F476481
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 706 | 307 | 703 | 215 |
Family's Representative Sequence
| Representative Sequence | 3300031239|Ga0265328_10059482|Ga0265328_100594822 |
| Length | 235 |
| Sequence | MRSGRFQPRFRPTTGCREKPLTHRTRIKICGLTRAEDVAAAVDAGADAIGFVFYDKSPRHIAPERAAELARKLPPFVVPVGLFVNAGAVEIARAVALIPNLLLQFHGDETPAQCRSAGRPYLRAVRMAPGFDLLDFARSYADAQGLLLDAFVEGYGGGGKVFDWSLVPRGVALPLVLSGGLNAANVAAGIVQVRPWAVDVSSGVESAKGIKDALAIRRFCDAVREADARIAACQT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 2 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 3 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 4 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 5 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 6 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 7 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 8 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 9 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 10 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 11 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 12 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 46 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 55 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 56 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 57 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 58 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 59 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 66 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 67 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 68 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 69 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 70 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 71 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 72 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 73 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 75 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 76 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 77 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 78 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 79 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 81 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 109 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 111 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 112 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 113 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 114 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 117 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 175 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 178 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 179 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 180 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 181 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 182 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 183 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 184 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 185 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 186 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 187 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 188 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 189 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 190 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 191 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 192 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 193 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 194 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 195 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 196 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 197 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 198 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 199 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 200 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 201 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 202 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 203 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 204 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 205 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 206 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 207 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 208 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 209 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 210 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 211 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 212 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 213 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 214 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 215 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 216 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 217 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 218 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 219 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 220 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 221 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 222 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 223 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 224 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 225 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 226 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 227 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 228 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 229 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 260 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 261 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 262 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 263 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 264 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 265 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 266 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 267 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 268 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 269 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 270 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 271 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 272 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 273 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 274 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 275 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 276 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 277 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 278 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 279 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 280 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 281 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 282 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 283 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 284 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 285 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 290 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 293 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 294 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 295 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 296 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 297 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 298 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 299 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 300 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 301 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 302 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 303 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 304 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 305 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 306 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 307 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.58 |
| Metatranscriptomes | 0 |
| Isolates | 0.42 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.31 |
| Nodule | 0.28 |
| Rhizoplane | 4.25 |
| Rhizosphere | 77.62 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.53 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25150J39212_1013974 | 3300002774 | Bacteria | 1375 |
| 2 | JGI25153J46596_10005823 | 3300003215 | Bacteria | 6405 |
| 3 | JGI25153J46596_10005931 | 3300003215 | Bacteria | 6301 |
| 4 | JGI25153J46596_10010740 | 3300003215 | Bacteria | 4112 |
| 5 | rootH1_10048080 | 3300003316 | Bacteria | 1793 |
| 6 | Ga0055526_1018996 | 3300003771 | Bacteria | 2528 |
| 7 | Ga0055524_1000079 | 3300003775 | Bacteria | 120203 |
| 8 | Ga0055540_1000004 | 3300003792 | Bacteria | 395545 |
| 9 | Ga0055531_10008300 | 3300003794 | Bacteria | 5508 |
| 10 | Ga0065165_1046569 | 3300005262 | Bacteria | 1257 |
| 11 | Ga0065707_10092687 | 3300005295 | Bacteria | 3734 |
| 12 | Ga0070658_10070761 | 3300005327 | Bacteria | 2857 |
| 13 | Ga0070658_10103249 | 3300005327 | Bacteria | 2358 |
| 14 | Ga0070658_10250839 | 3300005327 | Bacteria | 1501 |
| 15 | Ga0070676_10003580 | 3300005328 | Bacteria | 8119 |
| 16 | Ga0070676_10036707 | 3300005328 | Bacteria | 2824 |
| 17 | Ga0070690_100013302 | 3300005330 | Bacteria | 4861 |
| 18 | Ga0070670_100004564 | 3300005331 | Bacteria | 11615 |
| 19 | Ga0070670_100047389 | 3300005331 | Bacteria | 3698 |
| 20 | Ga0070670_100104394 | 3300005331 | Bacteria | 2441 |
| 21 | Ga0070670_100653351 | 3300005331 | Bacteria | 943 |
| 22 | Ga0070677_10013875 | 3300005333 | Bacteria | 2828 |
| 23 | Ga0070677_10017543 | 3300005333 | Bacteria | 2564 |
| 24 | Ga0070677_10034440 | 3300005333 | Bacteria | 1956 |
| 25 | Ga0070677_10064275 | 3300005333 | Bacteria | 1523 |
| 26 | Ga0068869_100000287 | 3300005334 | Bacteria | 26922 |
| 27 | Ga0068869_100007333 | 3300005334 | Bacteria | 7036 |
| 28 | Ga0068869_100144210 | 3300005334 | Bacteria | 1842 |
| 29 | Ga0070666_10038958 | 3300005335 | Bacteria | 3165 |
| 30 | Ga0070666_10051094 | 3300005335 | Bacteria | 2782 |
| 31 | Ga0070666_10096529 | 3300005335 | Bacteria | 2034 |
| 32 | Ga0070666_10225758 | 3300005335 | Bacteria | 1322 |
| 33 | Ga0070666_10524669 | 3300005335 | Bacteria | 860 |
| 34 | Ga0070680_100029873 | 3300005336 | Bacteria | 4376 |
| 35 | Ga0068868_100035131 | 3300005338 | Bacteria | 3873 |
| 36 | Ga0068868_100043620 | 3300005338 | Bacteria | 3504 |
| 37 | Ga0068868_100050267 | 3300005338 | Bacteria | 3273 |
| 38 | Ga0068868_100199950 | 3300005338 | Bacteria | 1665 |
| 39 | Ga0068868_100254955 | 3300005338 | Bacteria | 1477 |
| 40 | Ga0068868_100605073 | 3300005338 | Bacteria | 971 |
| 41 | Ga0070660_100075701 | 3300005339 | Bacteria | 2635 |
| 42 | Ga0070660_100287217 | 3300005339 | Bacteria | 1347 |
| 43 | Ga0070660_100339685 | 3300005339 | Bacteria | 1236 |
| 44 | Ga0070687_100304885 | 3300005343 | Bacteria | 1012 |
| 45 | Ga0070661_100001326 | 3300005344 | Bacteria | 17338 |
| 46 | Ga0070661_100096521 | 3300005344 | Bacteria | 2194 |
| 47 | Ga0070661_100551070 | 3300005344 | Bacteria | 928 |
| 48 | Ga0070661_100590459 | 3300005344 | Bacteria | 897 |
| 49 | Ga0070668_100006437 | 3300005347 | Bacteria | 8708 |
| 50 | Ga0070668_100031606 | 3300005347 | Bacteria | 4028 |
| 51 | Ga0070669_100008796 | 3300005353 | Bacteria | 7203 |
| 52 | Ga0070669_100100348 | 3300005353 | Bacteria | 2183 |
| 53 | Ga0070675_100000322 | 3300005354 | Bacteria | 32261 |
| 54 | Ga0070675_100011400 | 3300005354 | Bacteria | 6958 |
| 55 | Ga0070675_100025355 | 3300005354 | Bacteria | 4754 |
| 56 | Ga0070675_100027488 | 3300005354 | Bacteria | 4571 |
| 57 | Ga0070675_100047502 | 3300005354 | Bacteria | 3517 |
| 58 | Ga0070675_100224039 | 3300005354 | Bacteria | 1638 |
| 59 | Ga0070671_100014031 | 3300005355 | Bacteria | 6469 |
| 60 | Ga0070671_100041904 | 3300005355 | Bacteria | 3805 |
| 61 | Ga0070671_100062646 | 3300005355 | Bacteria | 3096 |
| 62 | Ga0070671_100157386 | 3300005355 | Bacteria | 1920 |
| 63 | Ga0070671_100482188 | 3300005355 | Bacteria | 1066 |
| 64 | Ga0070674_100010469 | 3300005356 | Bacteria | 5609 |
| 65 | Ga0070674_100167871 | 3300005356 | Bacteria | 1671 |
| 66 | Ga0070674_100259095 | 3300005356 | Bacteria | 1369 |
