F476545

General Info

Members Datasets Scaffolds Average Seq Length
707 296 1414 136

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_10863756|Ga0157380_108637562
Length 152
Sequence MNAVDSARGHSMRTITVIITGLAVLLSGAGTAIAHHSFAAEFDSTKPVSLQGVVTKMEWINPHSWIHLDVKNADGTVTKWMIEGGTPNTLVRRGFTKDSLKVGTEIRVEGFRAKNGANRANGRDLVLPDGKRLFLGSSGTGAPKDGRDPSDK

Samples

Sample ID Description Type Environment
1 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
75 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300019188 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
105 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
106 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
158 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
159 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
161 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
162 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
163 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
164 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
165 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
166 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
167 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
168 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
169 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
170 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
171 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
172 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
173 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
174 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
175 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
176 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
177 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
178 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
179 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
180 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
181 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
182 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
183 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
184 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
185 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
186 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
187 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
188 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
189 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
190 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
191 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
192 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
193 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
195 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
196 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
197 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
198 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
199 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
200 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
201 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
202 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
203 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
204 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
205 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
206 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
207 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
208 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
209 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
210 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
211 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
212 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
213 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
214 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
215 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
216 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
217 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
218 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
219 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
220 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
221 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
222 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
223 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
224 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
225 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
226 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
227 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
228 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
229 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
230 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
231 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
232 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
233 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
234 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
235 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
236 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
237 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
238 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
239 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
240 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
241 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
242 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
243 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
244 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
245 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
246 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
247 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
248 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
249 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
250 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
251 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
252 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
253 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
254 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
255 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
256 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
257 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
258 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
259 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
260 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
261 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
262 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
271 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
272 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
273 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
274 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
275 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
276 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
277 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
278 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
279 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
280 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
281 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
282 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
283 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
284 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
285 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
286 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
287 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
