 | |||
| 1156 | Ga0268264_11323579 | |||
| 1157 | Ga0265322_10098231 | |||
| 1158 | Ga0265338_10535244 | |||
| 1159 | Ga0265766_1021483 | |||
| 1160 | Ga0265332_10352325 | |||
| 1161 | Ga0265328_10064828 | |||
| 1162 | Ga0265339_10153668 | |||
| 1163 | Ga0265331_10412052 | |||
| 1164 | Ga0307408_101886436 | |||
| 1165 | Ga0265314_10000373 | |||
| 1166 | Ga0265342_10064848 | |||
| 1167 | Ga0307405_10446570 | |||
| 1168 | Ga0307413_10548519 | |||
| 1169 | Ga0307406_10239251 | |||
| 1170 | Ga0307409_100647663 | |||
| 1171 | Ga0307416_102589758 | |||
| 1172 | Ga0307411_10094624 | |||
| 1173 | Ga0316053_103706 | |||
| 1174 | Ga0307415_100288238 | |||
| 1175 | Ga0373926_0141225 | |||
| 1176 | Ga0373926_0422991 | |||
| 1177 | Ga0373934_0044115 | |||
| 1178 | Ga0373934_0085935 | |||
| 1179 | Ga0373951_0153924 | |||
| 1180 | Ga0373923_0123014 | |||
| 1181 | Ga0373936_0096620 | |||
| 1182 | Ga0373936_0118052 | |||
| 1183 | Ga0373936_0397343 | |||
| 1184 | Ga0373945_0035055 | |||
| 1185 | Ga0373945_0258824 | |||
| 1186 | Ga0373954_0393916 | |||
| 1187 | Ga0373956_0048818 | |||
| 1188 | Ga0373956_0150559 | |||
| 1189 | Ga0373956_0170606 | |||
| 1190 | Ga0373956_0229852 | |||
| 1191 | Ga0373956_0292651 | |||
| 1192 | Ga0373956_0490973 | |||
| 1193 | Ga0373957_0108810 | |||
| 1194 | Ga0373957_0119475 | |||
| 1195 | Ga0373943_0027769 | |||
| 1196 | Ga0373943_0494209 | |||
| 1197 | Ga0373946_0066739 | |||
| 1198 | Ga0373946_0604935 | |||
| 1199 | Ga0373946_0754587 | |||
| 1200 | Ga0373955_0119596 | |||
| 1201 | Ga0373955_0147054 | |||
| 1202 | Ga0373955_0170191 | |||
| 1203 | Ga0373955_0381947 | |||
| 1204 | Ga0373955_0959011 | |||
| 1205 | Ga0373924_0006729 | |||
| 1206 | Ga0373935_0235228 | |||
| 1207 | Ga0373927_0066964 | |||
| 1208 | Ga0373927_0069353 | |||
| 1209 | Ga0373927_0160132 | |||
| 1210 | Ga0373927_0488128 | |||
| 1211 | Ga0373933_0022280 | |||
| 1212 | Ga0373933_0129743 | |||
| 1213 | Ga0373933_0236110 | |||
| 1214 | Ga0373933_0712080 | |||
| 1215 | Ga0373947_0297556 | |||
| 1216 | Ga0373937_0002529 | |||
| 1217 | Ga0373937_0016010 | |||
| 1218 | Ga0373937_0021590 | |||
| 1219 | Ga0373937_0376941 | |||
| 1220 | Ga0373937_0600242 | |||
| 1221 | Ga0373937_0627772 | |||
| 1222 | Ga0265778_001995 | |||
| 1223 | Ga0265778_052307 | |||
| 1224 | Ga0373925_0015240 | |||
| 1225 | Ga0373925_0119653 | |||
| 1226 | Ga0373925_0476274 | |||
| 1227 | Ga0436364_0095879 | |||
| 1228 | Ga0436364_0416069 | |||
| 1229 | Ga0436364_0539637 | |||
| 1230 | Ga0436364_0594990 | |||
| 1231 | Ga0436364_0612439 | |||
| 1232 | Ga0436364_0631782 | |||
| 1233 | Ga0436364_0741686 | |||