| 67 | Ga0070674_100271028 | 3300005356 | Bacteria | 1341 |
| 68 | Ga0070673_100002962 | 3300005364 | Bacteria | 10471 |
| 69 | Ga0070673_100132159 | 3300005364 | Bacteria | 2096 |
| 70 | Ga0070673_100265472 | 3300005364 | Bacteria | 1501 |
| 71 | Ga0070673_100290539 | 3300005364 | Bacteria | 1436 |
| 72 | Ga0070673_100394347 | 3300005364 | Bacteria | 1236 |
| 73 | Ga0070673_100687772 | 3300005364 | Bacteria | 938 |
| 74 | Ga0070659_100000336 | 3300005366 | Bacteria | 36297 |
| 75 | Ga0070667_100004438 | 3300005367 | Bacteria | 11832 |
| 76 | Ga0070667_100009358 | 3300005367 | Bacteria | 8122 |
| 77 | Ga0070667_100012223 | 3300005367 | Bacteria | 7101 |
| 78 | Ga0070667_100029416 | 3300005367 | Bacteria | 4576 |
| 79 | Ga0070667_100155900 | 3300005367 | Bacteria | 2009 |
| 80 | Ga0070667_100175866 | 3300005367 | Bacteria | 1892 |
| 81 | Ga0070667_100218257 | 3300005367 | Bacteria | 1697 |
| 82 | Ga0070667_100230754 | 3300005367 | Bacteria | 1650 |
| 83 | Ga0070667_100277639 | 3300005367 | Bacteria | 1504 |
| 84 | Ga0070667_100321752 | 3300005367 | Bacteria | 1396 |
| 85 | Ga0070701_10300297 | 3300005438 | Bacteria | 987 |
| 86 | Ga0070700_100004808 | 3300005441 | Bacteria | 7085 |
| 87 | Ga0070700_100172198 | 3300005441 | Bacteria | 1500 |
| 88 | Ga0070663_100008422 | 3300005455 | Bacteria | 6343 |
| 89 | Ga0070663_100059976 | 3300005455 | Bacteria | 2735 |
| 90 | Ga0070663_100273119 | 3300005455 | Bacteria | 1345 |
| 91 | Ga0070663_100539211 | 3300005455 | Bacteria | 974 |
| 92 | Ga0070678_100027686 | 3300005456 | Bacteria | 3852 |
| 93 | Ga0070678_100045697 | 3300005456 | Bacteria | 3135 |
| 94 | Ga0070678_100076567 | 3300005456 | Bacteria | 2520 |
| 95 | Ga0070678_100205439 | 3300005456 | Bacteria | 1628 |
| 96 | Ga0070678_100222524 | 3300005456 | Bacteria | 1569 |
| 97 | Ga0070678_100354784 | 3300005456 | Bacteria | 1262 |
| 98 | Ga0070678_100460996 | 3300005456 | Bacteria | 1115 |
| 99 | Ga0070678_100482982 | 3300005456 | Bacteria | 1090 |
| 100 | Ga0070678_100743552 | 3300005456 | Bacteria | 887 |
| 101 | Ga0070662_100038169 | 3300005457 | Bacteria | 3410 |
| 102 | Ga0070662_100057681 | 3300005457 | Bacteria | 2822 |
| 103 | Ga0070681_10314729 | 3300005458 | Bacteria | 1475 |
| 104 | Ga0068867_100002034 | 3300005459 | Bacteria | 14144 |
| 105 | Ga0068867_100101659 | 3300005459 | Bacteria | 2196 |
| 106 | Ga0068867_100141393 | 3300005459 | Bacteria | 1882 |
| 107 | Ga0068867_100193719 | 3300005459 | Bacteria | 1623 |
| 108 | Ga0068867_100256975 | 3300005459 | Bacteria | 1423 |
| 109 | Ga0068867_100559883 | 3300005459 | Bacteria | 991 |
| 110 | Ga0070685_10074581 | 3300005466 | Bacteria | 2019 |
| 111 | Ga0070685_10415401 | 3300005466 | Bacteria | 935 |
| 112 | Ga0070706_100001359 | 3300005467 | Bacteria | 26010 |
| 113 | Ga0070707_100097547 | 3300005468 | Bacteria | 2847 |
| 114 | Ga0070679_100012199 | 3300005530 | Bacteria | 8209 |
| 115 | Ga0070684_100160632 | 3300005535 | Bacteria | 2038 |
| 116 | Ga0068853_100524126 | 3300005539 | Bacteria | 1120 |
| 117 | Ga0068853_100604623 | 3300005539 | Bacteria | 1041 |
| 118 | Ga0070672_100008994 | 3300005543 | Bacteria | 6865 |
| 119 | Ga0070672_100015361 | 3300005543 | Bacteria | 5450 |
| 120 | Ga0070672_100216745 | 3300005543 | Bacteria | 1604 |
| 121 | Ga0070672_100238256 | 3300005543 | Bacteria | 1530 |
| 122 | Ga0070672_100518423 | 3300005543 | Bacteria | 1032 |
| 123 | Ga0070672_100538176 | 3300005543 | Bacteria | 1013 |
| 124 | Ga0070672_100862763 | 3300005543 | Unclassified | 798 |
| 125 | Ga0070696_100671760 | 3300005546 | Bacteria | 842 |
| 126 | Ga0070665_100488282 | 3300005548 | Bacteria | 1243 |
| 127 | Ga0068855_100404923 | 3300005563 | Bacteria | 1495 |
| 128 | Ga0068855_100468355 | 3300005563 | Bacteria | 1373 |
| 129 | Ga0070664_100017678 | 3300005564 | Bacteria | 5855 |
| 130 | Ga0070664_100250050 | 3300005564 | Bacteria | 1593 |
| 131 | Ga0070664_100574723 | 3300005564 | Bacteria | 1044 |
| 132 | Ga0068857_100133634 | 3300005577 | Bacteria | 2239 |
| 133 | Ga0068857_100306491 | 3300005577 | Bacteria | 1465 |
| 134 | Ga0068857_101079164 | 3300005577 | Bacteria | 775 |
| 135 | Ga0068854_100037572 | 3300005578 | Bacteria | 3400 |
| 136 | Ga0068854_100059484 | 3300005578 | Bacteria | 2761 |
| 137 | Ga0068854_100072892 | 3300005578 | Bacteria | 2515 |
| 138 | Ga0068854_100553840 | 3300005578 | Bacteria | 976 |
| 139 | Ga0070702_100122951 | 3300005615 | Bacteria | 1627 |
| 140 | Ga0068852_100011794 | 3300005616 | Bacteria | 6600 |
| 141 | Ga0068852_100092739 | 3300005616 | Bacteria | 2705 |
| 142 | Ga0068852_100498015 | 3300005616 | Bacteria | 1213 |
| 143 | Ga0068859_100008152 | 3300005617 | Bacteria | 10625 |
| 144 | Ga0068859_100023977 | 3300005617 | Bacteria | 6124 |
| 145 | Ga0068859_100057687 | 3300005617 | Bacteria | 3911 |
| 146 | Ga0068859_100180990 | 3300005617 | Bacteria | 2191 |
| 147 | Ga0068864_100006810 | 3300005618 | Bacteria | 9362 |
| 148 | Ga0068864_100006813 | 3300005618 | Bacteria | 9361 |
| 149 | Ga0068864_100052350 | 3300005618 | Bacteria | 3518 |
| 150 | Ga0068864_100068692 | 3300005618 | Bacteria | 3079 |
| 151 | Ga0068864_100170056 | 3300005618 | Bacteria | 1987 |
| 152 | Ga0068864_100213981 | 3300005618 | Bacteria | 1776 |
| 153 | Ga0068864_101049522 | 3300005618 | Bacteria | 810 |
| 154 | Ga0068866_10115104 | 3300005718 | Bacteria | 1507 |
| 155 | Ga0068861_100001256 | 3300005719 | Bacteria | 15820 |
| 156 | Ga0068861_100033391 | 3300005719 | Bacteria | 3795 |
| 157 | Ga0068861_100417916 | 3300005719 | Bacteria | 1194 |
| 158 | Ga0068851_10031438 | 3300005834 | Bacteria | 2637 |
| 159 | Ga0068851_10073763 | 3300005834 | Bacteria | 1770 |
| 160 | Ga0068851_10075709 | 3300005834 | Bacteria | 1749 |
| 161 | Ga0068851_10080770 | 3300005834 | Bacteria | 1697 |
| 162 | Ga0068863_100008722 | 3300005841 | Bacteria | 9907 |
| 163 | Ga0068863_100021758 | 3300005841 | Bacteria | 6118 |
| 164 | Ga0068863_100038295 | 3300005841 | Bacteria | 4562 |
| 165 | Ga0068863_100156834 | 3300005841 | Bacteria | 2179 |
| 166 | Ga0068863_100224273 | 3300005841 | Bacteria | 1811 |
| 167 | Ga0068858_100004522 | 3300005842 | Bacteria | 13638 |
| 168 | Ga0068858_100021085 | 3300005842 | Bacteria | 6086 |
| 169 | Ga0068858_100051898 | 3300005842 | Bacteria | 3794 |
| 170 | Ga0068858_100167873 | 3300005842 | Bacteria | 2068 |
| 171 | Ga0068860_100000989 | 3300005843 | Bacteria | 31420 |
| 172 | Ga0068860_100005562 | 3300005843 | Bacteria | 12742 |
| 173 | Ga0068860_100082121 | 3300005843 | Bacteria | 3065 |
| 174 | Ga0068860_100085907 | 3300005843 | Bacteria | 2994 |
| 175 | Ga0068860_100222431 | 3300005843 | Bacteria | 1833 |
| 176 | Ga0068862_100078880 | 3300005844 | Bacteria | 2853 |
| 177 | Ga0068862_100079156 | 3300005844 | Bacteria | 2849 |
| 178 | Ga0068862_100171192 | 3300005844 | Bacteria | 1944 |
| 179 | Ga0068862_100235457 | 3300005844 | Bacteria | 1663 |
| 180 | Ga0070717_10722906 | 3300006028 | Bacteria | 905 |
| 181 | Ga0075365_10024481 | 3300006038 | Bacteria | 3809 |
| 182 | Ga0075365_10572908 | 3300006038 | Bacteria | 798 |
| 183 | Ga0075368_10001139 | 3300006042 | Bacteria | 8381 |
| 184 | Ga0075363_100000866 | 3300006048 | Bacteria | 10603 |
| 185 | Ga0075363_100088685 | 3300006048 | Bacteria | 1700 |
| 186 | Ga0075363_100206767 | 3300006048 | Bacteria | 1123 |
| 187 | Ga0075363_100330071 | 3300006048 | Bacteria | 888 |
| 188 | Ga0075364_10021082 | 3300006051 | Bacteria | 4105 |
| 189 | Ga0075364_10060464 | 3300006051 | Bacteria | 2484 |
| 190 | Ga0075362_10008657 | 3300006177 | Bacteria | 3906 |
| 191 | Ga0075362_10064522 | 3300006177 | Bacteria | 1662 |
| 192 | Ga0075362_10152163 | 3300006177 | Bacteria | 1110 |
| 193 | Ga0075367_10013893 | 3300006178 | Bacteria | 4344 |
| 194 | Ga0075367_10037441 | 3300006178 | Bacteria | 2819 |
| 195 | Ga0075367_10039167 | 3300006178 | Bacteria | 2763 |
| 196 | Ga0075369_10058088 | 3300006186 | Bacteria | 1684 |
| 197 | Ga0075366_10000694 | 3300006195 | Bacteria | 15919 |
| 198 | Ga0075366_10009550 | 3300006195 | Bacteria | 5418 |
| 199 | Ga0075366_10033502 | 3300006195 | Bacteria | 3026 |
| 200 | Ga0075366_10094778 | 3300006195 | Bacteria | 1789 |
| 201 | Ga0075366_10167834 | 3300006195 | Bacteria | 1331 |
| 202 | Ga0097621_100054327 | 3300006237 | Bacteria | 3266 |
| 203 | Ga0097621_100145211 | 3300006237 | Bacteria | 2030 |
| 204 | Ga0097621_100177209 | 3300006237 | Bacteria | 1840 |
| 205 | Ga0097621_100379196 | 3300006237 | Bacteria | 1263 |
| 206 | Ga0075370_10000326 | 3300006353 | Bacteria | 17238 |
| 207 | Ga0075370_10000436 | 3300006353 | Bacteria | 15538 |
| 208 | Ga0075370_10009246 | 3300006353 | Bacteria | 5108 |
| 209 | Ga0075370_10011217 | 3300006353 | Bacteria | 4703 |
| 210 | Ga0075370_10030032 | 3300006353 | Bacteria | 3031 |
| 211 | Ga0075370_10235062 | 3300006353 | Bacteria | 1085 |
| 212 | Ga0068871_100041817 | 3300006358 | Bacteria | 3677 |
| 213 | Ga0068871_100769640 | 3300006358 | Bacteria | 886 |
| 214 | Ga0075430_100072946 | 3300006846 | Bacteria | 2879 |
| 215 | Ga0075429_100005458 | 3300006880 | Bacteria | 10949 |
| 216 | Ga0068865_100013136 | 3300006881 | Bacteria | 5225 |
| 217 | Ga0068865_100044231 | 3300006881 | Bacteria | 3047 |
| 218 | Ga0068865_100259393 | 3300006881 | Bacteria | 1375 |
| 219 | Ga0097620_100008153 | 3300006931 | Bacteria | 10625 |
| 220 | Ga0097620_100023977 | 3300006931 | Bacteria | 6124 |
| 221 | Ga0097620_100057688 | 3300006931 | Bacteria | 3911 |
| 222 | Ga0097620_100180988 | 3300006931 | Bacteria | 2191 |
| 223 | Ga0079104_1000352 | 3300006946 | Bacteria | 55479 |
| 224 | Ga0105240_10123389 | 3300009093 | Bacteria | 3117 |
| 225 | Ga0105240_10459432 | 3300009093 | Bacteria | 1423 |
| 226 | Ga0105245_10012538 | 3300009098 | Bacteria | 7376 |
| 227 | Ga0105245_10133816 | 3300009098 | Bacteria | 2328 |
| 228 | Ga0105245_10342330 | 3300009098 | Bacteria | 1479 |
| 229 | Ga0105247_10110819 | 3300009101 | Bacteria | 1766 |
| 230 | Ga0114129_10252574 | 3300009147 | Bacteria | 2366 |
| 231 | Ga0105243_10244094 | 3300009148 | Bacteria | 1600 |
| 232 | Ga0105241_10092023 | 3300009174 | Bacteria | 2394 |
| 233 | Ga0105242_10096246 | 3300009176 | Bacteria | 2500 |
| 234 | Ga0105242_10123243 | 3300009176 | Bacteria | 2228 |
| 235 | Ga0105242_10255866 | 3300009176 | Bacteria | 1580 |
| 236 | Ga0105242_10575875 | 3300009176 | Bacteria | 1083 |
| 237 | Ga0105248_10005678 | 3300009177 | Bacteria | 13707 |
| 238 | Ga0105248_10037339 | 3300009177 | Bacteria | 5435 |
| 239 | Ga0105248_10164097 | 3300009177 | Bacteria | 2505 |
| 240 | Ga0105248_10546135 | 3300009177 | Bacteria | 1307 |
| 241 | Ga0105237_10053047 | 3300009545 | Bacteria | 4068 |
| 242 | Ga0105237_10186555 | 3300009545 | Bacteria | 2074 |
| 243 | Ga0105237_10503317 | 3300009545 | Bacteria | 1218 |
| 244 | Ga0105238_10197500 | 3300009551 | Bacteria | 1987 |
| 245 | Ga0105249_10059678 | 3300009553 | Bacteria | 3499 |
| 246 | Ga0105249_11000370 | 3300009553 | Bacteria | 905 |
| 247 | Ga0105239_10094657 | 3300010375 | Bacteria | 3299 |
| 248 | Ga0105239_10098645 | 3300010375 | Bacteria | 3230 |
| 249 | Ga0105246_10516056 | 3300011119 | Bacteria | 1018 |
| 250 | Ga0105246_10708553 | 3300011119 | Bacteria | 883 |
| 251 | Ga0157373_10004841 | 3300013100 | Bacteria | 10129 |
| 252 | Ga0157371_10204596 | 3300013102 | Bacteria | 1416 |
| 253 | Ga0157370_10230937 | 3300013104 | Bacteria | 1712 |
| 254 | Ga0157369_10064757 | 3300013105 | Bacteria | 3936 |
| 255 | Ga0157369_10229909 | 3300013105 | Bacteria | 1939 |
| 256 | Ga0157374_10132987 | 3300013296 | Bacteria | 2409 |
| 257 | Ga0157374_10178734 | 3300013296 | Bacteria | 2072 |
| 258 | Ga0157374_10442001 | 3300013296 | Bacteria | 1301 |
| 259 | Ga0157374_10633625 | 3300013296 | Bacteria | 1080 |
| 260 | Ga0157374_10656350 | 3300013296 | Bacteria | 1061 |
| 261 | Ga0157378_10127038 | 3300013297 | Bacteria | 2356 |
| 262 | Ga0157378_10236886 | 3300013297 | Bacteria | 1742 |
| 263 | Ga0157378_10359092 | 3300013297 | Bacteria | 1425 |
| 264 | Ga0163162_10002520 | 3300013306 | Bacteria | 17318 |
| 265 | Ga0163162_10038029 | 3300013306 | Bacteria | 4803 |
| 266 | Ga0163162_10107216 | 3300013306 | Bacteria | 2889 |
| 267 | Ga0163162_10310114 | 3300013306 | Bacteria | 1710 |
| 268 | Ga0157372_10268809 | 3300013307 | Bacteria | 1981 |
| 269 | Ga0157375_10003007 | 3300013308 | Bacteria | 14639 |
| 270 | Ga0157375_10003841 | 3300013308 | Bacteria | 13033 |
| 271 | Ga0157375_10094724 | 3300013308 | Bacteria | 3055 |