288 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
289 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
290 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
291 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
292 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
293 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
294 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
295 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
296 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.73
Metatranscriptomes 1.27
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.14
Nodule 0
Rhizoplane 3.96
Rhizosphere 92.93
Stem 0
Stem Tuber 0
Unclassified 23.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157380_10863756 3300014326 Unclassified 928
2 JGI24743J22301_10127712 3300001991 Unclassified 560
3 Ga0058859_11547489 3300004798 Unclassified 719
4 Ga0058860_12144590 3300004801 Unclassified 750
5 Ga0058862_12827608 3300004803 Unclassified 672
6 Ga0058862_12841748 3300004803 Bacteria 1871
7 Ga0065712_10068186 3300005290 Bacteria 13337
8 Ga0065712_10353139 3300005290 Bacteria 785
9 Ga0065715_10495466 3300005293 Bacteria 784
10 Ga0065707_10257919 3300005295 Bacteria 1102
11 Ga0070658_10557524 3300005327 Bacteria 992
12 Ga0070676_10511361 3300005328 Bacteria 854
13 Ga0070683_100159465 3300005329 Bacteria 2140
14 Ga0070683_100464459 3300005329 Unclassified 1208
15 Ga0070683_100486858 3300005329 Bacteria 1178
16 Ga0070683_101455734 3300005329 Bacteria 658
17 Ga0070690_100015296 3300005330 Bacteria 4574
18 Ga0070670_100281425 3300005331 Bacteria 1452
19 Ga0070670_101758835 3300005331 Bacteria 571
20 Ga0070677_10330331 3300005333 Bacteria 784
21 Ga0068869_100089643 3300005334 Unclassified 2310
22 Ga0068869_100581786 3300005334 Bacteria 944
23 Ga0070666_10056850 3300005335 Bacteria 2643
24 Ga0070666_10197375 3300005335 Bacteria 1415
25 Ga0070666_10434905 3300005335 Bacteria 946
26 Ga0070666_11046732 3300005335 Unclassified 606
27 Ga0070682_101230543 3300005337 Unclassified 633
28 Ga0070682_101587716 3300005337 Unclassified 565
29 Ga0068868_100014728 3300005338 Bacteria 5769
30 Ga0068868_101145356 3300005338 Bacteria 717
31 Ga0070660_100461806 3300005339 Bacteria 1054
32 Ga0070689_100081212 3300005340 Bacteria 2545
33 Ga0070689_102076563 3300005340 Unclassified 520
34 Ga0070661_100874445 3300005344 Unclassified 741
35 Ga0070668_100173191 3300005347 Bacteria 1758
36 Ga0070668_101592023 3300005347 Bacteria 598
37 Ga0070669_100018199 3300005353 Bacteria 5018
38 Ga0070669_100158924 3300005353 Bacteria 1755
39 Ga0070669_100833803 3300005353 Unclassified 785
40 Ga0070675_100004550 3300005354 Bacteria 10588
41 Ga0070675_100020502 3300005354 Bacteria 5274
42 Ga0070675_100096550 3300005354 Bacteria 2483
43 Ga0070675_100190229 3300005354 Unclassified 1778
44 Ga0070675_101117276 3300005354 Bacteria 725
45 Ga0070671_100037673 3300005355 Bacteria 4011
46 Ga0070671_100088144 3300005355 Bacteria 2597
47 Ga0070671_100914167 3300005355 Bacteria 767
48 Ga0070671_101091366 3300005355 Bacteria 701
49 Ga0070674_100017416 3300005356 Bacteria 4520
50 Ga0070674_100632677 3300005356 Bacteria 908
51 Ga0070674_100641587 3300005356 Bacteria 902
52 Ga0070674_100996041 3300005356 Bacteria 735
53 Ga0070673_101074385 3300005364 Unclassified 751
54 Ga0070673_101326912 3300005364 Bacteria 676
55 Ga0070688_100054435 3300005365 Bacteria 2506
56 Ga0070688_100975801 3300005365 Unclassified 672
57 Ga0070688_101342155 3300005365 Unclassified 578
58 Ga0070703_10085358 3300005406 Unclassified 1084
59 Ga0070713_100202348 3300005436 Bacteria 1794
60 Ga0070713_100299102 3300005436 Bacteria 1481
61 Ga0070713_100809956 3300005436 Bacteria 898
62 Ga0070701_10883619 3300005438 Bacteria 616
63 Ga0070711_100070201 3300005439 Bacteria 2466
64 Ga0070711_100393474 3300005439 Unclassified 1123
65 Ga0070711_100585793 3300005439 Bacteria 929
66 Ga0070705_100764171 3300005440 Unclassified 765
67 Ga0070708_100413415 3300005445 Unclassified 1272
68 Ga0070663_100235633 3300005455 Bacteria 1443
69 Ga0070678_100177199 3300005456 Bacteria 1742
70 Ga0070678_100269575 3300005456 Bacteria 1435
71 Ga0070678_101491158 3300005456 Bacteria 633
72 Ga0070681_10052512 3300005458 Unclassified 4065
73 Ga0070681_10179624 3300005458 Unclassified 2038
74 Ga0070681_10522379 3300005458 Unclassified 1100
75 Ga0068867_100045993 3300005459 Bacteria 3203
76 Ga0068867_102241395 3300005459 Unclassified 519
77 Ga0070685_10455532 3300005466 Bacteria 897
78 Ga0070699_100493992 3300005518 Bacteria 1111
79 Ga0070699_100842875 3300005518 Unclassified 839
80 Ga0070699_101660652 3300005518 Bacteria 585
81 Ga0070684_100446974 3300005535 Bacteria 1194
82 Ga0070684_100488292 3300005535 Unclassified 1140
83 Ga0070697_100047066 3300005536 Bacteria 3498
84 Ga0068853_100195466 3300005539 Bacteria 1839
85 Ga0068853_100428954 3300005539 Bacteria 1241
86 Ga0068853_101180170 3300005539 Unclassified 739
87 Ga0070672_100819038 3300005543 Bacteria 820
88 Ga0070672_100877228 3300005543 Bacteria 792
89 Ga0070665_100333317 3300005548 Bacteria 1522
90 Ga0070665_100561398 3300005548 Bacteria 1154
91 Ga0068855_100001733 3300005563 Bacteria 27220
92 Ga0068855_100062911 3300005563 Bacteria 4331
93 Ga0068855_100154677 3300005563 Bacteria 2606
94 Ga0068855_100407513 3300005563 Unclassified 1489
95 Ga0068855_100809441 3300005563 Unclassified 995
96 Ga0070664_101192026 3300005564 Bacteria 718
97 Ga0070664_101423273 3300005564 Unclassified 655
98 Ga0068857_100002727 3300005577 Bacteria 14490
99 Ga0068857_100003583 3300005577 Bacteria 12991
100 Ga0068857_100101545 3300005577 Bacteria 2581
101 Ga0068857_102499806 3300005577 Unclassified 507
102 Ga0068856_100004088 3300005614 Bacteria 14583
103 Ga0068856_100017451 3300005614 Bacteria 6954
104 Ga0068856_100034816 3300005614 Bacteria 4934
105 Ga0068856_100353515 3300005614 Bacteria 1488
106 Ga0070702_101557164 3300005615 Unclassified 545
107 Ga0068859_100025969 3300005617 Bacteria 5876
108 Ga0068859_100087789 3300005617 Bacteria 3159
109 Ga0068859_100613346 3300005617 Bacteria 1181
110 Ga0068859_100809629 3300005617 Bacteria 1024
111 Ga0068859_102783497 3300005617 Unclassified 537
112 Ga0068864_100001500 3300005618 Bacteria 19242
113 Ga0068864_100149681 3300005618 Unclassified 2113
114 Ga0068864_100590589 3300005618 Bacteria 1077
115 Ga0068866_10490495 3300005718 Bacteria 811
116 Ga0068866_10602723 3300005718 Bacteria 742
117 Ga0068861_100023381 3300005719 Bacteria 4456
118 Ga0068861_100231580 3300005719 Bacteria 1567
119 Ga0068861_101599022 3300005719 Unclassified 642
120 Ga0068861_101736901 3300005719 Bacteria 618
121 Ga0068863_100019107 3300005841 Bacteria 6559
122 Ga0068863_100035530 3300005841 Bacteria 4747
123 Ga0068863_100068603 3300005841 Bacteria 3354
124 Ga0068863_100494393 3300005841 Bacteria 1204
125 Ga0068863_100649022 3300005841 Bacteria 1047
126 Ga0068863_100920657 3300005841 Bacteria 875
127 Ga0068863_101524604 3300005841 Bacteria 677
128 Ga0068858_100009936 3300005842 Bacteria 9039
129 Ga0068858_100068244 3300005842 Unclassified 3294
130 Ga0068858_100127205 3300005842 Bacteria 2387
131 Ga0068858_100192462 3300005842 Bacteria 1927
132 Ga0068858_100494363 3300005842 Bacteria 1181
133 Ga0068858_100547860 3300005842 Bacteria 1120
134 Ga0068858_101151376 3300005842 Bacteria 762
135 Ga0068858_102308920 3300005842 Unclassified 532
136 Ga0068860_100038493 3300005843 Bacteria 4575
137 Ga0068860_100038598 3300005843 Bacteria 4568
138 Ga0068860_100112679 3300005843 Unclassified 2601
139 Ga0068860_100171880 3300005843 Unclassified 2093
140 Ga0068860_100648112 3300005843 Bacteria 1064
141 Ga0068862_100616971 3300005844 Unclassified 1043