| 1234 | Ga0436364_0900852 | |||
| 1235 | Ga0436364_0955889 | |||
| 1236 | Ga0436365_0973300 | |||
| 1237 | Ga0436363_1200123 | |||
| 1238 | Ga0439439_0125188 | |||
| 1239 | Ga0439439_0167613 | |||
| 1240 | Ga0439453_0003914 | |||
| 1241 | Ga0451853_2760430 | |||
| 1242 | Ga0439433_0114675 | |||
| 1243 | Ga0450923_103917 | |||
| 1244 | Ga0450888_072451 | |||
| 1245 | Ga0450896_016390 | |||
| 1246 | Ga0439446_0140832 | |||
| 1247 | Ga0439434_0080510 | |||
| 1248 | Ga0439435_0074507 | |||
| 1249 | Ga0439464_0160072 | |||
| 1250 | Ga0439460_0338023 | |||
| 1251 | Ga0466967_0756503 | |||
| 1252 | Ga0495592_0016047 | |||
| 1253 | Ga0495592_0029498 | |||
| 1254 | Ga0495592_0090439 | |||
| 1255 | Ga0495629_0104467 | |||
| 1256 | Ga0495629_0245236 | |||
| 1257 | Ga0495651_0147120 | |||
| 1258 | Ga0495653_0225375 | |||
| 1259 | Ga0495653_0501248 | |||
| 1260 | Ga0495580_0019830 | |||
| 1261 | Ga0495580_0050111 | |||
| 1262 | Ga0495580_0708650 | |||
| 1263 | Ga0495582_0171508 | |||
| 1264 | Ga0495639_0173486 | |||
| 1265 | Ga0495639_0536049 | |||
| 1266 | Ga0495662_0178979 | |||
| 1267 | Ga0495664_0143588 | |||
| 1268 | Ga0495594_0144841 | |||
| 1269 | Ga0495594_0257846 | |||
| 1270 | Ga0495594_0360437 | |||
| 1271 | Ga0495608_0023848 | |||
| 1272 | Ga0495608_0048859 | |||
| 1273 | Ga0495608_0272828 | |||
| 1274 | Ga0495618_0063425 | |||
| 1275 | Ga0495618_0323763 | |||
| 1276 | Ga0495630_0004984 | |||
| 1277 | Ga0495630_0202108 | |||
| 1278 | Ga0495666_0164530 | |||
| 1279 | Ga0495652_0201865 | |||
| 1280 | Ga0495652_0312772 | |||
| 1281 | Ga0495665_0239082 | |||
| 1282 | Ga0495665_0330199 | |||
| 1283 | Ga0495665_0466128 | |||
| 1284 | Ga0495586_0060103 | |||
| 1285 | Ga0495586_0452414 | |||
| 1286 | Ga0495587_0580836 | |||
| 1287 | Ga0495645_0026526 | |||
| 1288 | Ga0495645_0106650 | |||
| 1289 | Ga0495633_0247278 | |||
| 1290 | Ga0495667_0000906 | |||
| 1291 | Ga0495667_0044844 | |||
| 1292 | Ga0495667_0058126 | |||
| 1293 | Ga0495634_0288095 | |||
| 1294 | Ga0495635_0108139 | |||
| 1295 | Ga0495635_0198307 | |||
| 1296 | Ga0495635_0292768 | |||
| 1297 | Ga0495588_0640639 | |||
| 1298 | Ga0495657_0164989 | |||
| 1299 | Ga0495599_0093942 | |||
| 1300 | Ga0495599_0396697 | |||
| 1301 | Ga0495647_0040113 | |||
| 1302 | Ga0495658_0131508 | |||
| 1303 | Ga0495658_0885624 | |||
| 1304 | Ga0495669_0015199 | |||
| 1305 | Ga0495613_0000643 | |||
| 1306 | Ga0495613_0231113 | |||
| 1307 | Ga0495600_0006887 | |||
| 1308 | Ga0495581_0055656 | |||
| 1309 | Ga0495581_0398889 | |||
| 1310 | Ga0495604_0005836 | |||
| 1311 | Ga0495604_0341476 | |||
| 1312 | Ga0495674_0048845 | |||