| 272 | Ga0157375_10153375 | 3300013308 | Bacteria | 2441 |
| 273 | Ga0157375_10231241 | 3300013308 | Bacteria | 2008 |
| 274 | Ga0157375_10643527 | 3300013308 | Bacteria | 1217 |
| 275 | Ga0157375_11232497 | 3300013308 | Unclassified | 878 |
| 276 | Ga0163163_10023012 | 3300014325 | Bacteria | 5908 |
| 277 | Ga0163163_10378722 | 3300014325 | Bacteria | 1473 |
| 278 | Ga0163163_10927844 | 3300014325 | Bacteria | 934 |
| 279 | Ga0157380_10001456 | 3300014326 | Bacteria | 15479 |
| 280 | Ga0157380_10015049 | 3300014326 | Bacteria | 5676 |
| 281 | Ga0157380_10050553 | 3300014326 | Bacteria | 3284 |
| 282 | Ga0157380_10104898 | 3300014326 | Bacteria | 2362 |
| 283 | Ga0157377_10017784 | 3300014745 | Bacteria | 3685 |
| 284 | Ga0157377_10337711 | 3300014745 | Bacteria | 1006 |
| 285 | Ga0157377_10540347 | 3300014745 | Bacteria | 821 |
| 286 | Ga0157379_10007711 | 3300014968 | Bacteria | 9320 |
| 287 | Ga0157379_10046568 | 3300014968 | Bacteria | 3868 |
| 288 | Ga0157379_10090299 | 3300014968 | Bacteria | 2748 |
| 289 | Ga0157379_10091557 | 3300014968 | Bacteria | 2728 |
| 290 | Ga0157379_10101466 | 3300014968 | Bacteria | 2583 |
| 291 | Ga0157379_10114831 | 3300014968 | Bacteria | 2420 |
| 292 | Ga0157379_10250806 | 3300014968 | Bacteria | 1607 |
| 293 | Ga0157379_10707495 | 3300014968 | Bacteria | 946 |
| 294 | Ga0157379_10831783 | 3300014968 | Bacteria | 873 |
| 295 | Ga0157376_10057077 | 3300014969 | Bacteria | 3264 |
| 296 | Ga0157376_10088944 | 3300014969 | Bacteria | 2669 |
| 297 | Ga0157376_10641687 | 3300014969 | Bacteria | 1061 |
| 298 | Ga0182007_10060635 | 3300015262 | Bacteria | 1240 |
| 299 | Ga0163161_10010581 | 3300017792 | Bacteria | 6387 |
| 300 | Ga0163161_10043893 | 3300017792 | Bacteria | 3219 |
| 301 | Ga0163161_10180512 | 3300017792 | Bacteria | 1618 |
| 302 | Ga0163161_10202527 | 3300017792 | Bacteria | 1530 |
| 303 | Ga0207425_1001224 | 3300025245 | Bacteria | 11279 |
| 304 | Ga0209129_1000041 | 3300025258 | Bacteria | 307590 |
| 305 | Ga0209673_1021882 | 3300025273 | Bacteria | 2223 |
| 306 | Ga0209564_1000029 | 3300025295 | Bacteria | 505995 |
| 307 | Ga0209758_1000043 | 3300025297 | Bacteria | 402310 |
| 308 | Ga0209758_1000057 | 3300025297 | Bacteria | 333111 |
| 309 | Ga0209050_1003660 | 3300025298 | Bacteria | 11105 |
| 310 | Ga0209256_1000011 | 3300025299 | Bacteria | 865309 |
| 311 | Ga0209051_1000016 | 3300025303 | Bacteria | 541891 |
| 312 | Ga0209257_1000102 | 3300025304 | Bacteria | 251074 |
| 313 | Ga0207697_10033989 | 3300025315 | Bacteria | 2087 |
| 314 | Ga0207656_10046886 | 3300025321 | Bacteria | 1856 |
| 315 | Ga0207682_10008765 | 3300025893 | Bacteria | 4001 |
| 316 | Ga0207682_10015590 | 3300025893 | Bacteria | 2959 |
| 317 | Ga0207682_10016142 | 3300025893 | Bacteria | 2910 |
| 318 | Ga0207682_10031014 | 3300025893 | Bacteria | 2144 |
| 319 | Ga0207642_10004119 | 3300025899 | Bacteria | 4663 |
| 320 | Ga0207642_10090705 | 3300025899 | Bacteria | 1509 |
| 321 | Ga0207688_10094685 | 3300025901 | Bacteria | 1718 |
| 322 | Ga0207688_10340443 | 3300025901 | Bacteria | 923 |
| 323 | Ga0207680_10031915 | 3300025903 | Bacteria | 2988 |
| 324 | Ga0207680_10047700 | 3300025903 | Bacteria | 2540 |
| 325 | Ga0207645_10006800 | 3300025907 | Bacteria | 8163 |
| 326 | Ga0207645_10043145 | 3300025907 | Bacteria | 2886 |
| 327 | Ga0207645_10100275 | 3300025907 | Bacteria | 1868 |
| 328 | Ga0207645_10269379 | 3300025907 | Bacteria | 1129 |
| 329 | Ga0207643_10138303 | 3300025908 | Bacteria | 1453 |
| 330 | Ga0207643_10159122 | 3300025908 | Bacteria | 1358 |
| 331 | Ga0207705_10412832 | 3300025909 | Bacteria | 1045 |
| 332 | Ga0207654_10048113 | 3300025911 | Bacteria | 2439 |
| 333 | Ga0207695_10074259 | 3300025913 | Bacteria | 3462 |
| 334 | Ga0207695_10290834 | 3300025913 | Bacteria | 1526 |
| 335 | Ga0207671_10015949 | 3300025914 | Bacteria | 5858 |
| 336 | Ga0207671_10072300 | 3300025914 | Bacteria | 2574 |
| 337 | Ga0207671_10145005 | 3300025914 | Bacteria | 1831 |
| 338 | Ga0207660_10108625 | 3300025917 | Bacteria | 2084 |
| 339 | Ga0207662_10086628 | 3300025918 | Bacteria | 1920 |
| 340 | Ga0207657_10095410 | 3300025919 | Bacteria | 2475 |
| 341 | Ga0207649_10011600 | 3300025920 | Bacteria | 4864 |
| 342 | Ga0207649_10094310 | 3300025920 | Bacteria | 1966 |
| 343 | Ga0207649_10600990 | 3300025920 | Bacteria | 846 |
| 344 | Ga0207652_10006543 | 3300025921 | Bacteria | 9389 |
| 345 | Ga0207646_10084736 | 3300025922 | Bacteria | 2836 |
| 346 | Ga0207681_10000205 | 3300025923 | Bacteria | 47034 |
| 347 | Ga0207681_10083208 | 3300025923 | Bacteria | 2264 |
| 348 | Ga0207681_10184498 | 3300025923 | Bacteria | 1592 |
| 349 | Ga0207681_10444798 | 3300025923 | Bacteria | 1053 |
| 350 | Ga0207694_10038195 | 3300025924 | Bacteria | 3691 |
| 351 | Ga0207694_10220461 | 3300025924 | Bacteria | 1547 |
| 352 | Ga0207650_10002265 | 3300025925 | Bacteria | 13428 |
| 353 | Ga0207650_10002632 | 3300025925 | Bacteria | 12423 |
| 354 | Ga0207650_10049976 | 3300025925 | Bacteria | 3090 |
| 355 | Ga0207659_10000640 | 3300025926 | Bacteria | 20764 |
| 356 | Ga0207659_10005482 | 3300025926 | Bacteria | 7696 |
| 357 | Ga0207659_10029748 | 3300025926 | Bacteria | 3726 |
| 358 | Ga0207659_10055002 | 3300025926 | Bacteria | 2844 |
| 359 | Ga0207659_10077319 | 3300025926 | Bacteria | 2449 |
| 360 | Ga0207659_10218711 | 3300025926 | Bacteria | 1530 |
| 361 | Ga0207687_10062639 | 3300025927 | Bacteria | 2631 |
| 362 | Ga0207687_10076478 | 3300025927 | Bacteria | 2405 |
| 363 | Ga0207687_10105424 | 3300025927 | Bacteria | 2083 |
| 364 | Ga0207644_10004364 | 3300025931 | Bacteria | 9173 |
| 365 | Ga0207644_10115431 | 3300025931 | Bacteria | 2036 |
| 366 | Ga0207644_10116173 | 3300025931 | Bacteria | 2030 |
| 367 | Ga0207644_10148244 | 3300025931 | Bacteria | 1813 |
| 368 | Ga0207644_10374540 | 3300025931 | Bacteria | 1160 |
| 369 | Ga0207644_10868920 | 3300025931 | Unclassified | 755 |
| 370 | Ga0207690_10013283 | 3300025932 | Bacteria | 4946 |
| 371 | Ga0207690_10137966 | 3300025932 | Bacteria | 1793 |
| 372 | Ga0207690_10422398 | 3300025932 | Bacteria | 1067 |
| 373 | Ga0207706_10020517 | 3300025933 | Bacteria | 5940 |
| 374 | Ga0207706_10134453 | 3300025933 | Bacteria | 2175 |
| 375 | Ga0207706_10211252 | 3300025933 | Bacteria | 1701 |
| 376 | Ga0207686_10166644 | 3300025934 | Bacteria | 1550 |
| 377 | Ga0207709_10426815 | 3300025935 | Bacteria | 1019 |
| 378 | Ga0207670_10016862 | 3300025936 | Bacteria | 4402 |
| 379 | Ga0207670_10192515 | 3300025936 | Bacteria | 1544 |
| 380 | Ga0207669_10025734 | 3300025937 | Bacteria | 3186 |
| 381 | Ga0207669_10128822 | 3300025937 | Bacteria | 1734 |
| 382 | Ga0207669_10153035 | 3300025937 | Bacteria | 1618 |
| 383 | Ga0207704_10014643 | 3300025938 | Bacteria | 3967 |
| 384 | Ga0207704_10040771 | 3300025938 | Bacteria | 2717 |
| 385 | Ga0207704_10222617 | 3300025938 | Bacteria | 1397 |
| 386 | Ga0207704_10374449 | 3300025938 | Bacteria | 1116 |
| 387 | Ga0207691_10005244 | 3300025940 | Bacteria | 12509 |
| 388 | Ga0207691_10013352 | 3300025940 | Bacteria | 7866 |
| 389 | Ga0207691_10031282 | 3300025940 | Bacteria | 4968 |
| 390 | Ga0207691_10033674 | 3300025940 | Bacteria | 4771 |
| 391 | Ga0207691_10049278 | 3300025940 | Bacteria | 3858 |
| 392 | Ga0207691_10125365 | 3300025940 | Bacteria | 2273 |
| 393 | Ga0207691_10347673 | 3300025940 | Bacteria | 1269 |
| 394 | Ga0207691_10429243 | 3300025940 | Bacteria | 1126 |
| 395 | Ga0207691_10577625 | 3300025940 | Bacteria | 952 |
| 396 | Ga0207711_10003076 | 3300025941 | Bacteria | 14559 |
| 397 | Ga0207711_10004990 | 3300025941 | Bacteria | 11255 |
| 398 | Ga0207711_10006526 | 3300025941 | Bacteria | 9821 |
| 399 | Ga0207711_10044179 | 3300025941 | Bacteria | 3803 |
| 400 | Ga0207711_10098658 | 3300025941 | Bacteria | 2581 |
| 401 | Ga0207711_10373411 | 3300025941 | Bacteria | 1323 |
| 402 | Ga0207711_10423257 | 3300025941 | Bacteria | 1239 |
| 403 | Ga0207689_10000612 | 3300025942 | Bacteria | 34213 |
| 404 | Ga0207689_10007315 | 3300025942 | Bacteria | 9689 |
| 405 | Ga0207689_10036567 | 3300025942 | Bacteria | 4075 |
| 406 | Ga0207689_10282697 | 3300025942 | Bacteria | 1374 |
| 407 | Ga0207661_10028032 | 3300025944 | Bacteria | 4309 |
| 408 | Ga0207679_10000526 | 3300025945 | Bacteria | 25924 |
| 409 | Ga0207679_10073308 | 3300025945 | Bacteria | 2590 |
| 410 | Ga0207679_10133413 | 3300025945 | Bacteria | 1996 |
| 411 | Ga0207679_10311431 | 3300025945 | Bacteria | 1360 |
| 412 | Ga0207667_10505813 | 3300025949 | Bacteria | 1225 |
| 413 | Ga0207651_10004882 | 3300025960 | Bacteria | 6836 |
| 414 | Ga0207651_10062308 | 3300025960 | Bacteria | 2598 |
| 415 | Ga0207651_10178703 | 3300025960 | Bacteria | 1681 |
| 416 | Ga0207651_10377525 | 3300025960 | Bacteria | 1200 |
| 417 | Ga0207651_10492238 | 3300025960 | Bacteria | 1058 |
| 418 | Ga0207712_10021116 | 3300025961 | Bacteria | 4271 |
| 419 | Ga0207712_10172443 | 3300025961 | Bacteria | 1692 |
| 420 | Ga0207668_10006845 | 3300025972 | Bacteria | 6760 |
| 421 | Ga0207640_10055213 | 3300025981 | Bacteria | 2601 |
| 422 | Ga0207640_10145212 | 3300025981 | Bacteria | 1735 |
| 423 | Ga0207658_10001252 | 3300025986 | Bacteria | 20100 |
| 424 | Ga0207658_10005498 | 3300025986 | Bacteria | 8687 |
| 425 | Ga0207658_10068012 | 3300025986 | Bacteria | 2686 |
| 426 | Ga0207658_10131396 | 3300025986 | Bacteria | 2012 |
| 427 | Ga0207658_10188708 | 3300025986 | Bacteria | 1711 |
| 428 | Ga0207658_10191045 | 3300025986 | Bacteria | 1702 |
| 429 | Ga0207658_10199074 | 3300025986 | Bacteria | 1671 |
| 430 | Ga0207677_10001106 | 3300026023 | Bacteria | 14727 |
| 431 | Ga0207677_10003691 | 3300026023 | Bacteria | 8119 |
| 432 | Ga0207677_10029892 | 3300026023 | Bacteria | 3470 |
| 433 | Ga0207677_10113150 | 3300026023 | Bacteria | 2025 |
| 434 | Ga0207677_10155303 | 3300026023 | Bacteria | 1771 |
| 435 | Ga0207703_10007447 | 3300026035 | Bacteria | 8694 |
| 436 | Ga0207703_10015583 | 3300026035 | Bacteria | 5929 |
| 437 | Ga0207703_10031846 | 3300026035 | Bacteria | 4172 |
| 438 | Ga0207703_10035385 | 3300026035 | Bacteria | 3968 |
| 439 | Ga0207703_10054951 | 3300026035 | Bacteria | 3239 |
| 440 | Ga0207639_10218941 | 3300026041 | Bacteria | 1643 |
| 441 | Ga0207639_10229905 | 3300026041 | Bacteria | 1607 |
| 442 | Ga0207678_10069611 | 3300026067 | Bacteria | 3017 |
| 443 | Ga0207678_10335539 | 3300026067 | Bacteria | 1302 |
| 444 | Ga0207678_10808897 | 3300026067 | Bacteria | 828 |
| 445 | Ga0207708_10021642 | 3300026075 | Bacteria | 4850 |
| 446 | Ga0207708_10726361 | 3300026075 | Bacteria | 851 |
| 447 | Ga0207702_10042415 | 3300026078 | Bacteria | 3816 |
| 448 | Ga0207702_10577782 | 3300026078 | Bacteria | 1101 |
| 449 | Ga0207641_10004081 | 3300026088 | Bacteria | 12733 |
| 450 | Ga0207641_10010585 | 3300026088 | Bacteria | 7567 |
| 451 | Ga0207641_10121844 | 3300026088 | Bacteria | 2328 |
| 452 | Ga0207641_10133817 | 3300026088 | Bacteria | 2229 |
| 453 | Ga0207641_10232078 | 3300026088 | Bacteria | 1715 |
| 454 | Ga0207648_10000310 | 3300026089 | Bacteria | 53471 |
| 455 | Ga0207648_10017210 | 3300026089 | Bacteria | 6588 |
| 456 | Ga0207648_10114922 | 3300026089 | Bacteria | 2365 |
| 457 | Ga0207648_10226719 | 3300026089 | Bacteria | 1661 |
| 458 | Ga0207648_10337228 | 3300026089 | Bacteria | 1357 |
| 459 | Ga0207676_10002699 | 3300026095 | Bacteria | 12624 |
| 460 | Ga0207676_10018266 | 3300026095 | Bacteria | 5096 |
| 461 | Ga0207676_10029671 | 3300026095 | Bacteria | 4097 |
| 462 | Ga0207676_10066501 | 3300026095 | Bacteria | 2875 |
| 463 | Ga0207676_10476556 | 3300026095 | Bacteria | 1181 |
| 464 | Ga0207676_10638197 | 3300026095 | Bacteria | 1026 |
| 465 | Ga0207674_10060222 | 3300026116 | Bacteria | 3840 |
| 466 | Ga0207674_10293199 | 3300026116 | Bacteria | 1575 |
| 467 | Ga0207675_100002511 | 3300026118 | Bacteria | 18156 |
| 468 | Ga0207675_100012910 | 3300026118 | Bacteria | 7801 |
| 469 | Ga0207675_100018129 | 3300026118 | Bacteria | 6564 |
| 470 | Ga0207675_100079277 | 3300026118 | Bacteria | 3077 |
| 471 | Ga0207675_100190784 | 3300026118 | Bacteria | 1965 |
| 472 | Ga0207675_100212811 | 3300026118 | Bacteria | 1860 |
| 473 | Ga0207683_10028632 | 3300026121 | Bacteria | 4819 |
| 474 | Ga0207683_10037011 | 3300026121 | Bacteria | 4250 |
| 475 | Ga0207683_10066783 | 3300026121 | Bacteria | 3172 |
| 476 | Ga0207683_10083050 | 3300026121 | Bacteria | 2847 |
| 477 | Ga0207683_10102365 | 3300026121 | Bacteria | 2557 |