142 Ga0068862_101815921 3300005844 Bacteria 619
143 Ga0070717_10181253 3300006028 Bacteria 1836
144 Ga0070717_10551059 3300006028 Unclassified 1044
145 Ga0070715_10596561 3300006163 Bacteria 647
146 Ga0070716_100139210 3300006173 Bacteria 1545
147 Ga0097621_100019829 3300006237 Bacteria 5171
148 Ga0097621_100068356 3300006237 Bacteria 2930
149 Ga0097621_100093094 3300006237 Bacteria 2525
150 Ga0097621_100179893 3300006237 Bacteria 1827
151 Ga0097621_100200956 3300006237 Bacteria 1730
152 Ga0068871_100003608 3300006358 Bacteria 10632
153 Ga0068871_100028832 3300006358 Bacteria 4356
154 Ga0068871_100047174 3300006358 Bacteria 3473
155 Ga0068871_100186930 3300006358 Bacteria 1783
156 Ga0068871_100575354 3300006358 Bacteria 1022
157 Ga0068871_101247710 3300006358 Unclassified 698
158 Ga0075428_100047248 3300006844 Bacteria 4728
159 Ga0075428_101115230 3300006844 Bacteria 833
160 Ga0075430_100011998 3300006846 Bacteria 7373
161 Ga0075430_100063327 3300006846 Bacteria 3106
162 Ga0075430_100157739 3300006846 Unclassified 1889
163 Ga0075431_100015251 3300006847 Bacteria 7788
164 Ga0075431_100057610 3300006847 Bacteria 4008
165 Ga0075433_10548518 3300006852 Bacteria 1016
166 Ga0075434_100516462 3300006871 Bacteria 1215
167 Ga0075429_100072558 3300006880 Bacteria 2998
168 Ga0075429_100129733 3300006880 Bacteria 2205
169 Ga0068865_100222862 3300006881 Bacteria 1475
170 Ga0075436_100274034 3300006914 Bacteria 1205
171 Ga0097620_100025969 3300006931 Bacteria 5876
172 Ga0097620_100087789 3300006931 Bacteria 3159
173 Ga0097620_100613347 3300006931 Bacteria 1181
174 Ga0097620_100809529 3300006931 Bacteria 1024
175 Ga0097620_102784060 3300006931 Unclassified 537
176 Ga0075435_100041151 3300007076 Bacteria 3693
177 Ga0099794_10488507 3300007265 Bacteria 647
178 Ga0099795_10200230 3300007788 Bacteria 842
179 Ga0105240_10002654 3300009093 Bacteria 28457
180 Ga0105240_10197379 3300009093 Unclassified 2361
181 Ga0105240_10384330 3300009093 Bacteria 1584
182 Ga0105240_11899005 3300009093 Bacteria 620
183 Ga0111539_10017785 3300009094 Bacteria 8801
184 Ga0111539_10025546 3300009094 Bacteria 7241
185 Ga0105245_10006384 3300009098 Bacteria 10373
186 Ga0105245_10011243 3300009098 Bacteria 7793
187 Ga0105245_10057554 3300009098 Bacteria 3497
188 Ga0105245_10109654 3300009098 Bacteria 2565
189 Ga0105245_10191773 3300009098 Bacteria 1958
190 Ga0105245_10311737 3300009098 Unclassified 1547
191 Ga0105245_10469327 3300009098 Bacteria 1270
192 Ga0105245_10656773 3300009098 Unclassified 1079
193 Ga0105245_10955408 3300009098 Unclassified 900
194 Ga0105247_10073018 3300009101 Bacteria 2149
195 Ga0105247_10079636 3300009101 Bacteria 2062
196 Ga0105247_11296434 3300009101 Bacteria 585
197 Ga0114129_10161846 3300009147 Bacteria 3056
198 Ga0114129_10181891 3300009147 Bacteria 2860
199 Ga0114129_10202495 3300009147 Bacteria 2688
200 Ga0105243_10054742 3300009148 Bacteria 3168
201 Ga0105243_10089003 3300009148 Unclassified 2537
202 Ga0105243_10107213 3300009148 Bacteria 2330
203 Ga0105243_10581353 3300009148 Bacteria 1075
204 Ga0105243_10968226 3300009148 Bacteria 851
205 Ga0105241_10031242 3300009174 Bacteria 3987
206 Ga0105241_10037061 3300009174 Bacteria 3673
207 Ga0105241_10039911 3300009174 Bacteria 3542
208 Ga0105241_10110444 3300009174 Bacteria 2200
209 Ga0105241_10267709 3300009174 Bacteria 1454
210 Ga0105241_10275327 3300009174 Unclassified 1435
211 Ga0105242_10004936 3300009176 Bacteria 10332
212 Ga0105242_10016108 3300009176 Bacteria 5808
213 Ga0105242_10020384 3300009176 Bacteria 5198
214 Ga0105242_10190195 3300009176 Bacteria 1817
215 Ga0105242_10368641 3300009176 Bacteria 1331
216 Ga0105242_10506306 3300009176 Bacteria 1149
217 Ga0105242_10907025 3300009176 Bacteria 882
218 Ga0105248_10052752 3300009177 Bacteria 4563
219 Ga0105248_10062297 3300009177 Unclassified 4189
220 Ga0105248_10078102 3300009177 Bacteria 3722
221 Ga0105248_10127069 3300009177 Bacteria 2876
222 Ga0105248_10275980 3300009177 Bacteria 1893
223 Ga0105248_10309287 3300009177 Bacteria 1780
224 Ga0105248_10410754 3300009177 Bacteria 1524
225 Ga0105248_10566672 3300009177 Unclassified 1281
226 Ga0105248_11033163 3300009177 Bacteria 928
227 Ga0105248_11247753 3300009177 Bacteria 840
228 Ga0105248_11264047 3300009177 Bacteria 835
229 Ga0105248_11691770 3300009177 Unclassified 717
230 Ga0105248_13108584 3300009177 Bacteria 528
231 Ga0105237_10007273 3300009545 Bacteria 12148
232 Ga0105237_10042107 3300009545 Bacteria 4606
233 Ga0105237_10077876 3300009545 Bacteria 3305
234 Ga0105237_10485522 3300009545 Bacteria 1242
235 Ga0105238_10017209 3300009551 Bacteria 7343
236 Ga0105238_10080688 3300009551 Bacteria 3242
237 Ga0105238_10086701 3300009551 Unclassified 3118
238 Ga0105238_10580577 3300009551 Bacteria 1127
239 Ga0105238_12168502 3300009551 Bacteria 590
240 Ga0105249_12133420 3300009553 Bacteria 633
241 Ga0099796_10258889 3300010159 Unclassified 725
242 Ga0099796_10414736 3300010159 Bacteria 593
243 Ga0105239_10005545 3300010375 Bacteria 14772
244 Ga0105239_10019309 3300010375 Bacteria 7527
245 Ga0105239_10656201 3300010375 Bacteria 1198
246 Ga0105239_10881321 3300010375 Bacteria 1027
247 Ga0105246_10010641 3300011119 Bacteria 5699
248 Ga0105246_11260429 3300011119 Unclassified 683
249 Ga0105246_12060143 3300011119 Bacteria 552
250 Ga0157370_10005685 3300013104 Bacteria 13939
251 Ga0157370_10074105 3300013104 Bacteria 3211
252 Ga0157370_11164208 3300013104 Unclassified 696
253 Ga0157369_10244844 3300013105 Bacteria 1872
254 Ga0157374_10069175 3300013296 Bacteria 3324
255 Ga0157374_10457585 3300013296 Bacteria 1278
256 Ga0157374_10467567 3300013296 Bacteria 1263
257 Ga0157374_10719158 3300013296 Bacteria 1012
258 Ga0157378_10002294 3300013297 Bacteria 17000
259 Ga0157378_10168657 3300013297 Bacteria 2051
260 Ga0157378_10432027 3300013297 Unclassified 1303
261 Ga0157378_10531830 3300013297 Bacteria 1178
262 Ga0157378_10623175 3300013297 Bacteria 1092
263 Ga0157378_10858294 3300013297 Unclassified 936
264 Ga0157378_11290077 3300013297 Unclassified 771
265 Ga0163162_10157024 3300013306 Bacteria 2395
266 Ga0163162_10637291 3300013306 Bacteria 1190
267 Ga0163162_11579011 3300013306 Bacteria 748
268 Ga0163162_11655021 3300013306 Unclassified 731
269 Ga0157372_10213724 3300013307 Bacteria 2235
270 Ga0157372_10325243 3300013307 Unclassified 1790
271 Ga0157375_10296473 3300013308 Unclassified 1780
272 Ga0157375_10644002 3300013308 Bacteria 1216
273 Ga0157375_10660451 3300013308 Bacteria 1201
274 Ga0157375_10959143 3300013308 Unclassified 997
275 Ga0157375_11042635 3300013308 Unclassified 956
276 Ga0157375_11462175 3300013308 Bacteria 806
277 Ga0157375_13480772 3300013308 Unclassified 524
278 Ga0163163_10000335 3300014325 Bacteria 45290
279 Ga0163163_10003599 3300014325 Bacteria 13163
280 Ga0163163_10008622 3300014325 Bacteria 9066
281 Ga0163163_10009332 3300014325 Bacteria 8754
282 Ga0163163_10074157 3300014325 Bacteria 3394
283 Ga0163163_10200863 3300014325 Bacteria 2042
284 Ga0163163_10263768 3300014325 Bacteria 1774
285 Ga0163163_10845413 3300014325 Bacteria 979
286 Ga0157380_10126861 3300014326 Bacteria 2170
287 Ga0157380_10242370 3300014326 Bacteria 1626
288 Ga0157380_10903748 3300014326 Bacteria 909
289 Ga0157380_10960317 3300014326 Unclassified 885
290 Ga0157377_10266017 3300014745 Bacteria 1118
291 Ga0157379_10006591 3300014968 Bacteria 10023
292 Ga0157379_10009854 3300014968 Bacteria 8326
293 Ga0157379_10029985 3300014968 Bacteria 4837
294 Ga0157379_10177756 3300014968 Bacteria 1922
295 Ga0157379_10406050 3300014968 Bacteria 1253
296 Ga0157379_10432590 3300014968 Bacteria 1213
297 Ga0157379_10522777 3300014968 Bacteria 1102