| 1313 | Ga0495674_0059410 | |||
| 1314 | Ga0495674_0073897 | |||
| 1315 | Ga0495674_0169578 | |||
| 1316 | Ga0495680_0085559 | |||
| 1317 | Ga0495680_0381435 | |||
| 1318 | Ga0495684_0000494 | |||
| 1319 | Ga0495684_0138532 | |||
| 1320 | Ga0495684_0325688 | |||
| 1321 | Ga0495684_0332238 | |||
| 1322 | Ga0495602_0001193 | |||
| 1323 | Ga0495602_0404632 | |||
| 1324 | Ga0495614_0568106 | |||
| 1325 | Ga0496100_0016846 | |||
| 1326 | Ga0496101_0002267 | |||
| 1327 | Ga0496101_0823734 | |||
| 1328 | Ga0496104_0095798 | |||
| 1329 | Ga0496104_0353541 | |||
| 1330 | Ga0496105_0392933 | |||
| 1331 | Ga0496105_0606205 | |||
| 1332 | Ga0496105_0924951 | |||
| 1333 | Ga0496105_1284418 | |||
| 1334 | Ga0496106_0045654 | |||
| 1335 | Ga0496106_0192753 | |||
| 1336 | Ga0496106_0569146 | |||
| 1337 | Ga0496107_0664207 | |||
| 1338 | Ga0496108_1642057 | |||
| 1339 | Ga0496109_0055352 | |||
| 1340 | Ga0496109_1157746 | |||
| 1341 | Ga0496110_0327381 | |||
| 1342 | Ga0496112_0341037 | |||
| 1343 | Ga0496112_0458147 | |||
| 1344 | Ga0496112_1105622 | |||
| 1345 | Ga0496113_0106579 | |||
| 1346 | Ga0496114_0041138 | |||
| 1347 | Ga0496114_0570707 | |||
| 1348 | Ga0496114_0606960 | |||
| 1349 | Ga0496114_0822087 | |||
| 1350 | Ga0496114_1103185 | |||
| 1351 | Ga0496115_0710229 | |||
| 1352 | Ga0496115_0811945 | |||
| 1353 | Ga0501033_0679924 | |||
| 1354 | Ga0501037_0185043 | |||
| 1355 | Ga0501039_0199844 | |||
| 1356 | Ga0501040_0313121 | |||
| 1357 | Ga0501041_0714095 | |||
| 1358 | Ga0501041_0927945 | |||
| 1359 | Ga0501042_0410609 | |||
| 1360 | Ga0501042_0672390 | |||
| 1361 | Ga0501043_0297407 | |||
| 1362 | Ga0501046_0184520 | |||
| 1363 | Ga0501068_0234813 | |||
| 1364 | Ga0501070_1467426 | |||
| 1365 | Ga0501071_0065873 | |||
| 1366 | Ga0501072_0101691 | |||
| 1367 | Ga0501073_0901075 | |||
| 1368 | Ga0501075_0290918 | |||
| 1369 | Ga0501076_0002896 | |||
| 1370 | Ga0501076_0872333 | |||
| 1371 | Ga0501077_0068628 | |||
| 1372 | Ga0501079_0039251 | |||
| 1373 | Ga0501079_0849129 | |||
| 1374 | Ga0501079_0949570 | |||
| 1375 | Ga0501080_0073554 | |||
| 1376 | Ga0501080_0141878 | |||
| 1377 | Ga0501081_1051437 | |||
| 1378 | Ga0501045_0018244 | |||
| 1379 | Ga0501045_0161148 | |||
| 1380 | nmdc:mga05p37_120792_c1 | |||
| 1381 | nmdc:mga05p37_2088735_c1 | |||
| 1382 | nmdc:mga05p37_402188_c1 | |||
| 1383 | nmdc:mga05p37_79040_c1 | |||
| 1384 | nmdc:mga05p37_81859_c1 | |||
| 1385 | nmdc:mga09592_1024338_c1 | |||
| 1386 | nmdc:mga09592_112377_c1 | |||
| 1387 | nmdc:mga09592_124350_c1 | |||
| 1388 | nmdc:mga09592_834326_c1 | |||
| 1389 | nmdc:mga09592_931478_c1 | |||