| 478 | Ga0207683_10262310 | 3300026121 | Bacteria | 1578 |
| 479 | Ga0207683_10285400 | 3300026121 | Bacteria | 1509 |
| 480 | Ga0207683_10349818 | 3300026121 | Bacteria | 1356 |
| 481 | Ga0207698_10014722 | 3300026142 | Bacteria | 5210 |
| 482 | Ga0207698_10095019 | 3300026142 | Bacteria | 2453 |
| 483 | Ga0207698_10164835 | 3300026142 | Bacteria | 1943 |
| 484 | Ga0207698_10380232 | 3300026142 | Bacteria | 1343 |
| 485 | Ga0207698_10446677 | 3300026142 | Bacteria | 1247 |
| 486 | Ga0209281_1000454 | 3300027111 | Bacteria | 58234 |
| 487 | Ga0268265_10035164 | 3300028380 | Bacteria | 3658 |
| 488 | Ga0268265_10062352 | 3300028380 | Bacteria | 2864 |
| 489 | Ga0268265_10095674 | 3300028380 | Bacteria | 2385 |
| 490 | Ga0268265_10428105 | 3300028380 | Bacteria | 1230 |
| 491 | Ga0268264_10001585 | 3300028381 | Bacteria | 21062 |
| 492 | Ga0268264_10004874 | 3300028381 | Bacteria | 11372 |
| 493 | Ga0268264_10013175 | 3300028381 | Bacteria | 6803 |
| 494 | Ga0268264_10242966 | 3300028381 | Bacteria | 1668 |
| 495 | Ga0268264_10344600 | 3300028381 | Bacteria | 1416 |
| 496 | Ga0307517_10059170 | 3300028786 | Bacteria | 3675 |
| 497 | Ga0307515_10020164 | 3300028794 | Bacteria | 11918 |
| 498 | Ga0307515_10094534 | 3300028794 | Bacteria | 3691 |
| 499 | Ga0307515_10214253 | 3300028794 | Bacteria | 1761 |
| 500 | Ga0307512_10077698 | 3300030522 | Bacteria | 2410 |
| 501 | Ga0265328_10009284 | 3300031239 | Bacteria | 4010 |
| 502 | Ga0265328_10059482 | 3300031239 | Bacteria | 1403 |
| 503 | Ga0265331_10003982 | 3300031250 | Bacteria | 9334 |
| 504 | Ga0265327_10000311 | 3300031251 | Bacteria | 93995 |
| 505 | Ga0265327_10061279 | 3300031251 | Bacteria | 1920 |
| 506 | Ga0307513_10012208 | 3300031456 | Bacteria | 10620 |
| 507 | Ga0307513_10036776 | 3300031456 | Bacteria | 5456 |
| 508 | Ga0307513_10082308 | 3300031456 | Bacteria | 3314 |
| 509 | Ga0307509_10004656 | 3300031507 | Bacteria | 19591 |
| 510 | Ga0307509_10016899 | 3300031507 | Bacteria | 8418 |
| 511 | Ga0307509_10095855 | 3300031507 | Bacteria | 3021 |
| 512 | Ga0307509_10142586 | 3300031507 | Bacteria | 2328 |
| 513 | Ga0307509_10318850 | 3300031507 | Bacteria | 1292 |
| 514 | Ga0307408_100565212 | 3300031548 | Bacteria | 1006 |
| 515 | Ga0307508_10000140 | 3300031616 | Bacteria | 85941 |
| 516 | Ga0307508_10002494 | 3300031616 | Bacteria | 19401 |
| 517 | Ga0307508_10002594 | 3300031616 | Bacteria | 19009 |
| 518 | Ga0307508_10023375 | 3300031616 | Bacteria | 5612 |
| 519 | Ga0307514_10171368 | 3300031649 | Bacteria | 1417 |
| 520 | Ga0307516_10001367 | 3300031730 | Bacteria | 33805 |
| 521 | Ga0307516_10450473 | 3300031730 | Bacteria | 943 |
| 522 | Ga0307405_10002079 | 3300031731 | Bacteria | 8724 |
| 523 | Ga0307405_10303228 | 3300031731 | Bacteria | 1213 |
| 524 | Ga0307413_10229201 | 3300031824 | Bacteria | 1363 |
| 525 | Ga0307410_10091829 | 3300031852 | Bacteria | 2157 |
| 526 | Ga0307406_10396714 | 3300031901 | Bacteria | 1092 |
| 527 | Ga0307412_10042851 | 3300031911 | Bacteria | 2944 |
| 528 | Ga0307409_100010869 | 3300031995 | Bacteria | 5696 |
| 529 | Ga0307416_100010522 | 3300032002 | Bacteria | 6115 |
| 530 | Ga0307416_100298896 | 3300032002 | Bacteria | 1599 |
| 531 | Ga0307414_10416130 | 3300032004 | Bacteria | 1171 |
| 532 | Ga0307411_10813272 | 3300032005 | Bacteria | 824 |
| 533 | Ga0307507_10031471 | 3300033179 | Bacteria | 5569 |
| 534 | Ga0307507_10099452 | 3300033179 | Bacteria | 2443 |
| 535 | Ga0307510_10035300 | 3300033180 | Bacteria | 5587 |
| 536 | Ga0307510_10060400 | 3300033180 | Bacteria | 3901 |
| 537 | Ga0373950_0020532 | 3300034818 | Bacteria | 1162 |
| 538 | Ga0373928_0010569 | 3300035084 | Bacteria | 1816 |
| 539 | Ga0373940_0106463 | 3300035088 | Bacteria | 856 |
| 540 | Ga0373944_0253281 | 3300035089 | Bacteria | 650 |
| 541 | Ga0373923_0088198 | 3300035111 | Bacteria | 1354 |
| 542 | Ga0373923_0150161 | 3300035111 | Bacteria | 1058 |
| 543 | Ga0373932_0026400 | 3300035112 | Bacteria | 1579 |
| 544 | Ga0373932_0136214 | 3300035112 | Bacteria | 831 |
| 545 | Ga0373939_0010079 | 3300035114 | Bacteria | 2355 |
| 546 | Ga0373945_0155260 | 3300035116 | Bacteria | 930 |
| 547 | Ga0373954_0036049 | 3300035118 | Bacteria | 2295 |
| 548 | Ga0373943_0037525 | 3300035170 | Bacteria | 2326 |
| 549 | Ga0373943_0449363 | 3300035170 | Bacteria | 749 |
| 550 | Ga0373955_0169413 | 3300035172 | Bacteria | 1292 |
| 551 | Ga0373931_0009527 | 3300035691 | Bacteria | 4643 |
| 552 | Ga0373931_0026741 | 3300035691 | Bacteria | 2940 |
| 553 | Ga0373947_0034410 | 3300035725 | Bacteria | 2996 |
| 554 | Ga0373937_0551889 | 3300036401 | Bacteria | 1094 |
| 555 | Ga0373937_0683092 | 3300036401 | Bacteria | 973 |
| 556 | Ga0373925_0002050 | 3300037068 | Bacteria | 16608 |
| 557 | Ga0373925_0018803 | 3300037068 | Bacteria | 5022 |
| 558 | Ga0373925_0064335 | 3300037068 | Bacteria | 2761 |
| 559 | Ga0395905_0014692 | 3300037471 | Bacteria | 7467 |
| 560 | Ga0395905_0102984 | 3300037471 | Bacteria | 2680 |
| 561 | Ga0436365_0483654 | 3300039437 | Bacteria | 4339 |
| 562 | Ga0451793_0214308 | 3300041452 | Bacteria | 1956 |
| 563 | Ga0451795_0209198 | 3300041456 | Bacteria | 1164 |
| 564 | Ga0451804_0983626 | 3300041463 | Bacteria | 1033 |
| 565 | Ga0451853_1017854 | 3300041512 | Bacteria | 3064 |
| 566 | Ga0451853_3243327 | 3300041512 | Bacteria | 1075 |
| 567 | Ga0439455_0034325 | 3300042012 | Bacteria | 1276 |
| 568 | Ga0450898_020290 | 3300042134 | Bacteria | 1163 |
| 569 | Ga0451577_0341371 | 3300042876 | Bacteria | 1358 |
| 570 | Ga0451577_0716562 | 3300042876 | Bacteria | 906 |
| 571 | Ga0466961_0129667 | 3300044693 | Bacteria | 1581 |
| 572 | Ga0453684_0047579 | 3300044712 | Bacteria | 5685 |
| 573 | Ga0453684_0050849 | 3300044712 | Bacteria | 5444 |
| 574 | Ga0453684_0583250 | 3300044712 | Bacteria | 1228 |
| 575 | Ga0466971_0153358 | 3300044719 | Bacteria | 1076 |
| 576 | Ga0466968_0010618 | 3300044735 | Bacteria | 3575 |
| 577 | Ga0451576_0032948 | 3300045051 | Bacteria | 5509 |
| 578 | Ga0451576_0176990 | 3300045051 | Bacteria | 2227 |
| 579 | Ga0451576_0892800 | 3300045051 | Bacteria | 932 |
| 580 | Ga0495629_0202920 | 3300046459 | Bacteria | 1370 |
| 581 | Ga0495629_0287684 | 3300046459 | Bacteria | 1127 |
| 582 | Ga0495638_0098925 | 3300046460 | Bacteria | 1747 |
| 583 | Ga0495582_0047911 | 3300046473 | Bacteria | 2354 |
| 584 | Ga0495582_0100993 | 3300046473 | Bacteria | 1615 |
| 585 | Ga0495639_0186330 | 3300046475 | Bacteria | 1012 |
| 586 | Ga0495583_0112415 | 3300046506 | Bacteria | 1153 |
| 587 | Ga0495608_0122921 | 3300046511 | Bacteria | 1664 |
| 588 | Ga0495616_0141655 | 3300046513 | Bacteria | 1094 |
| 589 | Ga0495618_0257697 | 3300046514 | Bacteria | 1093 |
| 590 | Ga0495630_0076893 | 3300046517 | Bacteria | 2516 |
| 591 | Ga0495630_0210803 | 3300046517 | Bacteria | 1483 |
| 592 | Ga0495632_0010620 | 3300046519 | Bacteria | 5434 |
| 593 | Ga0495632_0014268 | 3300046519 | Bacteria | 4499 |
| 594 | Ga0495586_0010100 | 3300046535 | Bacteria | 5024 |
| 595 | Ga0495621_0043281 | 3300046539 | Bacteria | 1588 |
| 596 | Ga0495597_0023049 | 3300046542 | Bacteria | 2881 |
| 597 | Ga0495656_0226443 | 3300046615 | Bacteria | 937 |
| 598 | Ga0495668_0365057 | 3300046616 | Bacteria | 793 |
| 599 | Ga0495625_0112700 | 3300046660 | Bacteria | 1858 |
| 600 | Ga0495635_0287995 | 3300046663 | Bacteria | 1103 |
| 601 | Ga0495599_0171209 | 3300046678 | Bacteria | 1340 |
| 602 | Ga0495647_0252674 | 3300046681 | Bacteria | 785 |
| 603 | Ga0495658_0008156 | 3300046683 | Bacteria | 5188 |
| 604 | Ga0495658_0058485 | 3300046683 | Bacteria | 2205 |
| 605 | Ga0495658_0084402 | 3300046683 | Bacteria | 1870 |
| 606 | Ga0495658_0091762 | 3300046683 | Bacteria | 1799 |
| 607 | Ga0495658_0099971 | 3300046683 | Bacteria | 1730 |
| 608 | Ga0495613_0189448 | 3300046689 | Bacteria | 1454 |
| 609 | Ga0495624_0058215 | 3300046690 | Bacteria | 2428 |
| 610 | Ga0495671_0023643 | 3300046692 | Bacteria | 3210 |
| 611 | Ga0495649_0002061 | 3300046694 | Bacteria | 14469 |
| 612 | Ga0495581_0359463 | 3300047315 | Bacteria | 850 |
| 613 | Ga0495674_0224707 | 3300047319 | Bacteria | 1551 |
| 614 | Ga0495676_0090835 | 3300047321 | Bacteria | 2284 |
| 615 | Ga0495687_002698 | 3300047443 | Bacteria | 13771 |
| 616 | Ga0495684_0153217 | 3300047471 | Bacteria | 1723 |
| 617 | Ga0495684_0176233 | 3300047471 | Bacteria | 1587 |
| 618 | Ga0495614_0091752 | 3300048089 | Bacteria | 1322 |
| 619 | Ga0495614_0147259 | 3300048089 | Bacteria | 1049 |
| 620 | Ga0496100_0042521 | 3300048903 | Bacteria | 2902 |
| 621 | Ga0496101_0076512 | 3300048904 | Bacteria | 2465 |
| 622 | Ga0496101_0616567 | 3300048904 | Bacteria | 858 |
| 623 | Ga0496102_0047870 | 3300048905 | Bacteria | 3887 |
| 624 | Ga0496103_0301411 | 3300048906 | Bacteria | 1031 |
| 625 | Ga0496104_0155059 | 3300048907 | Bacteria | 2198 |
| 626 | Ga0496105_0089172 | 3300048908 | Bacteria | 2548 |
| 627 | Ga0496105_0109224 | 3300048908 | Bacteria | 2284 |
| 628 | Ga0496106_0009675 | 3300048909 | Bacteria | 7120 |
| 629 | Ga0496106_0699925 | 3300048909 | Bacteria | 808 |
| 630 | Ga0496107_0033571 | 3300048910 | Bacteria | 3672 |
| 631 | Ga0496108_0042916 | 3300048911 | Bacteria | 3776 |
| 632 | Ga0496108_0114612 | 3300048911 | Bacteria | 2308 |
| 633 | Ga0496108_0270411 | 3300048911 | Bacteria | 1479 |
| 634 | Ga0496108_0362980 | 3300048911 | Bacteria | 1264 |
| 635 | Ga0496109_0071475 | 3300048912 | Bacteria | 3186 |
| 636 | Ga0496109_0147834 | 3300048912 | Bacteria | 2199 |
| 637 | Ga0496109_0549562 | 3300048912 | Bacteria | 1089 |
| 638 | Ga0496110_0019345 | 3300048913 | Bacteria | 5728 |
| 639 | Ga0496110_0061842 | 3300048913 | Bacteria | 3306 |
| 640 | Ga0496110_0158563 | 3300048913 | Bacteria | 2051 |
| 641 | Ga0496111_0066099 | 3300048914 | Bacteria | 2625 |
| 642 | Ga0496112_0009035 | 3300048915 | Bacteria | 8950 |
| 643 | Ga0496113_0127874 | 3300048916 | Bacteria | 1991 |
| 644 | Ga0496114_0019482 | 3300048917 | Bacteria | 5497 |
| 645 | Ga0496114_0086981 | 3300048917 | Bacteria | 2649 |
| 646 | Ga0496114_0565929 | 3300048917 | Bacteria | 1003 |
| 647 | Ga0496121_0044818 | 3300048924 | Bacteria | 3809 |
| 648 | Ga0496124_0018411 | 3300048927 | Bacteria | 6540 |
| 649 | Ga0496125_0008691 | 3300048928 | Bacteria | 10576 |
| 650 | nmdc:mga03683_1375_c1 | 3300050489 | Bacteria | 7227 |
| 651 | nmdc:mga03683_14349_c1 | 3300050489 | Bacteria | 2929 |
| 652 | nmdc:mga03683_81638_c1 | 3300050489 | Bacteria | 1397 |
| 653 | nmdc:mga03n38_101530_c1 | 3300050490 | Bacteria | 1388 |
| 654 | nmdc:mga03n38_10498_c1 | 3300050490 | Bacteria | 3411 |
| 655 | nmdc:mga03n38_49835_c1 | 3300050490 | Bacteria | 1863 |
| 656 | nmdc:mga03n38_83803_c1 | 3300050490 | Bacteria | 1504 |
| 657 | nmdc:mga00v17_35885_c1 | 3300050491 | Bacteria | 2953 |
| 658 | nmdc:mga00v17_70495_c1 | 3300050491 | Bacteria | 2165 |
| 659 | nmdc:mga0yw44_13996_c1 | 3300050492 | Bacteria | 4243 |
| 660 | nmdc:mga0yw44_615477_c1 | 3300050492 | Bacteria | 738 |
| 661 | nmdc:mga0k408_126403_c1 | 3300050493 | Bacteria | 1517 |
| 662 | nmdc:mga0k408_298_c1 | 3300050493 | Bacteria | 26818 |
| 663 | nmdc:mga0k408_323886_c1 | 3300050493 | Bacteria | 920 |
| 664 | nmdc:mga0k408_33293_c1 | 3300050493 | Bacteria | 2947 |
| 665 | nmdc:mga0k408_41470_c1 | 3300050493 | Bacteria | 2650 |
| 666 | nmdc:mga0k408_44081_c1 | 3300050493 | Bacteria | 2572 |
| 667 | nmdc:mga0k408_791_c1 | 3300050493 | Bacteria | 17435 |
| 668 | nmdc:mga06z11_315376_c1 | 3300050494 | Bacteria | 932 |
| 669 | nmdc:mga06z11_3754_c1 | 3300050494 | Bacteria | 5906 |
| 670 | nmdc:mga04h51_117335_c1 | 3300050495 | Bacteria | 988 |
| 671 | nmdc:mga07m45_1450_c1 | 3300050496 | Bacteria | 10878 |
| 672 | nmdc:mga07m45_17067_c1 | 3300050496 | Bacteria | 3893 |
| 673 | nmdc:mga07m45_27438_c1 | 3300050496 | Bacteria | 3137 |
| 674 | nmdc:mga07m45_410_c1 | 3300050496 | Bacteria | 17752 |
| 675 | nmdc:mga07m45_53099_c1 | 3300050496 | Bacteria | 2290 |
| 676 | nmdc:mga05p37_213124_c1 | 3300050507 | Bacteria | 2334 |
| 677 | nmdc:mga09592_8800_c1 | 3300050508 | Bacteria | 8214 |
| 678 | nmdc:mga0qj67_46651_c1 | 3300050509 | Bacteria | 3421 |
| 679 | nmdc:mga08y16_439247_c1 | 3300050511 | Bacteria | 1332 |
| 680 | nmdc:mga0sz30_28770_c1 | 3300050516 | Bacteria | 2288 |
| 681 | nmdc:mga0sz30_83374_c1 | 3300050516 | Bacteria | 1385 |
| 682 | Ga0495595_0142503 | 3300053084 | Bacteria | 1176 |
| 683 | Ga0495619_0351664 | 3300053085 | Bacteria | 1019 |