298 Ga0157379_10538044 3300014968 Unclassified 1086
299 Ga0157379_10843967 3300014968 Bacteria 866
300 Ga0157379_11161685 3300014968 Unclassified 741
301 Ga0157376_10002397 3300014969 Bacteria 12659
302 Ga0157376_10176725 3300014969 Bacteria 1948
303 Ga0157376_10204365 3300014969 Bacteria 1820
304 Ga0157376_10380985 3300014969 Bacteria 1359
305 Ga0157376_10455452 3300014969 Bacteria 1249
306 Ga0157376_10577145 3300014969 Bacteria 1116
307 Ga0157376_10754389 3300014969 Unclassified 982
308 Ga0163161_10774437 3300017792 Bacteria 804
309 Ga0184599_119678 3300019188 Unclassified 674
310 Ga0213876_10194170 3300021384 Bacteria 1079
311 Ga0213875_10005308 3300021388 Bacteria 6931
312 Ga0213875_10014846 3300021388 Unclassified 3796
313 Ga0213875_10017533 3300021388 Bacteria 3457
314 Ga0213875_10032502 3300021388 Bacteria 2466
315 Ga0213875_10058045 3300021388 Bacteria 1812
316 Ga0213875_10286644 3300021388 Unclassified 778
317 Ga0207642_10413878 3300025899 Bacteria 809
318 Ga0207710_10022700 3300025900 Bacteria 2693
319 Ga0207710_10037821 3300025900 Unclassified 2133
320 Ga0207710_10049079 3300025900 Bacteria 1890
321 Ga0207680_10083452 3300025903 Bacteria 2014
322 Ga0207680_10569964 3300025903 Bacteria 809
323 Ga0207680_10950848 3300025903 Unclassified 616
324 Ga0207699_10272349 3300025906 Bacteria 1174
325 Ga0207699_10332190 3300025906 Bacteria 1069
326 Ga0207645_10147242 3300025907 Archaea 1536
327 Ga0207643_10319099 3300025908 Unclassified 970
328 Ga0207654_10008274 3300025911 Bacteria 5252
329 Ga0207654_10014623 3300025911 Bacteria 4057
330 Ga0207654_10016503 3300025911 Bacteria 3846
331 Ga0207654_10186474 3300025911 Bacteria 1356
332 Ga0207654_10189863 3300025911 Bacteria 1346
333 Ga0207707_10019292 3300025912 Bacteria 5950
334 Ga0207707_10154899 3300025912 Unclassified 2004
335 Ga0207695_10001831 3300025913 Bacteria 33414
336 Ga0207695_10024176 3300025913 Bacteria 6844
337 Ga0207695_10088726 3300025913 Bacteria 3112
338 Ga0207671_10041835 3300025914 Bacteria 3392
339 Ga0207671_10278320 3300025914 Bacteria 1319
340 Ga0207663_10125415 3300025916 Bacteria 1765
341 Ga0207663_10518942 3300025916 Bacteria 928
342 Ga0207663_10624215 3300025916 Bacteria 849
343 Ga0207681_10027675 3300025923 Bacteria 3668
344 Ga0207681_10466117 3300025923 Bacteria 1030
345 Ga0207694_10001340 3300025924 Bacteria 21217
346 Ga0207694_10025836 3300025924 Bacteria 4465
347 Ga0207694_10585184 3300025924 Bacteria 938
348 Ga0207694_10781435 3300025924 Unclassified 806
349 Ga0207650_11363980 3300025925 Bacteria 603
350 Ga0207659_10001498 3300025926 Bacteria 13921
351 Ga0207659_10207982 3300025926 Bacteria 1567
352 Ga0207687_10007444 3300025927 Bacteria 7208
353 Ga0207687_10008910 3300025927 Bacteria 6558
354 Ga0207687_10076245 3300025927 Bacteria 2408
355 Ga0207687_10111280 3300025927 Unclassified 2033
356 Ga0207700_10586530 3300025928 Bacteria 991
357 Ga0207644_10042011 3300025931 Bacteria 3238
358 Ga0207644_10744653 3300025931 Bacteria 818
359 Ga0207690_11612085 3300025932 Unclassified 542
360 Ga0207686_10002390 3300025934 Bacteria 10241
361 Ga0207686_10033591 3300025934 Bacteria 3064
362 Ga0207686_10174912 3300025934 Bacteria 1517
363 Ga0207686_10481552 3300025934 Bacteria 960
364 Ga0207686_10539479 3300025934 Unclassified 910
365 Ga0207686_10848676 3300025934 Bacteria 735
366 Ga0207686_11670116 3300025934 Bacteria 526
367 Ga0207709_10784115 3300025935 Unclassified 768
368 Ga0207709_11119458 3300025935 Bacteria 647
369 Ga0207670_10236409 3300025936 Bacteria 1405
370 Ga0207670_10299550 3300025936 Unclassified 1259
371 Ga0207670_10881642 3300025936 Unclassified 749
372 Ga0207670_11101614 3300025936 Bacteria 670
373 Ga0207669_10915248 3300025937 Bacteria 733
374 Ga0207704_10140079 3300025938 Bacteria 1690
375 Ga0207665_10203999 3300025939 Bacteria 1442
376 Ga0207691_10103296 3300025940 Bacteria 2541
377 Ga0207691_10443188 3300025940 Bacteria 1105
378 Ga0207711_10037569 3300025941 Unclassified 4115
379 Ga0207711_10124474 3300025941 Bacteria 2305
380 Ga0207711_10135865 3300025941 Bacteria 2208
381 Ga0207711_10263481 3300025941 Unclassified 1585
382 Ga0207711_10390175 3300025941 Bacteria 1293
383 Ga0207711_10948731 3300025941 Bacteria 799
384 Ga0207711_10988221 3300025941 Bacteria 781
385 Ga0207711_11136993 3300025941 Bacteria 722
386 Ga0207711_11489534 3300025941 Bacteria 620
387 Ga0207711_11554414 3300025941 Bacteria 605
388 Ga0207689_10367381 3300025942 Unclassified 1197
389 Ga0207689_10575352 3300025942 Unclassified 947
390 Ga0207661_10142325 3300025944 Bacteria 2065
391 Ga0207661_10331694 3300025944 Bacteria 1369
392 Ga0207679_10083062 3300025945 Bacteria 2454
393 Ga0207667_10002284 3300025949 Bacteria 24089
394 Ga0207667_10132185 3300025949 Bacteria 2571
395 Ga0207667_10240287 3300025949 Bacteria 1854
396 Ga0207667_10388547 3300025949 Bacteria 1421
397 Ga0207667_10618068 3300025949 Unclassified 1091
398 Ga0207640_10829120 3300025981 Bacteria 803
399 Ga0207658_10635916 3300025986 Bacteria 961
400 Ga0207658_10908769 3300025986 Bacteria 802
401 Ga0207677_10008232 3300026023 Bacteria 5812
402 Ga0207677_10259843 3300026023 Bacteria 1415
403 Ga0207677_10666996 3300026023 Bacteria 919
404 Ga0207703_10009029 3300026035 Bacteria 7851
405 Ga0207703_10009926 3300026035 Bacteria 7469
406 Ga0207703_10157766 3300026035 Bacteria 1985
407 Ga0207703_10168167 3300026035 Unclassified 1926
408 Ga0207703_10271387 3300026035 Bacteria 1537
409 Ga0207703_10600227 3300026035 Bacteria 1041
410 Ga0207703_11877564 3300026035 Bacteria 575
411 Ga0207639_10210846 3300026041 Bacteria 1672
412 Ga0207678_10855431 3300026067 Bacteria 804
413 Ga0207708_10002543 3300026075 Bacteria 13415
414 Ga0207708_10852275 3300026075 Unclassified 787
415 Ga0207702_10006565 3300026078 Bacteria 10003
416 Ga0207702_10030592 3300026078 Unclassified 4485
417 Ga0207702_10082607 3300026078 Bacteria 2794
418 Ga0207641_10010218 3300026088 Bacteria 7719
419 Ga0207641_10256845 3300026088 Bacteria 1634
420 Ga0207641_10296533 3300026088 Bacteria 1526
421 Ga0207641_10465905 3300026088 Bacteria 1223
422 Ga0207648_10021798 3300026089 Bacteria 5756
423 Ga0207648_10222627 3300026089 Unclassified 1677
424 Ga0207648_10231586 3300026089 Unclassified 1643
425 Ga0207648_10502576 3300026089 Bacteria 1109
426 Ga0207648_10794992 3300026089 Bacteria 880
427 Ga0207676_10064022 3300026095 Bacteria 2922
428 Ga0207676_10144052 3300026095 Unclassified 2044
429 Ga0207674_10003879 3300026116 Bacteria 18231
430 Ga0207674_10066551 3300026116 Bacteria 3629
431 Ga0207675_100106463 3300026118 Unclassified 2644
432 Ga0207675_100266881 3300026118 Bacteria 1660
433 Ga0207675_100410907 3300026118 Unclassified 1335
434 Ga0207675_101643934 3300026118 Bacteria 662
435 Ga0207683_10200905 3300026121 Bacteria 1812
436 Ga0207683_10292903 3300026121 Bacteria 1488
437 Ga0210000_1038920 3300027462 Unclassified 752
438 Ga0209974_10275489 3300027876 Unclassified 639
439 Ga0207428_10176002 3300027907 Bacteria 1618
440 Ga0268266_10437937 3300028379 Bacteria 1241
441 Ga0268266_10449845 3300028379 Bacteria 1224
442 Ga0268266_10947042 3300028379 Bacteria 833
443 Ga0268265_10242350 3300028380 Bacteria 1592
444 Ga0268265_10397397 3300028380 Bacteria 1273
445 Ga0268265_11933348 3300028380 Unclassified 597
446 Ga0268264_10127214 3300028381 Bacteria 2254
447 Ga0268264_10506050 3300028381 Bacteria 1179
448 Ga0268264_10834302 3300028381 Bacteria 922
449 Ga0268264_11323579 3300028381 Unclassified 731
450 Ga0265322_10098231 3300028654 Unclassified 833
451 Ga0265338_10535244 3300028800 Bacteria 822
452 Ga0265766_1021483 3300030863 Unclassified 534
453 Ga0265332_10352325 3300031238 Unclassified 607
454 Ga0265328_10064828 3300031239 Bacteria 1342