| 1390 | nmdc:mga0qj67_19433_c1 | |||
| 1391 | nmdc:mga0qj67_40622_c1 | |||
| 1392 | nmdc:mga06r32_35895_c1 | |||
| 1393 | nmdc:mga06r32_8103_c1 | |||
| 1394 | nmdc:mga08y16_19920_c1 | |||
| 1395 | nmdc:mga08y16_450401_c1 | |||
| 1396 | nmdc:mga08y16_544943_c1 | |||
| 1397 | nmdc:mga08y16_906319_c1 | |||
| 1398 | nmdc:mga0n895_128148_c1 | |||
| 1399 | nmdc:mga0n895_159974_c1 | |||
| 1400 | nmdc:mga0n895_160553_c1 | |||
| 1401 | nmdc:mga0rr50_110570_c1 | |||
| 1402 | nmdc:mga0rr50_82142_c1 | |||
| 1403 | nmdc:mga0a205_460224_c1 | |||
| 1404 | Ga0495612_0607072 | |||
| 1405 | Ga0495595_0122927 | |||
| 1406 | Ga0495595_0706337 | |||
| 1407 | Ga0495619_0018251 | |||
| 1408 | Ga0495619_0028742 | |||
| 1409 | Ga0495619_0645696 | |||
| 1410 | Ga0500568_0000749 | |||
| 1411 | Ga0501084_0517726 | |||
| 1412 | Ga0501082_0040851 | |||
| 1413 | Ga0530510_0302201 | |||
| 1414 | Ga0530510_0554683 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7og2-assembly1.cif.gz_B | crystal structure of pseudoalteromonas luteoviolacea l-amino acid oxidase | 0.8492 | 39 | 69 |
| 7c4k-assembly1.cif.gz_A | ancestral l-amino acid oxidase (anclaao-n5) ligand free form | 0.8431 | 40 | 69 |
| 7c4l-assembly1.cif.gz_A | anncestral l-amino acid oxidase (anclaao-n5) l-gln binding form | 0.8228 | 40 | 69 |
| 2jjd-assembly5.cif.gz_E | protein tyrosine phosphatase, receptor type, e isoform | 0.8078 | 40 | 69 |
| 2jjd-assembly3.cif.gz_C | protein tyrosine phosphatase, receptor type, e isoform | 0.7955 | 40 | 69 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2jjdF02 | Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily | 0.8008 | 40 | 69 | 3.90.190.10 |
| af_Q8VIG0_99_222_3.30.1520.10 | Alpha Beta;2-Layer Sandwich;PX Domain;Phox-like domain | 0.7952 | 37 | 69 | 3.30.1520.10 |
| af_Q8VC10_106_455_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.7942 | 38 | 69 | 3.50.50.60 |
| af_Q9UBZ4_1_312_3.60.10.10 | Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase | 0.7915 | 49 | 69 | 3.60.10.10 |
| 3nuzD00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.7851 | 33 | 71 | 3.40.50.1820 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A383CUF3-F1-model_v4 | OB domain-containing protein | 0.9696 | 28 | 120 |
|
| AF-A0A2E8ECC8-F1-model_v4 | OB-fold nucleic acid binding domain-containing protein | 0.9502 | 15 | 125 |
|
| AF-A0A2V8I9N4-F1-model_v4 | DUF5666 domain-containing protein | 0.9448 | 36 | 123 |
|
| AF-A0A2V8GJN1-F1-model_v4 | OB domain-containing protein | 0.9433 | 28 | 122 |
|
| AF-A0A3N5PNS9-F1-model_v4 | DNA-binding protein | 0.943 | 19 | 123 |
|