| 684 | Ga0500646_0087255 | 3300053090 | Bacteria | 961 |
| 685 | Ga0500651_0012618 | 3300053093 | Bacteria | 5124 |
| 686 | Ga0500651_0059615 | 3300053093 | Bacteria | 2386 |
| 687 | Ga0500650_0017430 | 3300053098 | Bacteria | 3100 |
| 688 | Ga0500650_0064020 | 3300053098 | Bacteria | 1718 |
| 689 | Ga0500569_005309 | 3300053109 | Bacteria | 2763 |
| 690 | Ga0500607_145452 | 3300053121 | Bacteria | 1108 |
| 691 | Ga0500621_109017 | 3300053126 | Bacteria | 1084 |
| 692 | Ga0500628_002165 | 3300053129 | Bacteria | 3275 |
| 693 | Ga0500642_0041636 | 3300053130 | Bacteria | 1987 |
| 694 | Ga0500642_0119995 | 3300053130 | Bacteria | 1229 |
| 695 | Ga0500652_008946 | 3300053131 | Bacteria | 3364 |
| 696 | Ga0500559_0000135 | 3300053136 | Bacteria | 56960 |
| 697 | Ga0500577_0198743 | 3300053142 | Bacteria | 864 |
| 698 | Ga0500590_047089 | 3300053148 | Bacteria | 2202 |
| 699 | Ga0500616_0227219 | 3300053153 | Bacteria | 810 |
| 700 | Ga0500622_0005574 | 3300053156 | Bacteria | 7513 |
| 701 | Ga0500622_0038578 | 3300053156 | Bacteria | 2491 |
| 702 | Ga0500636_0072809 | 3300053177 | Bacteria | 1991 |
| 703 | Ga0500637_0345498 | 3300053178 | Bacteria | 794 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035089 | Ga0373944_0253281 | Ga0373944_0253281_12_491 | 159 |
| 2 | 3300026075 | Ga0207708_10726361 | Ga0207708_107263611 | 164 |
| 3 | 3300005844 | Ga0068862_100235457 | Ga0068862_1002354572 | 189 |
| 4 | 3300033180 | Ga0307510_10060400 | Ga0307510_100604003 | 189 |
| 5 | 3300053090 | Ga0500646_0087255 | Ga0500646_0087255_112_759 | 189 |
| 6 | 3300053093 | Ga0500651_0059615 | Ga0500651_0059615_646_1293 | 189 |
| 7 | 3300053126 | Ga0500621_109017 | Ga0500621_109017_235_882 | 189 |
| 8 | 3300053136 | Ga0500559_0000135 | Ga0500559_0000135_13241_13888 | 189 |
| 9 | 3300053153 | Ga0500616_0227219 | Ga0500616_0227219_145_792 | 189 |
| 10 | 3300053156 | Ga0500622_0038578 | Ga0500622_0038578_570_1217 | 189 |
| 11 | 3300005367 | Ga0070667_100218257 | Ga0070667_1002182572 | 193 |
| 12 | 3300005441 | Ga0070700_100172198 | Ga0070700_1001721982 | 193 |
| 13 | 3300005456 | Ga0070678_100354784 | Ga0070678_1003547842 | 193 |
| 14 | 3300005543 | Ga0070672_100518423 | Ga0070672_1005184233 | 193 |
| 15 | 3300005719 | Ga0068861_100001256 | Ga0068861_1000012562 | 193 |
| 16 | 3300005843 | Ga0068860_100000989 | Ga0068860_10000098910 | 193 |
| 17 | 3300013297 | Ga0157378_10127038 | Ga0157378_101270383 | 193 |
| 18 | 3300013308 | Ga0157375_10094724 | Ga0157375_100947242 | 193 |
| 19 | 3300014968 | Ga0157379_10007711 | Ga0157379_100077115 | 193 |
| 20 | 3300014969 | Ga0157376_10641687 | Ga0157376_106416872 | 193 |
| 21 | 3300025938 | Ga0207704_10014643 | Ga0207704_100146432 | 193 |
| 22 | 3300025940 | Ga0207691_10429243 | Ga0207691_104292432 | 193 |
| 23 | 3300025942 | Ga0207689_10282697 | Ga0207689_102826972 | 193 |
| 24 | 3300025961 | Ga0207712_10172443 | Ga0207712_101724432 | 193 |
| 25 | 3300025986 | Ga0207658_10191045 | Ga0207658_101910452 | 193 |
| 26 | 3300026035 | Ga0207703_10031846 | Ga0207703_100318462 | 193 |
| 27 | 3300026089 | Ga0207648_10000310 | Ga0207648_1000031029 | 193 |
| 28 | 3300026118 | Ga0207675_100012910 | Ga0207675_1000129105 | 193 |
| 29 | 3300026121 | Ga0207683_10037011 | Ga0207683_100370113 | 193 |
| 30 | 3300028381 | Ga0268264_10013175 | Ga0268264_100131754 | 193 |
| 31 | 3300005459 | Ga0068867_100002034 | Ga0068867_10000203414 | 195 |
| 32 | 3300005844 | Ga0068862_100078880 | Ga0068862_1000788802 | 195 |
| 33 | 3300009176 | Ga0105242_10123243 | Ga0105242_101232432 | 195 |
| 34 | 3300026089 | Ga0207648_10114922 | Ga0207648_101149222 | 195 |
| 35 | 3300028380 | Ga0268265_10428105 | Ga0268265_104281052 | 195 |
| 36 | 3300042876 | Ga0451577_0341371 | Ga0451577_0341371_347_946 | 196 |
| 37 | 3300044712 | Ga0453684_0583250 | Ga0453684_0583250_412_1011 | 196 |
| 38 | 3300045051 | Ga0451576_0892800 | Ga0451576_0892800_183_782 | 196 |
| 39 | 3300013306 | Ga0163162_10002520 | Ga0163162_100025204 | 197 |
| 40 | 3300005335 | Ga0070666_10524669 | Ga0070666_105246692 | 206 |
| 41 | 3300005367 | Ga0070667_100175866 | Ga0070667_1001758662 | 206 |
| 42 | 3300009545 | Ga0105237_10186555 | Ga0105237_101865552 | 206 |
| 43 | 3300041463 | Ga0451804_0983626 | Ga0451804_0983626_169_789 | 206 |
| 44 | 3300044712 | Ga0453684_0050849 | Ga0453684_0050849_317_946 | 206 |
| 45 | 3300046459 | Ga0495629_0287684 | Ga0495629_0287684_373_1011 | 206 |
| 46 | 3300025914 | Ga0207671_10145005 | Ga0207671_101450052 | 207 |
| 47 | 3300025986 | Ga0207658_10068012 | Ga0207658_100680123 | 207 |
| 48 | 3300031239 | Ga0265328_10009284 | Ga0265328_100092843 | 207 |
| 49 | 3300031250 | Ga0265331_10003982 | Ga0265331_100039825 | 207 |
| 50 | 3300031251 | Ga0265327_10000311 | Ga0265327_1000031135 | 207 |
| 51 | 3300031507 | Ga0307509_10142586 | Ga0307509_101425862 | 207 |
| 52 | 3300032005 | Ga0307411_10813272 | Ga0307411_108132721 | 207 |
| 53 | 3300005331 | Ga0070670_100047389 | Ga0070670_1000473893 | 209 |
| 54 | 3300005354 | Ga0070675_100224039 | Ga0070675_1002240392 | 209 |
| 55 | 3300005367 | Ga0070667_100321752 | Ga0070667_1003217522 | 209 |
| 56 | 3300005456 | Ga0070678_100743552 | Ga0070678_1007435521 | 209 |
| 57 | 3300025926 | Ga0207659_10077319 | Ga0207659_100773192 | 209 |
| 58 | 3300025933 | Ga0207706_10211252 | Ga0207706_102112522 | 209 |
| 59 | 3300026121 | Ga0207683_10102365 | Ga0207683_101023653 | 209 |
| 60 | 3300035084 | Ga0373928_0010569 | Ga0373928_0010569_669_1316 | 209 |
| 61 | 3300035691 | Ga0373931_0026741 | Ga0373931_0026741_489_1136 | 209 |
| 62 | 3300046514 | Ga0495618_0257697 | Ga0495618_0257697_298_945 | 209 |
| 63 | 3300046517 | Ga0495630_0076893 | Ga0495630_0076893_480_1127 | 209 |
| 64 | 3300046690 | Ga0495624_0058215 | Ga0495624_0058215_1447_2094 | 209 |
| 65 | 3300047315 | Ga0495581_0359463 | Ga0495581_0359463_120_767 | 209 |
| 66 | 3300047321 | Ga0495676_0090835 | Ga0495676_0090835_618_1265 | 209 |
| 67 | 3300048089 | Ga0495614_0147259 | Ga0495614_0147259_281_928 | 209 |
| 68 | 3300003316 | rootH1_10048080 | rootH1_100480802 | 210 |
| 69 | 3300031507 | Ga0307509_10004656 | Ga0307509_100046567 | 210 |
| 70 | iso_pu_bacteria | 2585428057 | 2587726333 | 211 |
| 71 | iso_pu_bacteria | 2585428058 | 2587731763 | 211 |
| 72 | iso_pu_bacteria | 2643221644 | 2644245425 | 211 |
| 73 | 3300005336 | Ga0070680_100029873 | Ga0070680_1000298733 | 213 |
| 74 | 3300005530 | Ga0070679_100012199 | Ga0070679_1000121996 | 213 |
| 75 | 3300014326 | Ga0157380_10104898 | Ga0157380_101048983 | 213 |
| 76 | 3300025917 | Ga0207660_10108625 | Ga0207660_101086252 | 213 |
| 77 | 3300025921 | Ga0207652_10006543 | Ga0207652_100065436 | 213 |
| 78 | 3300037471 | Ga0395905_0014692 | Ga0395905_0014692_6132_6836 | 213 |
| 79 | 3300044693 | Ga0466961_0129667 | Ga0466961_0129667_510_1214 | 213 |
| 80 | 3300044719 | Ga0466971_0153358 | Ga0466971_0153358_241_945 | 213 |
| 81 | 3300003775 | Ga0055524_1000079 | Ga0055524_1000079100 | 214 |
| 82 | 3300005262 | Ga0065165_1046569 | Ga0065165_10465691 | 214 |
| 83 | 3300006353 | Ga0075370_10235062 | Ga0075370_102350622 | 214 |
| 84 | 3300025299 | Ga0209256_1000011 | Ga0209256_1000011101 | 214 |
| 85 | 3300025933 | Ga0207706_10134453 | Ga0207706_101344533 | 214 |
| 86 | 3300026078 | Ga0207702_10042415 | Ga0207702_100424153 | 214 |
| 87 | 3300042876 | Ga0451577_0716562 | Ga0451577_0716562_74_718 | 214 |
| 88 | 3300044712 | Ga0453684_0047579 | Ga0453684_0047579_4410_5057 | 214 |
| 89 | 3300045051 | Ga0451576_0032948 | Ga0451576_0032948_4135_4779 | 214 |
| 90 | 3300048917 | Ga0496114_0019482 | Ga0496114_0019482_1060_1707 | 214 |
| 91 | 3300053178 | Ga0500637_0345498 | Ga0500637_0345498_59_718 | 214 |
| 92 | 3300002774 | JGI25150J39212_1013974 | JGI25150J39212_10139741 | 215 |
| 93 | 3300003215 | JGI25153J46596_10005823 | JGI25153J46596_100058232 | 215 |
| 94 | 3300003215 | JGI25153J46596_10005931 | JGI25153J46596_100059313 | 215 |
| 95 | 3300003215 | JGI25153J46596_10010740 | JGI25153J46596_100107403 | 215 |
| 96 | 3300003771 | Ga0055526_1018996 | Ga0055526_10189962 | 215 |
| 97 | 3300003792 | Ga0055540_1000004 | Ga0055540_1000004137 | 215 |
| 98 | 3300003794 | Ga0055531_10008300 | Ga0055531_100083003 | 215 |
| 99 | 3300005295 | Ga0065707_10092687 | Ga0065707_100926873 | 215 |
| 100 | 3300005327 | Ga0070658_10070761 | Ga0070658_100707613 | 215 |
| 101 | 3300005327 | Ga0070658_10103249 | Ga0070658_101032492 | 215 |
| 102 | 3300005327 | Ga0070658_10250839 | Ga0070658_102508392 | 215 |
| 103 | 3300005328 | Ga0070676_10003580 | Ga0070676_100035804 | 215 |
| 104 | 3300005328 | Ga0070676_10036707 | Ga0070676_100367073 | 215 |
| 105 | 3300005330 | Ga0070690_100013302 | Ga0070690_1000133023 | 215 |
| 106 | 3300005331 | Ga0070670_100004564 | Ga0070670_1000045647 | 215 |
| 107 | 3300005331 | Ga0070670_100104394 | Ga0070670_1001043943 | 215 |
| 108 | 3300005331 | Ga0070670_100653351 | Ga0070670_1006533511 | 215 |
| 109 | 3300005333 | Ga0070677_10013875 | Ga0070677_100138752 | 215 |
| 110 | 3300005333 | Ga0070677_10017543 | Ga0070677_100175432 | 215 |
| 111 | 3300005333 | Ga0070677_10034440 | Ga0070677_100344402 | 215 |
| 112 | 3300005333 | Ga0070677_10064275 | Ga0070677_100642752 | 215 |
| 113 | 3300005334 | Ga0068869_100000287 | Ga0068869_1000002878 | 215 |
| 114 | 3300005334 | Ga0068869_100007333 | Ga0068869_1000073334 | 215 |
| 115 | 3300005334 | Ga0068869_100144210 | Ga0068869_1001442102 | 215 |
| 116 | 3300005335 | Ga0070666_10038958 | Ga0070666_100389583 | 215 |
| 117 | 3300005335 | Ga0070666_10051094 | Ga0070666_100510943 | 215 |
| 118 | 3300005335 | Ga0070666_10096529 | Ga0070666_100965291 | 215 |
| 119 | 3300005335 | Ga0070666_10225758 | Ga0070666_102257582 | 215 |
| 120 | 3300005338 | Ga0068868_100035131 | Ga0068868_1000351313 | 215 |
| 121 | 3300005338 | Ga0068868_100043620 | Ga0068868_1000436202 | 215 |
| 122 | 3300005338 | Ga0068868_100050267 | Ga0068868_1000502674 | 215 |
| 123 | 3300005338 | Ga0068868_100199950 | Ga0068868_1001999501 | 215 |
| 124 | 3300005338 | Ga0068868_100254955 | Ga0068868_1002549552 | 215 |
| 125 | 3300005338 | Ga0068868_100605073 | Ga0068868_1006050731 | 215 |
| 126 | 3300005339 | Ga0070660_100075701 | Ga0070660_1000757012 | 215 |
| 127 | 3300005339 | Ga0070660_100287217 | Ga0070660_1002872172 | 215 |
| 128 | 3300005339 | Ga0070660_100339685 | Ga0070660_1003396852 | 215 |
| 129 | 3300005343 | Ga0070687_100304885 | Ga0070687_1003048851 | 215 |
| 130 | 3300005344 | Ga0070661_100001326 | Ga0070661_1000013269 | 215 |
| 131 | 3300005344 | Ga0070661_100096521 | Ga0070661_1000965212 | 215 |
| 132 | 3300005344 | Ga0070661_100551070 | Ga0070661_1005510701 | 215 |
| 133 | 3300005344 | Ga0070661_100590459 | Ga0070661_1005904591 | 215 |
| 134 | 3300005347 | Ga0070668_100006437 | Ga0070668_1000064376 | 215 |
| 135 | 3300005347 | Ga0070668_100031606 | Ga0070668_1000316062 | 215 |
| 136 | 3300005353 | Ga0070669_100008796 | Ga0070669_1000087964 | 215 |
| 137 | 3300005353 | Ga0070669_100100348 | Ga0070669_1001003482 | 215 |
| 138 | 3300005354 | Ga0070675_100000322 | Ga0070675_1000003225 | 215 |
| 139 | 3300005354 | Ga0070675_100011400 | Ga0070675_1000114004 | 215 |
| 140 | 3300005354 | Ga0070675_100025355 | Ga0070675_1000253555 | 215 |
| 141 | 3300005354 | Ga0070675_100027488 | Ga0070675_1000274883 | 215 |
| 142 | 3300005354 | Ga0070675_100047502 | Ga0070675_1000475023 | 215 |
| 143 | 3300005355 | Ga0070671_100014031 | Ga0070671_1000140315 | 215 |
| 144 | 3300005355 | Ga0070671_100041904 | Ga0070671_1000419044 | 215 |
| 145 | 3300005355 | Ga0070671_100062646 | Ga0070671_1000626463 | 215 |
| 146 | 3300005355 | Ga0070671_100157386 | Ga0070671_1001573862 | 215 |
| 147 | 3300005355 | Ga0070671_100482188 | Ga0070671_1004821882 | 215 |
| 148 | 3300005356 | Ga0070674_100010469 | Ga0070674_1000104693 | 215 |
| 149 | 3300005356 | Ga0070674_100167871 | Ga0070674_1001678712 | 215 |
| 150 | 3300005356 | Ga0070674_100259095 | Ga0070674_1002590951 | 215 |
| 151 | 3300005356 | Ga0070674_100271028 | Ga0070674_1002710282 | 215 |
| 152 | 3300005364 | Ga0070673_100002962 | Ga0070673_1000029628 | 215 |
| 153 | 3300005364 | Ga0070673_100132159 | Ga0070673_1001321592 | 215 |
| 154 | 3300005364 | Ga0070673_100265472 | Ga0070673_1002654721 | 215 |
| 155 | 3300005364 | Ga0070673_100290539 | Ga0070673_1002905392 | 215 |
| 156 | 3300005364 | Ga0070673_100394347 | Ga0070673_1003943472 | 215 |
| 157 | 3300005364 | Ga0070673_100687772 | Ga0070673_1006877722 | 215 |