455 Ga0265339_10153668 3300031249 Bacteria 1162
456 Ga0265331_10412052 3300031250 Unclassified 606
457 Ga0307408_101886436 3300031548 Bacteria 573
458 Ga0265314_10000373 3300031711 Bacteria 61369
459 Ga0265342_10064848 3300031712 Bacteria 2142
460 Ga0307405_10446570 3300031731 Unclassified 1024
461 Ga0307413_10548519 3300031824 Bacteria 937
462 Ga0307406_10239251 3300031901 Bacteria 1361
463 Ga0307409_100647663 3300031995 Bacteria 1050
464 Ga0307416_102589758 3300032002 Unclassified 605
465 Ga0307411_10094624 3300032005 Archaea 2095
466 Ga0316053_103706 3300032120 Bacteria 917
467 Ga0307415_100288238 3300032126 Bacteria 1354
468 Ga0373926_0141225 3300035083 Bacteria 915
469 Ga0373926_0422991 3300035083 Unclassified 527
470 Ga0373934_0044115 3300035086 Bacteria 1762
471 Ga0373934_0085935 3300035086 Bacteria 1266
472 Ga0373951_0153924 3300035091 Unclassified 646
473 Ga0373923_0123014 3300035111 Bacteria 1161
474 Ga0373936_0096620 3300035113 Bacteria 1243
475 Ga0373936_0118052 3300035113 Bacteria 1131
476 Ga0373936_0397343 3300035113 Bacteria 632
477 Ga0373945_0035055 3300035116 Bacteria 1792
478 Ga0373945_0258824 3300035116 Bacteria 737
479 Ga0373954_0393916 3300035118 Unclassified 685
480 Ga0373956_0048818 3300035119 Bacteria 1897
481 Ga0373956_0150559 3300035119 Bacteria 1095
482 Ga0373956_0170606 3300035119 Bacteria 1027
483 Ga0373956_0229852 3300035119 Unclassified 881
484 Ga0373956_0292651 3300035119 Bacteria 775
485 Ga0373956_0490973 3300035119 Bacteria 586
486 Ga0373957_0108810 3300035120 Bacteria 1115
487 Ga0373957_0119475 3300035120 Unclassified 1066
488 Ga0373943_0027769 3300035170 Bacteria 2662
489 Ga0373943_0494209 3300035170 Bacteria 714
490 Ga0373946_0066739 3300035171 Bacteria 1543
491 Ga0373946_0604935 3300035171 Bacteria 569
492 Ga0373946_0754587 3300035171 Unclassified 511
493 Ga0373955_0119596 3300035172 Bacteria 1530
494 Ga0373955_0147054 3300035172 Unclassified 1385
495 Ga0373955_0170191 3300035172 Bacteria 1289
496 Ga0373955_0381947 3300035172 Unclassified 855
497 Ga0373955_0959011 3300035172 Unclassified 526
498 Ga0373924_0006729 3300035410 Bacteria 4128
499 Ga0373935_0235228 3300035692 Bacteria 1277
500 Ga0373927_0066964 3300035695 Bacteria 2324
501 Ga0373927_0069353 3300035695 Bacteria 2282
502 Ga0373927_0160132 3300035695 Bacteria 1474
503 Ga0373927_0488128 3300035695 Bacteria 814
504 Ga0373933_0022280 3300035724 Bacteria 3606
505 Ga0373933_0129743 3300035724 Bacteria 1584
506 Ga0373933_0236110 3300035724 Bacteria 1175
507 Ga0373933_0712080 3300035724 Unclassified 660
508 Ga0373947_0297556 3300035725 Bacteria 1075
509 Ga0373937_0002529 3300036401 Bacteria 15180
510 Ga0373937_0016010 3300036401 Bacteria 6650
511 Ga0373937_0021590 3300036401 Bacteria 5777
512 Ga0373937_0376941 3300036401 Unclassified 1345
513 Ga0373937_0600242 3300036401 Bacteria 1045
514 Ga0373937_0627772 3300036401 Bacteria 1020
515 Ga0265778_001995 3300036457 Bacteria 1923
516 Ga0265778_052307 3300036457 Bacteria 561
517 Ga0373925_0015240 3300037068 Bacteria 5558
518 Ga0373925_0119653 3300037068 Bacteria 2043
519 Ga0373925_0476274 3300037068 Bacteria 1024
520 Ga0436364_0095879 3300037853 Unclassified 1770
521 Ga0436364_0416069 3300037853 Bacteria 11246
522 Ga0436364_0539637 3300037853 Unclassified 760
523 Ga0436364_0594990 3300037853 Bacteria 1648
524 Ga0436364_0612439 3300037853 Plasmid 2901
525 Ga0436364_0631782 3300037853 Unclassified 740
526 Ga0436364_0741686 3300037853 Bacteria 2695
527 Ga0436364_0900852 3300037853 Bacteria 1555
528 Ga0436364_0955889 3300037853 Bacteria 3097
529 Ga0436365_0973300 3300039437 Bacteria 4029
530 Ga0436363_1200123 3300039450 Bacteria 1474
531 Ga0439439_0125188 3300041406 Bacteria 719
532 Ga0439439_0167613 3300041406 Bacteria 629
533 Ga0439453_0003914 3300041408 Bacteria 2181
534 Ga0451853_2760430 3300041512 Unclassified 948
535 Ga0439433_0114675 3300041999 Unclassified 676
536 Ga0450923_103917 3300042125 Bacteria 658
537 Ga0450888_072451 3300042126 Unclassified 520
538 Ga0450896_016390 3300042133 Bacteria 1064
539 Ga0439446_0140832 3300042156 Bacteria 788
540 Ga0439434_0080510 3300042435 Bacteria 1033
541 Ga0439435_0074507 3300042436 Unclassified 1010
542 Ga0439464_0160072 3300042439 Unclassified 707
543 Ga0439460_0338023 3300042461 Unclassified 530
544 Ga0466967_0756503 3300045976 Unclassified 964
545 Ga0495592_0016047 3300046454 Bacteria 5684
546 Ga0495592_0029498 3300046454 Bacteria 4154
547 Ga0495592_0090439 3300046454 Unclassified 2196
548 Ga0495629_0104467 3300046459 Bacteria 1976
549 Ga0495629_0245236 3300046459 Bacteria 1233
550 Ga0495651_0147120 3300046462 Bacteria 1702
551 Ga0495653_0225375 3300046463 Bacteria 1258
552 Ga0495653_0501248 3300046463 Unclassified 757
553 Ga0495580_0019830 3300046472 Bacteria 4989
554 Ga0495580_0050111 3300046472 Unclassified 2953
555 Ga0495580_0708650 3300046472 Bacteria 658
556 Ga0495582_0171508 3300046473 Bacteria 1235
557 Ga0495639_0173486 3300046475 Bacteria 1047
558 Ga0495639_0536049 3300046475 Bacteria 599
559 Ga0495662_0178979 3300046476 Bacteria 1045
560 Ga0495664_0143588 3300046477 Unclassified 1447
561 Ga0495594_0144841 3300046499 Bacteria 1348
562 Ga0495594_0257846 3300046499 Bacteria 993
563 Ga0495594_0360437 3300046499 Bacteria 828
564 Ga0495608_0023848 3300046511 Unclassified 4187
565 Ga0495608_0048859 3300046511 Bacteria 2810
566 Ga0495608_0272828 3300046511 Bacteria 1051
567 Ga0495618_0063425 3300046514 Bacteria 2346
568 Ga0495618_0323763 3300046514 Bacteria 954
569 Ga0495630_0004984 3300046517 Bacteria 9341
570 Ga0495630_0202108 3300046517 Bacteria 1516
571 Ga0495666_0164530 3300046526 Unclassified 1028
572 Ga0495652_0201865 3300046529 Bacteria 1508
573 Ga0495652_0312772 3300046529 Bacteria 1137
574 Ga0495665_0239082 3300046531 Bacteria 936
575 Ga0495665_0330199 3300046531 Bacteria 778
576 Ga0495665_0466128 3300046531 Unclassified 638
577 Ga0495586_0060103 3300046535 Bacteria 2066
578 Ga0495586_0452414 3300046535 Bacteria 740
579 Ga0495587_0580836 3300046536 Unclassified 617
580 Ga0495645_0026526 3300046543 Bacteria 4206
581 Ga0495645_0106650 3300046543 Bacteria 1987
582 Ga0495633_0247278 3300046558 Bacteria 814
583 Ga0495667_0000906 3300046559 Bacteria 19126
584 Ga0495667_0044844 3300046559 Unclassified 2928
585 Ga0495667_0058126 3300046559 Bacteria 2541
586 Ga0495634_0288095 3300046642 Bacteria 996
587 Ga0495635_0108139 3300046663 Bacteria 1900
588 Ga0495635_0198307 3300046663 Bacteria 1362
589 Ga0495635_0292768 3300046663 Unclassified 1092
590 Ga0495588_0640639 3300046674 Bacteria 556
591 Ga0495657_0164989 3300046675 Unclassified 1368
592 Ga0495599_0093942 3300046678 Bacteria 1871
593 Ga0495599_0396697 3300046678 Unclassified 822
594 Ga0495647_0040113 3300046681 Bacteria 1778
595 Ga0495658_0131508 3300046683 Bacteria 1524
596 Ga0495658_0885624 3300046683 Unclassified 571
597 Ga0495669_0015199 3300046684 Bacteria 3295
598 Ga0495613_0000643 3300046689 Bacteria 27730
599 Ga0495613_0231113 3300046689 Bacteria 1295
600 Ga0495600_0006887 3300046809 Bacteria 6934
601 Ga0495581_0055656 3300047315 Unclassified 2283
602 Ga0495581_0398889 3300047315 Bacteria 802
603 Ga0495604_0005836 3300047317 Bacteria 9761
604 Ga0495604_0341476 3300047317 Bacteria 997
605 Ga0495674_0048845 3300047319 Bacteria 3742
606 Ga0495674_0059410 3300047319 Bacteria 3339
607 Ga0495674_0073897 3300047319 Bacteria 2937
608 Ga0495674_0169578 3300047319 Bacteria 1822
609 Ga0495680_0085559 3300047322 Unclassified 2374
610 Ga0495680_0381435 3300047322 Bacteria 976
611 Ga0495684_0000494 3300047471 Bacteria 32208
612 Ga0495684_0138532 3300047471 Bacteria 1825
613 Ga0495684_0325688 3300047471 Unclassified 1097
614 Ga0495684_0332238 3300047471 Unclassified 1084