| 158 | 3300005366 | Ga0070659_100000336 | Ga0070659_10000033630 | 215 |
| 159 | 3300005367 | Ga0070667_100004438 | Ga0070667_1000044389 | 215 |
| 160 | 3300005367 | Ga0070667_100009358 | Ga0070667_1000093587 | 215 |
| 161 | 3300005367 | Ga0070667_100012223 | Ga0070667_1000122237 | 215 |
| 162 | 3300005367 | Ga0070667_100029416 | Ga0070667_1000294162 | 215 |
| 163 | 3300005367 | Ga0070667_100155900 | Ga0070667_1001559003 | 215 |
| 164 | 3300005367 | Ga0070667_100230754 | Ga0070667_1002307542 | 215 |
| 165 | 3300005367 | Ga0070667_100277639 | Ga0070667_1002776392 | 215 |
| 166 | 3300005438 | Ga0070701_10300297 | Ga0070701_103002972 | 215 |
| 167 | 3300005441 | Ga0070700_100004808 | Ga0070700_1000048082 | 215 |
| 168 | 3300005455 | Ga0070663_100008422 | Ga0070663_1000084227 | 215 |
| 169 | 3300005455 | Ga0070663_100059976 | Ga0070663_1000599762 | 215 |
| 170 | 3300005455 | Ga0070663_100273119 | Ga0070663_1002731191 | 215 |
| 171 | 3300005455 | Ga0070663_100539211 | Ga0070663_1005392112 | 215 |
| 172 | 3300005456 | Ga0070678_100027686 | Ga0070678_1000276863 | 215 |
| 173 | 3300005456 | Ga0070678_100045697 | Ga0070678_1000456973 | 215 |
| 174 | 3300005456 | Ga0070678_100076567 | Ga0070678_1000765672 | 215 |
| 175 | 3300005456 | Ga0070678_100205439 | Ga0070678_1002054392 | 215 |
| 176 | 3300005456 | Ga0070678_100222524 | Ga0070678_1002225242 | 215 |
| 177 | 3300005456 | Ga0070678_100460996 | Ga0070678_1004609962 | 215 |
| 178 | 3300005456 | Ga0070678_100482982 | Ga0070678_1004829821 | 215 |
| 179 | 3300005457 | Ga0070662_100038169 | Ga0070662_1000381692 | 215 |
| 180 | 3300005457 | Ga0070662_100057681 | Ga0070662_1000576812 | 215 |
| 181 | 3300005458 | Ga0070681_10314729 | Ga0070681_103147292 | 215 |
| 182 | 3300005459 | Ga0068867_100101659 | Ga0068867_1001016593 | 215 |
| 183 | 3300005459 | Ga0068867_100141393 | Ga0068867_1001413932 | 215 |
| 184 | 3300005459 | Ga0068867_100193719 | Ga0068867_1001937192 | 215 |
| 185 | 3300005459 | Ga0068867_100256975 | Ga0068867_1002569751 | 215 |
| 186 | 3300005459 | Ga0068867_100559883 | Ga0068867_1005598832 | 215 |
| 187 | 3300005466 | Ga0070685_10074581 | Ga0070685_100745812 | 215 |
| 188 | 3300005466 | Ga0070685_10415401 | Ga0070685_104154012 | 215 |
| 189 | 3300005467 | Ga0070706_100001359 | Ga0070706_10000135914 | 215 |
| 190 | 3300005468 | Ga0070707_100097547 | Ga0070707_1000975472 | 215 |
| 191 | 3300005535 | Ga0070684_100160632 | Ga0070684_1001606323 | 215 |
| 192 | 3300005539 | Ga0068853_100524126 | Ga0068853_1005241262 | 215 |
| 193 | 3300005539 | Ga0068853_100604623 | Ga0068853_1006046232 | 215 |
| 194 | 3300005543 | Ga0070672_100008994 | Ga0070672_1000089943 | 215 |
| 195 | 3300005543 | Ga0070672_100015361 | Ga0070672_1000153612 | 215 |
| 196 | 3300005543 | Ga0070672_100216745 | Ga0070672_1002167451 | 215 |
| 197 | 3300005543 | Ga0070672_100238256 | Ga0070672_1002382561 | 215 |
| 198 | 3300005543 | Ga0070672_100538176 | Ga0070672_1005381762 | 215 |
| 199 | 3300005543 | Ga0070672_100862763 | Ga0070672_1008627631 | 215 |
| 200 | 3300005546 | Ga0070696_100671760 | Ga0070696_1006717601 | 215 |
| 201 | 3300005548 | Ga0070665_100488282 | Ga0070665_1004882822 | 215 |
| 202 | 3300005563 | Ga0068855_100404923 | Ga0068855_1004049231 | 215 |
| 203 | 3300005563 | Ga0068855_100468355 | Ga0068855_1004683552 | 215 |
| 204 | 3300005564 | Ga0070664_100017678 | Ga0070664_1000176785 | 215 |
| 205 | 3300005564 | Ga0070664_100250050 | Ga0070664_1002500501 | 215 |
| 206 | 3300005564 | Ga0070664_100574723 | Ga0070664_1005747232 | 215 |
| 207 | 3300005577 | Ga0068857_100133634 | Ga0068857_1001336343 | 215 |
| 208 | 3300005577 | Ga0068857_100306491 | Ga0068857_1003064912 | 215 |
| 209 | 3300005577 | Ga0068857_101079164 | Ga0068857_1010791641 | 215 |
| 210 | 3300005578 | Ga0068854_100037572 | Ga0068854_1000375723 | 215 |
| 211 | 3300005578 | Ga0068854_100059484 | Ga0068854_1000594842 | 215 |
| 212 | 3300005578 | Ga0068854_100072892 | Ga0068854_1000728922 | 215 |
| 213 | 3300005578 | Ga0068854_100553840 | Ga0068854_1005538402 | 215 |
| 214 | 3300005615 | Ga0070702_100122951 | Ga0070702_1001229512 | 215 |
| 215 | 3300005616 | Ga0068852_100011794 | Ga0068852_1000117942 | 215 |
| 216 | 3300005616 | Ga0068852_100092739 | Ga0068852_1000927393 | 215 |
| 217 | 3300005616 | Ga0068852_100498015 | Ga0068852_1004980152 | 215 |
| 218 | 3300005617 | Ga0068859_100008152 | Ga0068859_10000815213 | 215 |
| 219 | 3300005617 | Ga0068859_100023977 | Ga0068859_1000239774 | 215 |
| 220 | 3300005617 | Ga0068859_100057687 | Ga0068859_1000576873 | 215 |
| 221 | 3300005617 | Ga0068859_100180990 | Ga0068859_1001809902 | 215 |
| 222 | 3300005618 | Ga0068864_100006810 | Ga0068864_1000068103 | 215 |
| 223 | 3300005618 | Ga0068864_100006813 | Ga0068864_1000068135 | 215 |
| 224 | 3300005618 | Ga0068864_100052350 | Ga0068864_1000523503 | 215 |
| 225 | 3300005618 | Ga0068864_100068692 | Ga0068864_1000686922 | 215 |
| 226 | 3300005618 | Ga0068864_100170056 | Ga0068864_1001700563 | 215 |
| 227 | 3300005618 | Ga0068864_100213981 | Ga0068864_1002139812 | 215 |
| 228 | 3300005618 | Ga0068864_101049522 | Ga0068864_1010495221 | 215 |
| 229 | 3300005718 | Ga0068866_10115104 | Ga0068866_101151042 | 215 |
| 230 | 3300005719 | Ga0068861_100033391 | Ga0068861_1000333913 | 215 |
| 231 | 3300005719 | Ga0068861_100417916 | Ga0068861_1004179162 | 215 |
| 232 | 3300005834 | Ga0068851_10031438 | Ga0068851_100314382 | 215 |
| 233 | 3300005834 | Ga0068851_10073763 | Ga0068851_100737632 | 215 |
| 234 | 3300005834 | Ga0068851_10075709 | Ga0068851_100757092 | 215 |
| 235 | 3300005834 | Ga0068851_10080770 | Ga0068851_100807702 | 215 |
| 236 | 3300005841 | Ga0068863_100008722 | Ga0068863_1000087222 | 215 |
| 237 | 3300005841 | Ga0068863_100021758 | Ga0068863_1000217582 | 215 |
| 238 | 3300005841 | Ga0068863_100038295 | Ga0068863_1000382954 | 215 |
| 239 | 3300005841 | Ga0068863_100156834 | Ga0068863_1001568343 | 215 |
| 240 | 3300005841 | Ga0068863_100224273 | Ga0068863_1002242732 | 215 |
| 241 | 3300005842 | Ga0068858_100004522 | Ga0068858_1000045222 | 215 |
| 242 | 3300005842 | Ga0068858_100021085 | Ga0068858_1000210853 | 215 |
| 243 | 3300005842 | Ga0068858_100051898 | Ga0068858_1000518983 | 215 |
| 244 | 3300005842 | Ga0068858_100167873 | Ga0068858_1001678732 | 215 |
| 245 | 3300005843 | Ga0068860_100005562 | Ga0068860_10000556211 | 215 |
| 246 | 3300005843 | Ga0068860_100082121 | Ga0068860_1000821213 | 215 |
| 247 | 3300005843 | Ga0068860_100085907 | Ga0068860_1000859071 | 215 |
| 248 | 3300005843 | Ga0068860_100222431 | Ga0068860_1002224312 | 215 |
| 249 | 3300005844 | Ga0068862_100079156 | Ga0068862_1000791563 | 215 |
| 250 | 3300005844 | Ga0068862_100171192 | Ga0068862_1001711922 | 215 |
| 251 | 3300006028 | Ga0070717_10722906 | Ga0070717_107229062 | 215 |
| 252 | 3300006038 | Ga0075365_10024481 | Ga0075365_100244813 | 215 |
| 253 | 3300006038 | Ga0075365_10572908 | Ga0075365_105729082 | 215 |
| 254 | 3300006042 | Ga0075368_10001139 | Ga0075368_100011393 | 215 |
| 255 | 3300006048 | Ga0075363_100000866 | Ga0075363_1000008665 | 215 |
| 256 | 3300006048 | Ga0075363_100088685 | Ga0075363_1000886852 | 215 |
| 257 | 3300006048 | Ga0075363_100206767 | Ga0075363_1002067671 | 215 |
| 258 | 3300006048 | Ga0075363_100330071 | Ga0075363_1003300711 | 215 |
| 259 | 3300006051 | Ga0075364_10021082 | Ga0075364_100210823 | 215 |
| 260 | 3300006051 | Ga0075364_10060464 | Ga0075364_100604642 | 215 |
| 261 | 3300006177 | Ga0075362_10008657 | Ga0075362_100086572 | 215 |
| 262 | 3300006177 | Ga0075362_10064522 | Ga0075362_100645222 | 215 |
| 263 | 3300006177 | Ga0075362_10152163 | Ga0075362_101521632 | 215 |
| 264 | 3300006178 | Ga0075367_10013893 | Ga0075367_100138933 | 215 |
| 265 | 3300006178 | Ga0075367_10037441 | Ga0075367_100374413 | 215 |
| 266 | 3300006178 | Ga0075367_10039167 | Ga0075367_100391672 | 215 |
| 267 | 3300006186 | Ga0075369_10058088 | Ga0075369_100580883 | 215 |
| 268 | 3300006195 | Ga0075366_10000694 | Ga0075366_1000069421 | 215 |
| 269 | 3300006195 | Ga0075366_10009550 | Ga0075366_100095502 | 215 |
| 270 | 3300006195 | Ga0075366_10033502 | Ga0075366_100335022 | 215 |
| 271 | 3300006195 | Ga0075366_10094778 | Ga0075366_100947782 | 215 |
| 272 | 3300006195 | Ga0075366_10167834 | Ga0075366_101678342 | 215 |
| 273 | 3300006237 | Ga0097621_100054327 | Ga0097621_1000543273 | 215 |
| 274 | 3300006237 | Ga0097621_100145211 | Ga0097621_1001452112 | 215 |
| 275 | 3300006237 | Ga0097621_100177209 | Ga0097621_1001772092 | 215 |
| 276 | 3300006237 | Ga0097621_100379196 | Ga0097621_1003791962 | 215 |
| 277 | 3300006353 | Ga0075370_10000326 | Ga0075370_100003267 | 215 |
| 278 | 3300006353 | Ga0075370_10000436 | Ga0075370_100004365 | 215 |
| 279 | 3300006353 | Ga0075370_10009246 | Ga0075370_100092462 | 215 |
| 280 | 3300006353 | Ga0075370_10011217 | Ga0075370_100112173 | 215 |
| 281 | 3300006353 | Ga0075370_10030032 | Ga0075370_100300323 | 215 |
| 282 | 3300006358 | Ga0068871_100041817 | Ga0068871_1000418172 | 215 |
| 283 | 3300006358 | Ga0068871_100769640 | Ga0068871_1007696402 | 215 |
| 284 | 3300006846 | Ga0075430_100072946 | Ga0075430_1000729462 | 215 |
| 285 | 3300006880 | Ga0075429_100005458 | Ga0075429_1000054587 | 215 |
| 286 | 3300006881 | Ga0068865_100013136 | Ga0068865_1000131364 | 215 |
| 287 | 3300006881 | Ga0068865_100044231 | Ga0068865_1000442312 | 215 |
| 288 | 3300006881 | Ga0068865_100259393 | Ga0068865_1002593932 | 215 |
| 289 | 3300006931 | Ga0097620_100008153 | Ga0097620_10000815313 | 215 |
| 290 | 3300006931 | Ga0097620_100023977 | Ga0097620_1000239774 | 215 |
| 291 | 3300006931 | Ga0097620_100057688 | Ga0097620_1000576883 | 215 |
| 292 | 3300006931 | Ga0097620_100180988 | Ga0097620_1001809882 | 215 |
| 293 | 3300006946 | Ga0079104_1000352 | Ga0079104_100035231 | 215 |
| 294 | 3300009093 | Ga0105240_10123389 | Ga0105240_101233893 | 215 |
| 295 | 3300009093 | Ga0105240_10459432 | Ga0105240_104594322 | 215 |
| 296 | 3300009098 | Ga0105245_10012538 | Ga0105245_100125382 | 215 |
| 297 | 3300009098 | Ga0105245_10133816 | Ga0105245_101338163 | 215 |
| 298 | 3300009098 | Ga0105245_10342330 | Ga0105245_103423302 | 215 |
| 299 | 3300009101 | Ga0105247_10110819 | Ga0105247_101108193 | 215 |
| 300 | 3300009147 | Ga0114129_10252574 | Ga0114129_102525742 | 215 |
| 301 | 3300009148 | Ga0105243_10244094 | Ga0105243_102440942 | 215 |
| 302 | 3300009174 | Ga0105241_10092023 | Ga0105241_100920233 | 215 |
| 303 | 3300009176 | Ga0105242_10096246 | Ga0105242_100962462 | 215 |
| 304 | 3300009176 | Ga0105242_10255866 | Ga0105242_102558662 | 215 |
| 305 | 3300009176 | Ga0105242_10575875 | Ga0105242_105758752 | 215 |
| 306 | 3300009177 | Ga0105248_10005678 | Ga0105248_1000567810 | 215 |
| 307 | 3300009177 | Ga0105248_10037339 | Ga0105248_100373395 | 215 |
| 308 | 3300009177 | Ga0105248_10164097 | Ga0105248_101640972 | 215 |
| 309 | 3300009177 | Ga0105248_10546135 | Ga0105248_105461352 | 215 |
| 310 | 3300009545 | Ga0105237_10053047 | Ga0105237_100530473 | 215 |
| 311 | 3300009545 | Ga0105237_10503317 | Ga0105237_105033172 | 215 |
| 312 | 3300009551 | Ga0105238_10197500 | Ga0105238_101975002 | 215 |
| 313 | 3300009553 | Ga0105249_10059678 | Ga0105249_100596784 | 215 |
| 314 | 3300009553 | Ga0105249_11000370 | Ga0105249_110003702 | 215 |
| 315 | 3300010375 | Ga0105239_10094657 | Ga0105239_100946573 | 215 |
| 316 | 3300010375 | Ga0105239_10098645 | Ga0105239_100986452 | 215 |
| 317 | 3300011119 | Ga0105246_10516056 | Ga0105246_105160562 | 215 |
| 318 | 3300011119 | Ga0105246_10708553 | Ga0105246_107085531 | 215 |
| 319 | 3300013100 | Ga0157373_10004841 | Ga0157373_100048413 | 215 |
| 320 | 3300013102 | Ga0157371_10204596 | Ga0157371_102045961 | 215 |
| 321 | 3300013104 | Ga0157370_10230937 | Ga0157370_102309372 | 215 |
| 322 | 3300013105 | Ga0157369_10064757 | Ga0157369_100647572 | 215 |
| 323 | 3300013105 | Ga0157369_10229909 | Ga0157369_102299092 | 215 |
| 324 | 3300013296 | Ga0157374_10132987 | Ga0157374_101329872 | 215 |
| 325 | 3300013296 | Ga0157374_10178734 | Ga0157374_101787343 | 215 |
| 326 | 3300013296 | Ga0157374_10442001 | Ga0157374_104420012 | 215 |
| 327 | 3300013296 | Ga0157374_10633625 | Ga0157374_106336252 | 215 |
| 328 | 3300013296 | Ga0157374_10656350 | Ga0157374_106563502 | 215 |
| 329 | 3300013297 | Ga0157378_10236886 | Ga0157378_102368862 | 215 |
| 330 | 3300013297 | Ga0157378_10359092 | Ga0157378_103590922 | 215 |
| 331 | 3300013306 | Ga0163162_10038029 | Ga0163162_100380293 | 215 |