615 Ga0495602_0001193 3300048088 Bacteria 25517
616 Ga0495602_0404632 3300048088 Bacteria 973
617 Ga0495614_0568106 3300048089 Bacteria 543
618 Ga0496100_0016846 3300048903 Bacteria 4299
619 Ga0496101_0002267 3300048904 Bacteria 11752
620 Ga0496101_0823734 3300048904 Bacteria 732
621 Ga0496104_0095798 3300048907 Bacteria 2839
622 Ga0496104_0353541 3300048907 Unclassified 1382
623 Ga0496105_0392933 3300048908 Bacteria 1102
624 Ga0496105_0606205 3300048908 Bacteria 849
625 Ga0496105_0924951 3300048908 Bacteria 656
626 Ga0496105_1284418 3300048908 Bacteria 535
627 Ga0496106_0045654 3300048909 Bacteria 3292
628 Ga0496106_0192753 3300048909 Unclassified 1621
629 Ga0496106_0569146 3300048909 Bacteria 909
630 Ga0496107_0664207 3300048910 Bacteria 768
631 Ga0496108_1642057 3300048911 Bacteria 531
632 Ga0496109_0055352 3300048912 Bacteria 3619
633 Ga0496109_1157746 3300048912 Bacteria 710
634 Ga0496110_0327381 3300048913 Unclassified 1396
635 Ga0496112_0341037 3300048915 Bacteria 1442
636 Ga0496112_0458147 3300048915 Unclassified 1213
637 Ga0496112_1105622 3300048915 Bacteria 711
638 Ga0496113_0106579 3300048916 Bacteria 2177
639 Ga0496114_0041138 3300048917 Bacteria 3829
640 Ga0496114_0570707 3300048917 Bacteria 999
641 Ga0496114_0606960 3300048917 Bacteria 965
642 Ga0496114_0822087 3300048917 Unclassified 808
643 Ga0496114_1103185 3300048917 Bacteria 678
644 Ga0496115_0710229 3300048918 Bacteria 789
645 Ga0496115_0811945 3300048918 Bacteria 727
646 Ga0501033_0679924 3300049570 Bacteria 701
647 Ga0501037_0185043 3300049573 Bacteria 1477
648 Ga0501039_0199844 3300049575 Bacteria 1572
649 Ga0501040_0313121 3300049576 Unclassified 1122
650 Ga0501041_0714095 3300049577 Unclassified 642
651 Ga0501041_0927945 3300049577 Unclassified 559
652 Ga0501042_0410609 3300049578 Unclassified 981
653 Ga0501042_0672390 3300049578 Unclassified 753
654 Ga0501043_0297407 3300049579 Bacteria 1234
655 Ga0501046_0184520 3300049580 Unclassified 1558
656 Ga0501068_0234813 3300049584 Bacteria 1166
657 Ga0501070_1467426 3300049586 Bacteria 517
658 Ga0501071_0065873 3300049587 Bacteria 2631
659 Ga0501072_0101691 3300049588 Unclassified 2284
660 Ga0501073_0901075 3300049589 Unclassified 609
661 Ga0501075_0290918 3300049591 Bacteria 1244
662 Ga0501076_0002896 3300049592 Bacteria 11883
663 Ga0501076_0872333 3300049592 Bacteria 742
664 Ga0501077_0068628 3300049593 Unclassified 2247
665 Ga0501079_0039251 3300049741 Unclassified 3651
666 Ga0501079_0849129 3300049741 Bacteria 719
667 Ga0501079_0949570 3300049741 Bacteria 677
668 Ga0501080_0073554 3300049742 Bacteria 3180
669 Ga0501080_0141878 3300049742 Unclassified 2221
670 Ga0501081_1051437 3300049743 Bacteria 616
671 Ga0501045_0018244 3300049824 Bacteria 4989
672 Ga0501045_0161148 3300049824 Unclassified 1670
673 nmdc:mga05p37_120792_c1 3300050507 Bacteria 3219
674 nmdc:mga05p37_2088735_c1 3300050507 Bacteria 531
675 nmdc:mga05p37_402188_c1 3300050507 Bacteria 1599
676 nmdc:mga05p37_79040_c1 3300050507 Bacteria 4050
677 nmdc:mga05p37_81859_c1 3300050507 Bacteria 3977
678 nmdc:mga09592_1024338_c1 3300050508 Bacteria 689
679 nmdc:mga09592_112377_c1 3300050508 Bacteria 2337
680 nmdc:mga09592_124350_c1 3300050508 Bacteria 2217
681 nmdc:mga09592_834326_c1 3300050508 Bacteria 778
682 nmdc:mga09592_931478_c1 3300050508 Bacteria 729
683 nmdc:mga0qj67_19433_c1 3300050509 Bacteria 5190
684 nmdc:mga0qj67_40622_c1 3300050509 Bacteria 3656
685 nmdc:mga06r32_35895_c1 3300050510 Bacteria 4679
686 nmdc:mga06r32_8103_c1 3300050510 Bacteria 9451
687 nmdc:mga08y16_19920_c1 3300050511 Bacteria 7077
688 nmdc:mga08y16_450401_c1 3300050511 Bacteria 1312
689 nmdc:mga08y16_544943_c1 3300050511 Bacteria 1175
690 nmdc:mga08y16_906319_c1 3300050511 Bacteria 867
691 nmdc:mga0n895_128148_c1 3300050512 Bacteria 2562
692 nmdc:mga0n895_159974_c1 3300050512 Unclassified 2284
693 nmdc:mga0n895_160553_c1 3300050512 Bacteria 2279
694 nmdc:mga0rr50_110570_c1 3300050513 Unclassified 2174
695 nmdc:mga0rr50_82142_c1 3300050513 Bacteria 2488
696 nmdc:mga0a205_460224_c1 3300050515 Unclassified 1132
697 Ga0495612_0607072 3300053078 Unclassified 506
698 Ga0495595_0122927 3300053084 Bacteria 1265
699 Ga0495595_0706337 3300053084 Unclassified 517
700 Ga0495619_0018251 3300053085 Unclassified 4451
701 Ga0495619_0028742 3300053085 Bacteria 3588
702 Ga0495619_0645696 3300053085 Bacteria 722
703 Ga0500568_0000749 3300053139 Bacteria 23216
704 Ga0501084_0517726 3300054114 Bacteria 1008
705 Ga0501082_0040851 3300060353 Bacteria 3999
706 Ga0530510_0302201 3300061734 Bacteria 1197
707 Ga0530510_0554683 3300061734 Bacteria 873
708 Ga0157380_10863756
709 JGI24743J22301_10127712
710 Ga0058859_11547489
711 Ga0058860_12144590
712 Ga0058862_12827608
713 Ga0058862_12841748
714 Ga0065712_10068186
715 Ga0065712_10353139
716 Ga0065715_10495466
717 Ga0065707_10257919
718 Ga0070658_10557524
719 Ga0070676_10511361
720 Ga0070683_100159465
721 Ga0070683_100464459
722 Ga0070683_100486858
723 Ga0070683_101455734
724 Ga0070690_100015296
725 Ga0070670_100281425
726 Ga0070670_101758835
727 Ga0070677_10330331
728 Ga0068869_100089643
729 Ga0068869_100581786
730 Ga0070666_10056850
731 Ga0070666_10197375
732 Ga0070666_10434905
733 Ga0070666_11046732
734 Ga0070682_101230543
735 Ga0070682_101587716
736 Ga0068868_100014728
737 Ga0068868_101145356
738 Ga0070660_100461806
739 Ga0070689_100081212
740 Ga0070689_102076563
741 Ga0070661_100874445
742 Ga0070668_100173191
743 Ga0070668_101592023
744 Ga0070669_100018199
745 Ga0070669_100158924
746 Ga0070669_100833803
747 Ga0070675_100004550
748 Ga0070675_100020502
749 Ga0070675_100096550
750 Ga0070675_100190229
751 Ga0070675_101117276
752 Ga0070671_100037673
753 Ga0070671_100088144
754 Ga0070671_100914167
755 Ga0070671_101091366
756 Ga0070674_100017416
757 Ga0070674_100632677
758 Ga0070674_100641587
759 Ga0070674_100996041
760 Ga0070673_101074385
761 Ga0070673_101326912
762 Ga0070688_100054435
763 Ga0070688_100975801
764 Ga0070688_101342155
765 Ga0070703_10085358
766 Ga0070713_100202348
767 Ga0070713_100299102
768 Ga0070713_100809956
769 Ga0070701_10883619
770 Ga0070711_100070201
771 Ga0070711_100393474
772 Ga0070711_100585793
773 Ga0070705_100764171
774 Ga0070708_100413415
775 Ga0070663_100235633
776 Ga0070678_100177199
777 Ga0070678_100269575
778 Ga0070678_101491158
779 Ga0070681_10052512
780 Ga0070681_10179624
781 Ga0070681_10522379
782 Ga0068867_100045993
783 Ga0068867_102241395
784 Ga0070685_10455532
785 Ga0070699_100493992
786 Ga0070699_100842875
787 Ga0070699_101660652
788 Ga0070684_100446974
789 Ga0070684_100488292
790 Ga0070697_100047066
791 Ga0068853_100195466
792 Ga0068853_100428954
793 Ga0068853_101180170
794 Ga0070672_100819038
795 Ga0070672_100877228
796 Ga0070665_100333317
797 Ga0070665_100561398
798 Ga0068855_100001733
799 Ga0068855_100062911
800 Ga0068855_100154677
801 Ga0068855_100407513
802 Ga0068855_100809441
803 Ga0070664_101192026
804 Ga0070664_101423273
805 Ga0068857_100002727
806 Ga0068857_100003583
807 Ga0068857_100101545
808 Ga0068857_102499806
809 Ga0068856_100004088
810 Ga0068856_100017451
811 Ga0068856_100034816
812 Ga0068856_100353515
813 Ga0070702_101557164
814 Ga0068859_100025969
815 Ga0068859_100087789
816 Ga0068859_100613346
817 Ga0068859_100809629
818 Ga0068859_102783497
819 Ga0068864_100001500
820 Ga0068864_100149681
821 Ga0068864_100590589
822 Ga0068866_10490495
823 Ga0068866_10602723
824 Ga0068861_100023381
825 Ga0068861_100231580
826 Ga0068861_101599022
827 Ga0068861_101736901
828 Ga0068863_100019107
829 Ga0068863_100035530
830 Ga0068863_100068603
831 Ga0068863_100494393
832 Ga0068863_100649022
833 Ga0068863_100920657
834 Ga0068863_101524604
835 Ga0068858_100009936
836 Ga0068858_100068244
837 Ga0068858_100127205
838 Ga0068858_100192462
839 Ga0068858_100494363
840 Ga0068858_100547860
841 Ga0068858_101151376
842 Ga0068858_102308920
843 Ga0068860_100038493
844 Ga0068860_100038598
845 Ga0068860_100112679
846 Ga0068860_100171880
847 Ga0068860_100648112
848 Ga0068862_100616971
849 Ga0068862_101815921
850 Ga0070717_10181253
851 Ga0070717_10551059
852 Ga0070715_10596561
853 Ga0070716_100139210
854 Ga0097621_100019829
855 Ga0097621_100068356
856 Ga0097621_100093094
857 Ga0097621_100179893
858 Ga0097621_100200956
859 Ga0068871_100003608
860 Ga0068871_100028832
861 Ga0068871_100047174
862 Ga0068871_100186930
863 Ga0068871_100575354
864 Ga0068871_101247710
865 Ga0075428_100047248
866 Ga0075428_101115230
867 Ga0075430_100011998
868 Ga0075430_100063327
869 Ga0075430_100157739
870 Ga0075431_100015251
871 Ga0075431_100057610
872 Ga0075433_10548518
873 Ga0075434_100516462
874 Ga0075429_100072558
875 Ga0075429_100129733
876 Ga0068865_100222862
877 Ga0075436_100274034
878 Ga0097620_100025969
879 Ga0097620_100087789
880 Ga0097620_100613347
881 Ga0097620_100809529
882 Ga0097620_102784060
883 Ga0075435_100041151
884 Ga0099794_10488507
885 Ga0099795_10200230
886 Ga0105240_10002654
887 Ga0105240_10197379
888 Ga0105240_10384330
889 Ga0105240_11899005
890 Ga0111539_10017785
891 Ga0111539_10025546
892 Ga0105245_10006384
893 Ga0105245_10011243
894 Ga0105245_10057554
895 Ga0105245_10109654
896 Ga0105245_10191773
897 Ga0105245_10311737
898 Ga0105245_10469327
899 Ga0105245_10656773
900 Ga0105245_10955408
901 Ga0105247_10073018
902 Ga0105247_10079636
903 Ga0105247_11296434
904 Ga0114129_10161846
905 Ga0114129_10181891
906 Ga0114129_10202495
907 Ga0105243_10054742
908 Ga0105243_10089003
909 Ga0105243_10107213
910 Ga0105243_10581353
911 Ga0105243_10968226
912 Ga0105241_10031242
913 Ga0105241_10037061
914 Ga0105241_10039911
915 Ga0105241_10110444
916 Ga0105241_10267709
917 Ga0105241_10275327
918 Ga0105242_10004936
919 Ga0105242_10016108
920 Ga0105242_10020384
921 Ga0105242_10190195
922 Ga0105242_10368641
923 Ga0105242_10506306
924 Ga0105242_10907025
925 Ga0105248_10052752
926 Ga0105248_10062297
927 Ga0105248_10078102
928 Ga0105248_10127069
929 Ga0105248_10275980
930 Ga0105248_10309287
931 Ga0105248_10410754
932 Ga0105248_10566672
933 Ga0105248_11033163
934 Ga0105248_11247753
935 Ga0105248_11264047
936 Ga0105248_11691770
937 Ga0105248_13108584
938 Ga0105237_10007273
939 Ga0105237_10042107
940 Ga0105237_10077876
941 Ga0105237_10485522
942 Ga0105238_10017209
943 Ga0105238_10080688
944 Ga0105238_10086701
945 Ga0105238_10580577
946 Ga0105238_12168502
947 Ga0105249_12133420
948 Ga0099796_10258889
949 Ga0099796_10414736
950 Ga0105239_10005545
951 Ga0105239_10019309
952 Ga0105239_10656201
953 Ga0105239_10881321
954 Ga0105246_10010641
955 Ga0105246_11260429
956 Ga0105246_12060143
957 Ga0157370_10005685
958 Ga0157370_10074105
959 Ga0157370_11164208
960 Ga0157369_10244844
961 Ga0157374_10069175
962 Ga0157374_10457585
963 Ga0157374_10467567
964 Ga0157374_10719158
965 Ga0157378_10002294
966 Ga0157378_10168657
967 Ga0157378_10432027
968 Ga0157378_10531830
969 Ga0157378_10623175
970 Ga0157378_10858294
971 Ga0157378_11290077
972 Ga0163162_10157024
973 Ga0163162_10637291
974 Ga0163162_11579011
975 Ga0163162_11655021
976 Ga0157372_10213724
977 Ga0157372_10325243
978 Ga0157375_10296473
979 Ga0157375_10644002
980 Ga0157375_10660451
981 Ga0157375_10959143
982 Ga0157375_11042635
983 Ga0157375_11462175
984 Ga0157375_13480772
985 Ga0163163_10000335
986 Ga0163163_10003599
987 Ga0163163_10008622
988 Ga0163163_10009332
989 Ga0163163_10074157
990 Ga0163163_10200863
991 Ga0163163_10263768
992 Ga0163163_10845413
993 Ga0157380_10126861
994 Ga0157380_10242370
995 Ga0157380_10903748
996 Ga0157380_10960317
997 Ga0157377_10266017
998 Ga0157379_10006591
999 Ga0157379_10009854
1000 Ga0157379_10029985
1001 Ga0157379_10177756
1002 Ga0157379_10406050
1003 Ga0157379_10432590
1004 Ga0157379_10522777
1005 Ga0157379_10538044
1006 Ga0157379_10843967
1007 Ga0157379_11161685
1008 Ga0157376_10002397
1009 Ga0157376_10176725
1010 Ga0157376_10204365
1011 Ga0157376_10380985
1012 Ga0157376_10455452
1013 Ga0157376_10577145
1014 Ga0157376_10754389
1015 Ga0163161_10774437
1016 Ga0184599_119678
1017 Ga0213876_10194170
1018 Ga0213875_10005308
1019 Ga0213875_10014846
1020 Ga0213875_10017533
1021 Ga0213875_10032502
1022 Ga0213875_10058045
1023 Ga0213875_10286644
1024 Ga0207642_10413878
1025 Ga0207710_10022700
1026 Ga0207710_10037821
1027 Ga0207710_10049079
1028 Ga0207680_10083452
1029 Ga0207680_10569964
1030 Ga0207680_10950848
1031 Ga0207699_10272349
1032 Ga0207699_10332190
1033 Ga0207645_10147242
1034 Ga0207643_10319099
1035 Ga0207654_10008274
1036 Ga0207654_10014623
1037 Ga0207654_10016503
1038 Ga0207654_10186474
1039 Ga0207654_10189863
1040 Ga0207707_10019292
1041 Ga0207707_10154899
1042 Ga0207695_10001831
1043 Ga0207695_10024176
1044 Ga0207695_10088726
1045 Ga0207671_10041835
1046 Ga0207671_10278320
1047 Ga0207663_10125415
1048 Ga0207663_10518942
1049 Ga0207663_10624215
1050 Ga0207681_10027675
1051 Ga0207681_10466117
1052 Ga0207694_10001340
1053 Ga0207694_10025836
1054 Ga0207694_10585184
1055 Ga0207694_10781435
1056 Ga0207650_11363980
1057 Ga0207659_10001498
1058 Ga0207659_10207982
1059 Ga0207687_10007444
1060 Ga0207687_10008910
1061 Ga0207687_10076245
1062 Ga0207687_10111280
1063 Ga0207700_10586530
1064 Ga0207644_10042011
1065 Ga0207644_10744653
1066 Ga0207690_11612085
1067 Ga0207686_10002390
1068 Ga0207686_10033591
1069 Ga0207686_10174912
1070 Ga0207686_10481552
1071 Ga0207686_10539479
1072 Ga0207686_10848676
1073 Ga0207686_11670116
1074 Ga0207709_10784115
1075 Ga0207709_11119458
1076 Ga0207670_10236409
1077 Ga0207670_10299550
1078 Ga0207670_10881642
1079 Ga0207670_11101614
1080 Ga0207669_10915248
1081 Ga0207704_10140079
1082 Ga0207665_10203999
1083 Ga0207691_10103296
1084 Ga0207691_10443188
1085 Ga0207711_10037569
1086 Ga0207711_10124474
1087 Ga0207711_10135865
1088 Ga0207711_10263481
1089 Ga0207711_10390175
1090 Ga0207711_10948731
1091 Ga0207711_10988221
1092 Ga0207711_11136993
1093 Ga0207711_11489534
1094 Ga0207711_11554414
1095 Ga0207689_10367381
1096 Ga0207689_10575352
1097 Ga0207661_10142325
1098 Ga0207661_10331694
1099 Ga0207679_10083062
1100 Ga0207667_10002284
1101 Ga0207667_10132185
1102 Ga0207667_10240287
1103 Ga0207667_10388547
1104 Ga0207667_10618068
1105 Ga0207640_10829120
1106 Ga0207658_10635916
1107 Ga0207658_10908769
1108 Ga0207677_10008232
1109 Ga0207677_10259843
1110 Ga0207677_10666996
1111 Ga0207703_10009029
1112 Ga0207703_10009926
1113 Ga0207703_10157766
1114 Ga0207703_10168167
1115 Ga0207703_10271387
1116 Ga0207703_10600227
1117 Ga0207703_11877564
1118 Ga0207639_10210846
1119 Ga0207678_10855431
1120 Ga0207708_10002543
1121 Ga0207708_10852275
1122 Ga0207702_10006565
1123 Ga0207702_10030592
1124 Ga0207702_10082607
1125 Ga0207641_10010218
1126 Ga0207641_10256845
1127 Ga0207641_10296533
1128 Ga0207641_10465905
1129 Ga0207648_10021798
1130 Ga0207648_10222627
1131 Ga0207648_10231586
1132 Ga0207648_10502576
1133 Ga0207648_10794992
1134 Ga0207676_10064022
1135 Ga0207676_10144052
1136 Ga0207674_10003879
1137 Ga0207674_10066551
1138 Ga0207675_100106463
1139 Ga0207675_100266881
1140 Ga0207675_100410907
1141 Ga0207675_101643934
1142 Ga0207683_10200905
1143 Ga0207683_10292903
1144 Ga0210000_1038920
1145 Ga0209974_10275489
1146 Ga0207428_10176002
1147 Ga0268266_10437937
1148 Ga0268266_10449845
1149 Ga0268266_10947042
1150 Ga0268265_10242350
1151 Ga0268265_10397397
1152 Ga0268265_11933348
1153 Ga0268264_10127214
1154 Ga0268264_10506050
1155 Ga0268264_10834302
1156 Ga0268264_11323579
1157 Ga0265322_10098231
1158 Ga0265338_10535244