| 332 | 3300013306 | Ga0163162_10107216 | Ga0163162_101072162 | 215 |
| 333 | 3300013306 | Ga0163162_10310114 | Ga0163162_103101141 | 215 |
| 334 | 3300013307 | Ga0157372_10268809 | Ga0157372_102688092 | 215 |
| 335 | 3300013308 | Ga0157375_10003007 | Ga0157375_100030073 | 215 |
| 336 | 3300013308 | Ga0157375_10003841 | Ga0157375_100038414 | 215 |
| 337 | 3300013308 | Ga0157375_10153375 | Ga0157375_101533752 | 215 |
| 338 | 3300013308 | Ga0157375_10231241 | Ga0157375_102312412 | 215 |
| 339 | 3300013308 | Ga0157375_10643527 | Ga0157375_106435272 | 215 |
| 340 | 3300013308 | Ga0157375_11232497 | Ga0157375_112324971 | 215 |
| 341 | 3300014325 | Ga0163163_10023012 | Ga0163163_100230124 | 215 |
| 342 | 3300014325 | Ga0163163_10378722 | Ga0163163_103787222 | 215 |
| 343 | 3300014325 | Ga0163163_10927844 | Ga0163163_109278441 | 215 |
| 344 | 3300014326 | Ga0157380_10001456 | Ga0157380_100014569 | 215 |
| 345 | 3300014326 | Ga0157380_10015049 | Ga0157380_100150494 | 215 |
| 346 | 3300014326 | Ga0157380_10050553 | Ga0157380_100505533 | 215 |
| 347 | 3300014745 | Ga0157377_10017784 | Ga0157377_100177843 | 215 |
| 348 | 3300014745 | Ga0157377_10337711 | Ga0157377_103377112 | 215 |
| 349 | 3300014745 | Ga0157377_10540347 | Ga0157377_105403471 | 215 |
| 350 | 3300014968 | Ga0157379_10046568 | Ga0157379_100465684 | 215 |
| 351 | 3300014968 | Ga0157379_10090299 | Ga0157379_100902993 | 215 |
| 352 | 3300014968 | Ga0157379_10091557 | Ga0157379_100915574 | 215 |
| 353 | 3300014968 | Ga0157379_10101466 | Ga0157379_101014663 | 215 |
| 354 | 3300014968 | Ga0157379_10114831 | Ga0157379_101148312 | 215 |
| 355 | 3300014968 | Ga0157379_10250806 | Ga0157379_102508062 | 215 |
| 356 | 3300014968 | Ga0157379_10707495 | Ga0157379_107074952 | 215 |
| 357 | 3300014968 | Ga0157379_10831783 | Ga0157379_108317832 | 215 |
| 358 | 3300014969 | Ga0157376_10057077 | Ga0157376_100570772 | 215 |
| 359 | 3300014969 | Ga0157376_10088944 | Ga0157376_100889443 | 215 |
| 360 | 3300015262 | Ga0182007_10060635 | Ga0182007_100606352 | 215 |
| 361 | 3300017792 | Ga0163161_10010581 | Ga0163161_100105812 | 215 |
| 362 | 3300017792 | Ga0163161_10043893 | Ga0163161_100438932 | 215 |
| 363 | 3300017792 | Ga0163161_10180512 | Ga0163161_101805122 | 215 |
| 364 | 3300017792 | Ga0163161_10202527 | Ga0163161_102025272 | 215 |
| 365 | 3300025245 | Ga0207425_1001224 | Ga0207425_10012249 | 215 |
| 366 | 3300025258 | Ga0209129_1000041 | Ga0209129_100004123 | 215 |
| 367 | 3300025273 | Ga0209673_1021882 | Ga0209673_10218822 | 215 |
| 368 | 3300025295 | Ga0209564_1000029 | Ga0209564_1000029169 | 215 |
| 369 | 3300025297 | Ga0209758_1000043 | Ga0209758_1000043271 | 215 |
| 370 | 3300025297 | Ga0209758_1000057 | Ga0209758_10000573 | 215 |
| 371 | 3300025298 | Ga0209050_1003660 | Ga0209050_10036602 | 215 |
| 372 | 3300025303 | Ga0209051_1000016 | Ga0209051_1000016229 | 215 |
| 373 | 3300025304 | Ga0209257_1000102 | Ga0209257_100010264 | 215 |
| 374 | 3300025315 | Ga0207697_10033989 | Ga0207697_100339893 | 215 |
| 375 | 3300025321 | Ga0207656_10046886 | Ga0207656_100468863 | 215 |
| 376 | 3300025893 | Ga0207682_10008765 | Ga0207682_100087653 | 215 |
| 377 | 3300025893 | Ga0207682_10015590 | Ga0207682_100155903 | 215 |
| 378 | 3300025893 | Ga0207682_10016142 | Ga0207682_100161422 | 215 |
| 379 | 3300025893 | Ga0207682_10031014 | Ga0207682_100310142 | 215 |
| 380 | 3300025899 | Ga0207642_10004119 | Ga0207642_100041192 | 215 |
| 381 | 3300025899 | Ga0207642_10090705 | Ga0207642_100907052 | 215 |
| 382 | 3300025901 | Ga0207688_10094685 | Ga0207688_100946852 | 215 |
| 383 | 3300025901 | Ga0207688_10340443 | Ga0207688_103404432 | 215 |
| 384 | 3300025903 | Ga0207680_10031915 | Ga0207680_100319152 | 215 |
| 385 | 3300025903 | Ga0207680_10047700 | Ga0207680_100477003 | 215 |
| 386 | 3300025907 | Ga0207645_10006800 | Ga0207645_100068004 | 215 |
| 387 | 3300025907 | Ga0207645_10043145 | Ga0207645_100431452 | 215 |
| 388 | 3300025907 | Ga0207645_10100275 | Ga0207645_101002752 | 215 |
| 389 | 3300025907 | Ga0207645_10269379 | Ga0207645_102693792 | 215 |
| 390 | 3300025908 | Ga0207643_10138303 | Ga0207643_101383032 | 215 |
| 391 | 3300025908 | Ga0207643_10159122 | Ga0207643_101591222 | 215 |
| 392 | 3300025909 | Ga0207705_10412832 | Ga0207705_104128322 | 215 |
| 393 | 3300025911 | Ga0207654_10048113 | Ga0207654_100481133 | 215 |
| 394 | 3300025913 | Ga0207695_10074259 | Ga0207695_100742594 | 215 |
| 395 | 3300025913 | Ga0207695_10290834 | Ga0207695_102908342 | 215 |
| 396 | 3300025914 | Ga0207671_10015949 | Ga0207671_100159493 | 215 |
| 397 | 3300025914 | Ga0207671_10072300 | Ga0207671_100723002 | 215 |
| 398 | 3300025918 | Ga0207662_10086628 | Ga0207662_100866282 | 215 |
| 399 | 3300025919 | Ga0207657_10095410 | Ga0207657_100954102 | 215 |
| 400 | 3300025920 | Ga0207649_10011600 | Ga0207649_100116005 | 215 |
| 401 | 3300025920 | Ga0207649_10094310 | Ga0207649_100943102 | 215 |
| 402 | 3300025920 | Ga0207649_10600990 | Ga0207649_106009901 | 215 |
| 403 | 3300025922 | Ga0207646_10084736 | Ga0207646_100847363 | 215 |
| 404 | 3300025923 | Ga0207681_10000205 | Ga0207681_100002058 | 215 |
| 405 | 3300025923 | Ga0207681_10083208 | Ga0207681_100832082 | 215 |
| 406 | 3300025923 | Ga0207681_10184498 | Ga0207681_101844982 | 215 |
| 407 | 3300025923 | Ga0207681_10444798 | Ga0207681_104447982 | 215 |
| 408 | 3300025924 | Ga0207694_10038195 | Ga0207694_100381952 | 215 |
| 409 | 3300025924 | Ga0207694_10220461 | Ga0207694_102204612 | 215 |
| 410 | 3300025925 | Ga0207650_10002265 | Ga0207650_100022653 | 215 |
| 411 | 3300025925 | Ga0207650_10002632 | Ga0207650_100026323 | 215 |
| 412 | 3300025925 | Ga0207650_10049976 | Ga0207650_100499762 | 215 |
| 413 | 3300025926 | Ga0207659_10000640 | Ga0207659_100006402 | 215 |
| 414 | 3300025926 | Ga0207659_10005482 | Ga0207659_100054824 | 215 |
| 415 | 3300025926 | Ga0207659_10029748 | Ga0207659_100297483 | 215 |
| 416 | 3300025926 | Ga0207659_10055002 | Ga0207659_100550022 | 215 |
| 417 | 3300025926 | Ga0207659_10218711 | Ga0207659_102187112 | 215 |
| 418 | 3300025927 | Ga0207687_10062639 | Ga0207687_100626393 | 215 |
| 419 | 3300025927 | Ga0207687_10076478 | Ga0207687_100764783 | 215 |
| 420 | 3300025927 | Ga0207687_10105424 | Ga0207687_101054242 | 215 |
| 421 | 3300025931 | Ga0207644_10004364 | Ga0207644_100043645 | 215 |
| 422 | 3300025931 | Ga0207644_10115431 | Ga0207644_101154313 | 215 |
| 423 | 3300025931 | Ga0207644_10116173 | Ga0207644_101161732 | 215 |
| 424 | 3300025931 | Ga0207644_10148244 | Ga0207644_101482442 | 215 |
| 425 | 3300025931 | Ga0207644_10374540 | Ga0207644_103745402 | 215 |
| 426 | 3300025931 | Ga0207644_10868920 | Ga0207644_108689201 | 215 |
| 427 | 3300025932 | Ga0207690_10013283 | Ga0207690_100132833 | 215 |
| 428 | 3300025932 | Ga0207690_10137966 | Ga0207690_101379663 | 215 |
| 429 | 3300025932 | Ga0207690_10422398 | Ga0207690_104223982 | 215 |
| 430 | 3300025933 | Ga0207706_10020517 | Ga0207706_100205173 | 215 |
| 431 | 3300025934 | Ga0207686_10166644 | Ga0207686_101666442 | 215 |
| 432 | 3300025935 | Ga0207709_10426815 | Ga0207709_104268152 | 215 |
| 433 | 3300025936 | Ga0207670_10016862 | Ga0207670_100168621 | 215 |
| 434 | 3300025936 | Ga0207670_10192515 | Ga0207670_101925152 | 215 |
| 435 | 3300025937 | Ga0207669_10025734 | Ga0207669_100257342 | 215 |
| 436 | 3300025937 | Ga0207669_10128822 | Ga0207669_101288222 | 215 |
| 437 | 3300025937 | Ga0207669_10153035 | Ga0207669_101530352 | 215 |
| 438 | 3300025938 | Ga0207704_10040771 | Ga0207704_100407712 | 215 |
| 439 | 3300025938 | Ga0207704_10222617 | Ga0207704_102226172 | 215 |
| 440 | 3300025938 | Ga0207704_10374449 | Ga0207704_103744492 | 215 |
| 441 | 3300025940 | Ga0207691_10005244 | Ga0207691_100052444 | 215 |
| 442 | 3300025940 | Ga0207691_10013352 | Ga0207691_100133523 | 215 |
| 443 | 3300025940 | Ga0207691_10031282 | Ga0207691_100312821 | 215 |
| 444 | 3300025940 | Ga0207691_10033674 | Ga0207691_100336742 | 215 |
| 445 | 3300025940 | Ga0207691_10049278 | Ga0207691_100492782 | 215 |
| 446 | 3300025940 | Ga0207691_10125365 | Ga0207691_101253653 | 215 |
| 447 | 3300025940 | Ga0207691_10347673 | Ga0207691_103476732 | 215 |
| 448 | 3300025940 | Ga0207691_10577625 | Ga0207691_105776252 | 215 |
| 449 | 3300025941 | Ga0207711_10003076 | Ga0207711_1000307615 | 215 |
| 450 | 3300025941 | Ga0207711_10004990 | Ga0207711_100049909 | 215 |
| 451 | 3300025941 | Ga0207711_10006526 | Ga0207711_100065267 | 215 |
| 452 | 3300025941 | Ga0207711_10044179 | Ga0207711_100441793 | 215 |
| 453 | 3300025941 | Ga0207711_10098658 | Ga0207711_100986583 | 215 |
| 454 | 3300025941 | Ga0207711_10373411 | Ga0207711_103734112 | 215 |
| 455 | 3300025941 | Ga0207711_10423257 | Ga0207711_104232572 | 215 |
| 456 | 3300025942 | Ga0207689_10000612 | Ga0207689_1000061220 | 215 |
| 457 | 3300025942 | Ga0207689_10007315 | Ga0207689_100073157 | 215 |
| 458 | 3300025942 | Ga0207689_10036567 | Ga0207689_100365673 | 215 |
| 459 | 3300025944 | Ga0207661_10028032 | Ga0207661_100280322 | 215 |
| 460 | 3300025945 | Ga0207679_10000526 | Ga0207679_1000052622 | 215 |
| 461 | 3300025945 | Ga0207679_10073308 | Ga0207679_100733083 | 215 |
| 462 | 3300025945 | Ga0207679_10133413 | Ga0207679_101334132 | 215 |
| 463 | 3300025945 | Ga0207679_10311431 | Ga0207679_103114312 | 215 |
| 464 | 3300025949 | Ga0207667_10505813 | Ga0207667_105058132 | 215 |
| 465 | 3300025960 | Ga0207651_10004882 | Ga0207651_100048823 | 215 |
| 466 | 3300025960 | Ga0207651_10062308 | Ga0207651_100623083 | 215 |
| 467 | 3300025960 | Ga0207651_10178703 | Ga0207651_101787032 | 215 |
| 468 | 3300025960 | Ga0207651_10377525 | Ga0207651_103775252 | 215 |
| 469 | 3300025960 | Ga0207651_10492238 | Ga0207651_104922381 | 215 |
| 470 | 3300025961 | Ga0207712_10021116 | Ga0207712_100211164 | 215 |
| 471 | 3300025972 | Ga0207668_10006845 | Ga0207668_100068454 | 215 |
| 472 | 3300025981 | Ga0207640_10055213 | Ga0207640_100552133 | 215 |
| 473 | 3300025981 | Ga0207640_10145212 | Ga0207640_101452122 | 215 |
| 474 | 3300025986 | Ga0207658_10001252 | Ga0207658_1000125210 | 215 |
| 475 | 3300025986 | Ga0207658_10005498 | Ga0207658_100054986 | 215 |
| 476 | 3300025986 | Ga0207658_10131396 | Ga0207658_101313963 | 215 |
| 477 | 3300025986 | Ga0207658_10188708 | Ga0207658_101887082 | 215 |
| 478 | 3300025986 | Ga0207658_10199074 | Ga0207658_101990742 | 215 |
| 479 | 3300026023 | Ga0207677_10001106 | Ga0207677_1000110611 | 215 |
| 480 | 3300026023 | Ga0207677_10003691 | Ga0207677_100036915 | 215 |
| 481 | 3300026023 | Ga0207677_10029892 | Ga0207677_100298923 | 215 |
| 482 | 3300026023 | Ga0207677_10113150 | Ga0207677_101131502 | 215 |
| 483 | 3300026023 | Ga0207677_10155303 | Ga0207677_101553032 | 215 |
| 484 | 3300026035 | Ga0207703_10007447 | Ga0207703_100074477 | 215 |
| 485 | 3300026035 | Ga0207703_10015583 | Ga0207703_100155834 | 215 |
| 486 | 3300026035 | Ga0207703_10035385 | Ga0207703_100353853 | 215 |
| 487 | 3300026035 | Ga0207703_10054951 | Ga0207703_100549512 | 215 |
| 488 | 3300026041 | Ga0207639_10218941 | Ga0207639_102189412 | 215 |
| 489 | 3300026041 | Ga0207639_10229905 | Ga0207639_102299052 | 215 |
| 490 | 3300026067 | Ga0207678_10069611 | Ga0207678_100696112 | 215 |
| 491 | 3300026067 | Ga0207678_10335539 | Ga0207678_103355391 | 215 |
| 492 | 3300026067 | Ga0207678_10808897 | Ga0207678_108088971 | 215 |
| 493 | 3300026075 | Ga0207708_10021642 | Ga0207708_100216424 | 215 |
| 494 | 3300026078 | Ga0207702_10577782 | Ga0207702_105777822 | 215 |
| 495 | 3300026088 | Ga0207641_10004081 | Ga0207641_1000408110 | 215 |
| 496 | 3300026088 | Ga0207641_10010585 | Ga0207641_100105858 | 215 |
| 497 | 3300026088 | Ga0207641_10121844 | Ga0207641_101218442 | 215 |
| 498 | 3300026088 | Ga0207641_10133817 | Ga0207641_101338172 | 215 |
| 499 | 3300026088 | Ga0207641_10232078 | Ga0207641_102320782 | 215 |
| 500 | 3300026089 | Ga0207648_10017210 | Ga0207648_100172104 | 215 |
| 501 | 3300026089 | Ga0207648_10226719 | Ga0207648_102267192 | 215 |
| 502 | 3300026089 | Ga0207648_10337228 | Ga0207648_103372282 | 215 |
| 503 | 3300026095 | Ga0207676_10002699 | Ga0207676_100026999 | 215 |
| 504 | 3300026095 | Ga0207676_10018266 | Ga0207676_100182664 | 215 |
| 505 | 3300026095 | Ga0207676_10029671 | Ga0207676_100296713 | 215 |
| 506 | 3300026095 | Ga0207676_10066501 | Ga0207676_100665013 | 215 |
| 507 | 3300026095 | Ga0207676_10476556 | Ga0207676_104765562 | 215 |