1159 Ga0265766_1021483
1160 Ga0265332_10352325
1161 Ga0265328_10064828
1162 Ga0265339_10153668
1163 Ga0265331_10412052
1164 Ga0307408_101886436
1165 Ga0265314_10000373
1166 Ga0265342_10064848
1167 Ga0307405_10446570
1168 Ga0307413_10548519
1169 Ga0307406_10239251
1170 Ga0307409_100647663
1171 Ga0307416_102589758
1172 Ga0307411_10094624
1173 Ga0316053_103706
1174 Ga0307415_100288238
1175 Ga0373926_0141225
1176 Ga0373926_0422991
1177 Ga0373934_0044115
1178 Ga0373934_0085935
1179 Ga0373951_0153924
1180 Ga0373923_0123014
1181 Ga0373936_0096620
1182 Ga0373936_0118052
1183 Ga0373936_0397343
1184 Ga0373945_0035055
1185 Ga0373945_0258824
1186 Ga0373954_0393916
1187 Ga0373956_0048818
1188 Ga0373956_0150559
1189 Ga0373956_0170606
1190 Ga0373956_0229852
1191 Ga0373956_0292651
1192 Ga0373956_0490973
1193 Ga0373957_0108810
1194 Ga0373957_0119475
1195 Ga0373943_0027769
1196 Ga0373943_0494209
1197 Ga0373946_0066739
1198 Ga0373946_0604935
1199 Ga0373946_0754587
1200 Ga0373955_0119596
1201 Ga0373955_0147054
1202 Ga0373955_0170191
1203 Ga0373955_0381947
1204 Ga0373955_0959011
1205 Ga0373924_0006729
1206 Ga0373935_0235228
1207 Ga0373927_0066964
1208 Ga0373927_0069353
1209 Ga0373927_0160132
1210 Ga0373927_0488128
1211 Ga0373933_0022280
1212 Ga0373933_0129743
1213 Ga0373933_0236110
1214 Ga0373933_0712080
1215 Ga0373947_0297556
1216 Ga0373937_0002529
1217 Ga0373937_0016010
1218 Ga0373937_0021590
1219 Ga0373937_0376941
1220 Ga0373937_0600242
1221 Ga0373937_0627772
1222 Ga0265778_001995
1223 Ga0265778_052307
1224 Ga0373925_0015240
1225 Ga0373925_0119653
1226 Ga0373925_0476274
1227 Ga0436364_0095879
1228 Ga0436364_0416069
1229 Ga0436364_0539637
1230 Ga0436364_0594990
1231 Ga0436364_0612439
1232 Ga0436364_0631782
1233 Ga0436364_0741686
1234 Ga0436364_0900852
1235 Ga0436364_0955889
1236 Ga0436365_0973300
1237 Ga0436363_1200123
1238 Ga0439439_0125188
1239 Ga0439439_0167613
1240 Ga0439453_0003914
1241 Ga0451853_2760430
1242 Ga0439433_0114675
1243 Ga0450923_103917
1244 Ga0450888_072451
1245 Ga0450896_016390
1246 Ga0439446_0140832
1247 Ga0439434_0080510
1248 Ga0439435_0074507
1249 Ga0439464_0160072
1250 Ga0439460_0338023
1251 Ga0466967_0756503
1252 Ga0495592_0016047
1253 Ga0495592_0029498
1254 Ga0495592_0090439
1255 Ga0495629_0104467
1256 Ga0495629_0245236
1257 Ga0495651_0147120
1258 Ga0495653_0225375
1259 Ga0495653_0501248
1260 Ga0495580_0019830
1261 Ga0495580_0050111
1262 Ga0495580_0708650
1263 Ga0495582_0171508
1264 Ga0495639_0173486
1265 Ga0495639_0536049
1266 Ga0495662_0178979
1267 Ga0495664_0143588
1268 Ga0495594_0144841
1269 Ga0495594_0257846
1270 Ga0495594_0360437
1271 Ga0495608_0023848
1272 Ga0495608_0048859
1273 Ga0495608_0272828
1274 Ga0495618_0063425
1275 Ga0495618_0323763
1276 Ga0495630_0004984
1277 Ga0495630_0202108
1278 Ga0495666_0164530
1279 Ga0495652_0201865
1280 Ga0495652_0312772
1281 Ga0495665_0239082
1282 Ga0495665_0330199
1283 Ga0495665_0466128
1284 Ga0495586_0060103
1285 Ga0495586_0452414
1286 Ga0495587_0580836
1287 Ga0495645_0026526
1288 Ga0495645_0106650
1289 Ga0495633_0247278
1290 Ga0495667_0000906
1291 Ga0495667_0044844
1292 Ga0495667_0058126
1293 Ga0495634_0288095
1294 Ga0495635_0108139
1295 Ga0495635_0198307
1296 Ga0495635_0292768
1297 Ga0495588_0640639
1298 Ga0495657_0164989
1299 Ga0495599_0093942
1300 Ga0495599_0396697
1301 Ga0495647_0040113
1302 Ga0495658_0131508
1303 Ga0495658_0885624
1304 Ga0495669_0015199
1305 Ga0495613_0000643
1306 Ga0495613_0231113
1307 Ga0495600_0006887
1308 Ga0495581_0055656
1309 Ga0495581_0398889
1310 Ga0495604_0005836
1311 Ga0495604_0341476
1312 Ga0495674_0048845
1313 Ga0495674_0059410
1314 Ga0495674_0073897
1315 Ga0495674_0169578
1316 Ga0495680_0085559
1317 Ga0495680_0381435
1318 Ga0495684_0000494
1319 Ga0495684_0138532
1320 Ga0495684_0325688
1321 Ga0495684_0332238
1322 Ga0495602_0001193
1323 Ga0495602_0404632
1324 Ga0495614_0568106
1325 Ga0496100_0016846
1326 Ga0496101_0002267
1327 Ga0496101_0823734
1328 Ga0496104_0095798
1329 Ga0496104_0353541
1330 Ga0496105_0392933
1331 Ga0496105_0606205
1332 Ga0496105_0924951
1333 Ga0496105_1284418
1334 Ga0496106_0045654
1335 Ga0496106_0192753
1336 Ga0496106_0569146
1337 Ga0496107_0664207
1338 Ga0496108_1642057
1339 Ga0496109_0055352
1340 Ga0496109_1157746
1341 Ga0496110_0327381
1342 Ga0496112_0341037
1343 Ga0496112_0458147
1344 Ga0496112_1105622
1345 Ga0496113_0106579
1346 Ga0496114_0041138
1347 Ga0496114_0570707
1348 Ga0496114_0606960
1349 Ga0496114_0822087
1350 Ga0496114_1103185
1351 Ga0496115_0710229
1352 Ga0496115_0811945
1353 Ga0501033_0679924
1354 Ga0501037_0185043
1355 Ga0501039_0199844
1356 Ga0501040_0313121
1357 Ga0501041_0714095
1358 Ga0501041_0927945
1359 Ga0501042_0410609
1360 Ga0501042_0672390
1361 Ga0501043_0297407
1362 Ga0501046_0184520
1363 Ga0501068_0234813
1364 Ga0501070_1467426
1365 Ga0501071_0065873
1366 Ga0501072_0101691
1367 Ga0501073_0901075
1368 Ga0501075_0290918
1369 Ga0501076_0002896
1370 Ga0501076_0872333
1371 Ga0501077_0068628
1372 Ga0501079_0039251
1373 Ga0501079_0849129
1374 Ga0501079_0949570
1375 Ga0501080_0073554
1376 Ga0501080_0141878
1377 Ga0501081_1051437
1378 Ga0501045_0018244
1379 Ga0501045_0161148
1380 nmdc:mga05p37_120792_c1
1381 nmdc:mga05p37_2088735_c1
1382 nmdc:mga05p37_402188_c1
1383 nmdc:mga05p37_79040_c1
1384 nmdc:mga05p37_81859_c1
1385 nmdc:mga09592_1024338_c1
1386 nmdc:mga09592_112377_c1
1387 nmdc:mga09592_124350_c1
1388 nmdc:mga09592_834326_c1
1389 nmdc:mga09592_931478_c1
1390 nmdc:mga0qj67_19433_c1
1391 nmdc:mga0qj67_40622_c1
1392 nmdc:mga06r32_35895_c1
1393 nmdc:mga06r32_8103_c1
1394 nmdc:mga08y16_19920_c1
1395 nmdc:mga08y16_450401_c1
1396 nmdc:mga08y16_544943_c1
1397 nmdc:mga08y16_906319_c1
1398 nmdc:mga0n895_128148_c1
1399 nmdc:mga0n895_159974_c1
1400 nmdc:mga0n895_160553_c1
1401 nmdc:mga0rr50_110570_c1
1402 nmdc:mga0rr50_82142_c1
1403 nmdc:mga0a205_460224_c1
1404 Ga0495612_0607072
1405 Ga0495595_0122927
1406 Ga0495595_0706337
1407 Ga0495619_0018251
1408 Ga0495619_0028742
1409 Ga0495619_0645696
1410 Ga0500568_0000749
1411 Ga0501084_0517726
1412 Ga0501082_0040851
1413 Ga0530510_0302201
1414 Ga0530510_0554683

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19649

DUF6152

Family of unknown function (DUF6152)

23

122

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7og2-assembly1.cif.gz_B crystal structure of pseudoalteromonas luteoviolacea l-amino acid oxidase 0.8492 39 69
7c4k-assembly1.cif.gz_A ancestral l-amino acid oxidase (anclaao-n5) ligand free form 0.8431 40 69
7c4l-assembly1.cif.gz_A anncestral l-amino acid oxidase (anclaao-n5) l-gln binding form 0.8228 40 69
2jjd-assembly5.cif.gz_E protein tyrosine phosphatase, receptor type, e isoform 0.8078 40 69
2jjd-assembly3.cif.gz_C protein tyrosine phosphatase, receptor type, e isoform 0.7955 40 69
ID Description Score Start End Superfamily
2jjdF02 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.8008 40 69 3.90.190.10
af_Q8VIG0_99_222_3.30.1520.10 Alpha Beta;2-Layer Sandwich;PX Domain;Phox-like domain 0.7952 37 69 3.30.1520.10
af_Q8VC10_106_455_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.7942 38 69 3.50.50.60
af_Q9UBZ4_1_312_3.60.10.10 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.7915 49 69 3.60.10.10
3nuzD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7851 33 71 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A383CUF3-F1-model_v4 OB domain-containing protein 0.9696 28 120
AF-A0A2E8ECC8-F1-model_v4 OB-fold nucleic acid binding domain-containing protein 0.9502 15 125
AF-A0A2V8I9N4-F1-model_v4 DUF5666 domain-containing protein 0.9448 36 123
AF-A0A2V8GJN1-F1-model_v4 OB domain-containing protein 0.9433 28 122
AF-A0A3N5PNS9-F1-model_v4 DNA-binding protein 0.943 19 123

Map