| 508 | 3300026095 | Ga0207676_10638197 | Ga0207676_106381972 | 215 |
| 509 | 3300026116 | Ga0207674_10060222 | Ga0207674_100602224 | 215 |
| 510 | 3300026116 | Ga0207674_10293199 | Ga0207674_102931992 | 215 |
| 511 | 3300026118 | Ga0207675_100002511 | Ga0207675_10000251116 | 215 |
| 512 | 3300026118 | Ga0207675_100018129 | Ga0207675_1000181291 | 215 |
| 513 | 3300026118 | Ga0207675_100079277 | Ga0207675_1000792772 | 215 |
| 514 | 3300026118 | Ga0207675_100190784 | Ga0207675_1001907842 | 215 |
| 515 | 3300026118 | Ga0207675_100212811 | Ga0207675_1002128112 | 215 |
| 516 | 3300026121 | Ga0207683_10028632 | Ga0207683_100286324 | 215 |
| 517 | 3300026121 | Ga0207683_10066783 | Ga0207683_100667832 | 215 |
| 518 | 3300026121 | Ga0207683_10083050 | Ga0207683_100830502 | 215 |
| 519 | 3300026121 | Ga0207683_10262310 | Ga0207683_102623102 | 215 |
| 520 | 3300026121 | Ga0207683_10285400 | Ga0207683_102854002 | 215 |
| 521 | 3300026121 | Ga0207683_10349818 | Ga0207683_103498182 | 215 |
| 522 | 3300026142 | Ga0207698_10014722 | Ga0207698_100147224 | 215 |
| 523 | 3300026142 | Ga0207698_10095019 | Ga0207698_100950193 | 215 |
| 524 | 3300026142 | Ga0207698_10164835 | Ga0207698_101648352 | 215 |
| 525 | 3300026142 | Ga0207698_10380232 | Ga0207698_103802322 | 215 |
| 526 | 3300026142 | Ga0207698_10446677 | Ga0207698_104466771 | 215 |
| 527 | 3300027111 | Ga0209281_1000454 | Ga0209281_100045426 | 215 |
| 528 | 3300028380 | Ga0268265_10035164 | Ga0268265_100351643 | 215 |
| 529 | 3300028380 | Ga0268265_10062352 | Ga0268265_100623522 | 215 |
| 530 | 3300028380 | Ga0268265_10095674 | Ga0268265_100956743 | 215 |
| 531 | 3300028381 | Ga0268264_10001585 | Ga0268264_1000158510 | 215 |
| 532 | 3300028381 | Ga0268264_10004874 | Ga0268264_100048746 | 215 |
| 533 | 3300028381 | Ga0268264_10242966 | Ga0268264_102429662 | 215 |
| 534 | 3300028381 | Ga0268264_10344600 | Ga0268264_103446001 | 215 |
| 535 | 3300028786 | Ga0307517_10059170 | Ga0307517_100591702 | 215 |
| 536 | 3300028794 | Ga0307515_10020164 | Ga0307515_100201645 | 215 |
| 537 | 3300028794 | Ga0307515_10094534 | Ga0307515_100945341 | 215 |
| 538 | 3300028794 | Ga0307515_10214253 | Ga0307515_102142532 | 215 |
| 539 | 3300030522 | Ga0307512_10077698 | Ga0307512_100776983 | 215 |
| 540 | 3300031239 | Ga0265328_10059482 | Ga0265328_100594822 | 215 |
| 541 | 3300031251 | Ga0265327_10061279 | Ga0265327_100612793 | 215 |
| 542 | 3300031456 | Ga0307513_10012208 | Ga0307513_100122084 | 215 |
| 543 | 3300031456 | Ga0307513_10036776 | Ga0307513_100367763 | 215 |
| 544 | 3300031456 | Ga0307513_10082308 | Ga0307513_100823083 | 215 |
| 545 | 3300031507 | Ga0307509_10016899 | Ga0307509_100168995 | 215 |
| 546 | 3300031507 | Ga0307509_10095855 | Ga0307509_100958553 | 215 |
| 547 | 3300031507 | Ga0307509_10318850 | Ga0307509_103188502 | 215 |
| 548 | 3300031548 | Ga0307408_100565212 | Ga0307408_1005652122 | 215 |
| 549 | 3300031616 | Ga0307508_10000140 | Ga0307508_1000014036 | 215 |
| 550 | 3300031616 | Ga0307508_10002494 | Ga0307508_100024946 | 215 |
| 551 | 3300031616 | Ga0307508_10002594 | Ga0307508_100025949 | 215 |
| 552 | 3300031616 | Ga0307508_10023375 | Ga0307508_100233754 | 215 |
| 553 | 3300031649 | Ga0307514_10171368 | Ga0307514_101713682 | 215 |
| 554 | 3300031730 | Ga0307516_10001367 | Ga0307516_1000136727 | 215 |
| 555 | 3300031730 | Ga0307516_10450473 | Ga0307516_104504732 | 215 |
| 556 | 3300031731 | Ga0307405_10002079 | Ga0307405_100020793 | 215 |
| 557 | 3300031731 | Ga0307405_10303228 | Ga0307405_103032282 | 215 |
| 558 | 3300031824 | Ga0307413_10229201 | Ga0307413_102292012 | 215 |
| 559 | 3300031852 | Ga0307410_10091829 | Ga0307410_100918293 | 215 |
| 560 | 3300031901 | Ga0307406_10396714 | Ga0307406_103967142 | 215 |
| 561 | 3300031911 | Ga0307412_10042851 | Ga0307412_100428512 | 215 |
| 562 | 3300031995 | Ga0307409_100010869 | Ga0307409_1000108693 | 215 |
| 563 | 3300032002 | Ga0307416_100010522 | Ga0307416_1000105222 | 215 |
| 564 | 3300032002 | Ga0307416_100298896 | Ga0307416_1002988962 | 215 |
| 565 | 3300032004 | Ga0307414_10416130 | Ga0307414_104161302 | 215 |
| 566 | 3300033179 | Ga0307507_10031471 | Ga0307507_100314712 | 215 |
| 567 | 3300033179 | Ga0307507_10099452 | Ga0307507_100994522 | 215 |
| 568 | 3300033180 | Ga0307510_10035300 | Ga0307510_100353004 | 215 |
| 569 | 3300034818 | Ga0373950_0020532 | Ga0373950_0020532_166_825 | 215 |
| 570 | 3300035088 | Ga0373940_0106463 | Ga0373940_0106463_59_718 | 215 |
| 571 | 3300035111 | Ga0373923_0088198 | Ga0373923_0088198_111_770 | 215 |
| 572 | 3300035111 | Ga0373923_0150161 | Ga0373923_0150161_199_846 | 215 |
| 573 | 3300035112 | Ga0373932_0026400 | Ga0373932_0026400_791_1450 | 215 |
| 574 | 3300035112 | Ga0373932_0136214 | Ga0373932_0136214_132_779 | 215 |
| 575 | 3300035114 | Ga0373939_0010079 | Ga0373939_0010079_443_1102 | 215 |
| 576 | 3300035116 | Ga0373945_0155260 | Ga0373945_0155260_98_745 | 215 |
| 577 | 3300035118 | Ga0373954_0036049 | Ga0373954_0036049_1519_2178 | 215 |
| 578 | 3300035170 | Ga0373943_0037525 | Ga0373943_0037525_1448_2107 | 215 |
| 579 | 3300035170 | Ga0373943_0449363 | Ga0373943_0449363_14_661 | 215 |
| 580 | 3300035172 | Ga0373955_0169413 | Ga0373955_0169413_584_1231 | 215 |
| 581 | 3300035691 | Ga0373931_0009527 | Ga0373931_0009527_1867_2526 | 215 |
| 582 | 3300035725 | Ga0373947_0034410 | Ga0373947_0034410_1489_2136 | 215 |
| 583 | 3300036401 | Ga0373937_0551889 | Ga0373937_0551889_345_992 | 215 |
| 584 | 3300036401 | Ga0373937_0683092 | Ga0373937_0683092_245_892 | 215 |
| 585 | 3300037068 | Ga0373925_0002050 | Ga0373925_0002050_3199_3846 | 215 |
| 586 | 3300037068 | Ga0373925_0018803 | Ga0373925_0018803_308_955 | 215 |
| 587 | 3300037068 | Ga0373925_0064335 | Ga0373925_0064335_1374_2021 | 215 |
| 588 | 3300037471 | Ga0395905_0102984 | Ga0395905_0102984_1658_2320 | 215 |
| 589 | 3300039437 | Ga0436365_0483654 | Ga0436365_0483654_908_1567 | 215 |
| 590 | 3300041452 | Ga0451793_0214308 | Ga0451793_0214308_249_896 | 215 |
| 591 | 3300041456 | Ga0451795_0209198 | Ga0451795_0209198_152_799 | 215 |
| 592 | 3300041512 | Ga0451853_1017854 | Ga0451853_1017854_1870_2517 | 215 |
| 593 | 3300041512 | Ga0451853_3243327 | Ga0451853_3243327_346_1011 | 215 |
| 594 | 3300042012 | Ga0439455_0034325 | Ga0439455_0034325_304_954 | 215 |
| 595 | 3300042134 | Ga0450898_020290 | Ga0450898_020290_344_1006 | 215 |
| 596 | 3300044735 | Ga0466968_0010618 | Ga0466968_0010618_814_1467 | 215 |
| 597 | 3300045051 | Ga0451576_0176990 | Ga0451576_0176990_231_890 | 215 |
| 598 | 3300046459 | Ga0495629_0202920 | Ga0495629_0202920_599_1258 | 215 |
| 599 | 3300046460 | Ga0495638_0098925 | Ga0495638_0098925_951_1598 | 215 |
| 600 | 3300046473 | Ga0495582_0047911 | Ga0495582_0047911_1165_1812 | 215 |
| 601 | 3300046473 | Ga0495582_0100993 | Ga0495582_0100993_473_1120 | 215 |
| 602 | 3300046475 | Ga0495639_0186330 | Ga0495639_0186330_246_905 | 215 |
| 603 | 3300046506 | Ga0495583_0112415 | Ga0495583_0112415_379_1026 | 215 |
| 604 | 3300046511 | Ga0495608_0122921 | Ga0495608_0122921_269_928 | 215 |
| 605 | 3300046513 | Ga0495616_0141655 | Ga0495616_0141655_225_872 | 215 |
| 606 | 3300046517 | Ga0495630_0210803 | Ga0495630_0210803_357_1016 | 215 |
| 607 | 3300046519 | Ga0495632_0010620 | Ga0495632_0010620_694_1341 | 215 |
| 608 | 3300046519 | Ga0495632_0014268 | Ga0495632_0014268_3093_3752 | 215 |
| 609 | 3300046535 | Ga0495586_0010100 | Ga0495586_0010100_451_1098 | 215 |
| 610 | 3300046539 | Ga0495621_0043281 | Ga0495621_0043281_727_1374 | 215 |
| 611 | 3300046542 | Ga0495597_0023049 | Ga0495597_0023049_1587_2246 | 215 |
| 612 | 3300046615 | Ga0495656_0226443 | Ga0495656_0226443_192_839 | 215 |
| 613 | 3300046616 | Ga0495668_0365057 | Ga0495668_0365057_77_736 | 215 |
| 614 | 3300046660 | Ga0495625_0112700 | Ga0495625_0112700_425_1072 | 215 |
| 615 | 3300046663 | Ga0495635_0287995 | Ga0495635_0287995_142_789 | 215 |
| 616 | 3300046678 | Ga0495599_0171209 | Ga0495599_0171209_456_1115 | 215 |
| 617 | 3300046681 | Ga0495647_0252674 | Ga0495647_0252674_89_736 | 215 |
| 618 | 3300046683 | Ga0495658_0008156 | Ga0495658_0008156_2412_3059 | 215 |
| 619 | 3300046683 | Ga0495658_0058485 | Ga0495658_0058485_1349_2008 | 215 |
| 620 | 3300046683 | Ga0495658_0084402 | Ga0495658_0084402_797_1444 | 215 |
| 621 | 3300046683 | Ga0495658_0091762 | Ga0495658_0091762_463_1110 | 215 |
| 622 | 3300046683 | Ga0495658_0099971 | Ga0495658_0099971_832_1479 | 215 |
| 623 | 3300046689 | Ga0495613_0189448 | Ga0495613_0189448_463_1110 | 215 |
| 624 | 3300046692 | Ga0495671_0023643 | Ga0495671_0023643_1862_2509 | 215 |
| 625 | 3300046694 | Ga0495649_0002061 | Ga0495649_0002061_1499_2158 | 215 |
| 626 | 3300047319 | Ga0495674_0224707 | Ga0495674_0224707_524_1183 | 215 |
| 627 | 3300047443 | Ga0495687_002698 | Ga0495687_002698_507_1166 | 215 |
| 628 | 3300047471 | Ga0495684_0153217 | Ga0495684_0153217_807_1454 | 215 |
| 629 | 3300047471 | Ga0495684_0176233 | Ga0495684_0176233_259_918 | 215 |
| 630 | 3300048089 | Ga0495614_0091752 | Ga0495614_0091752_361_1008 | 215 |
| 631 | 3300048903 | Ga0496100_0042521 | Ga0496100_0042521_577_1236 | 215 |
| 632 | 3300048904 | Ga0496101_0076512 | Ga0496101_0076512_1361_2020 | 215 |
| 633 | 3300048904 | Ga0496101_0616567 | Ga0496101_0616567_63_710 | 215 |
| 634 | 3300048905 | Ga0496102_0047870 | Ga0496102_0047870_1433_2092 | 215 |
| 635 | 3300048906 | Ga0496103_0301411 | Ga0496103_0301411_348_1007 | 215 |
| 636 | 3300048907 | Ga0496104_0155059 | Ga0496104_0155059_575_1222 | 215 |
| 637 | 3300048908 | Ga0496105_0089172 | Ga0496105_0089172_1780_2439 | 215 |
| 638 | 3300048908 | Ga0496105_0109224 | Ga0496105_0109224_835_1482 | 215 |
| 639 | 3300048909 | Ga0496106_0009675 | Ga0496106_0009675_1547_2206 | 215 |
| 640 | 3300048909 | Ga0496106_0699925 | Ga0496106_0699925_60_707 | 215 |
| 641 | 3300048910 | Ga0496107_0033571 | Ga0496107_0033571_1662_2321 | 215 |
| 642 | 3300048911 | Ga0496108_0042916 | Ga0496108_0042916_1870_2529 | 215 |
| 643 | 3300048911 | Ga0496108_0114612 | Ga0496108_0114612_753_1400 | 215 |
| 644 | 3300048911 | Ga0496108_0270411 | Ga0496108_0270411_598_1257 | 215 |
| 645 | 3300048911 | Ga0496108_0362980 | Ga0496108_0362980_565_1248 | 215 |
| 646 | 3300048912 | Ga0496109_0071475 | Ga0496109_0071475_44_727 | 215 |
| 647 | 3300048912 | Ga0496109_0147834 | Ga0496109_0147834_1085_1744 | 215 |
| 648 | 3300048912 | Ga0496109_0549562 | Ga0496109_0549562_370_1017 | 215 |
| 649 | 3300048913 | Ga0496110_0019345 | Ga0496110_0019345_263_922 | 215 |
| 650 | 3300048913 | Ga0496110_0061842 | Ga0496110_0061842_2277_2960 | 215 |
| 651 | 3300048913 | Ga0496110_0158563 | Ga0496110_0158563_274_921 | 215 |
| 652 | 3300048914 | Ga0496111_0066099 | Ga0496111_0066099_1443_2102 | 215 |
| 653 | 3300048915 | Ga0496112_0009035 | Ga0496112_0009035_7618_8301 | 215 |
| 654 | 3300048916 | Ga0496113_0127874 | Ga0496113_0127874_500_1159 | 215 |
| 655 | 3300048917 | Ga0496114_0086981 | Ga0496114_0086981_1708_2367 | 215 |
| 656 | 3300048917 | Ga0496114_0565929 | Ga0496114_0565929_81_728 | 215 |
| 657 | 3300048924 | Ga0496121_0044818 | Ga0496121_0044818_2586_3242 | 215 |
| 658 | 3300048927 | Ga0496124_0018411 | Ga0496124_0018411_5184_5840 | 215 |
| 659 | 3300048928 | Ga0496125_0008691 | Ga0496125_0008691_3963_4619 | 215 |
| 660 | 3300050489 | nmdc:mga03683_1375_c1 | nmdc:mga03683_1375_c1_4104_4751 | 215 |
| 661 | 3300050489 | nmdc:mga03683_14349_c1 | nmdc:mga03683_14349_c1_1908_2555 | 215 |
| 662 | 3300050489 | nmdc:mga03683_81638_c1 | nmdc:mga03683_81638_c1_229_876 | 215 |
| 663 | 3300050490 | nmdc:mga03n38_101530_c1 | nmdc:mga03n38_101530_c1_147_794 | 215 |
| 664 | 3300050490 | nmdc:mga03n38_10498_c1 | nmdc:mga03n38_10498_c1_323_970 | 215 |
| 665 | 3300050490 | nmdc:mga03n38_49835_c1 | nmdc:mga03n38_49835_c1_793_1443 | 215 |
| 666 | 3300050490 | nmdc:mga03n38_83803_c1 | nmdc:mga03n38_83803_c1_673_1320 | 215 |
| 667 | 3300050491 | nmdc:mga00v17_35885_c1 | nmdc:mga00v17_35885_c1_1698_2345 | 215 |
| 668 | 3300050491 | nmdc:mga00v17_70495_c1 | nmdc:mga00v17_70495_c1_1390_2037 | 215 |
| 669 | 3300050492 | nmdc:mga0yw44_13996_c1 | nmdc:mga0yw44_13996_c1_670_1317 | 215 |
| 670 | 3300050492 | nmdc:mga0yw44_615477_c1 | nmdc:mga0yw44_615477_c1_71_718 | 215 |
| 671 | 3300050493 | nmdc:mga0k408_126403_c1 | nmdc:mga0k408_126403_c1_285_941 | 215 |
| 672 | 3300050493 | nmdc:mga0k408_298_c1 | nmdc:mga0k408_298_c1_14932_15591 | 215 |
| 673 | 3300050493 | nmdc:mga0k408_323886_c1 | nmdc:mga0k408_323886_c1_103_750 | 215 |
| 674 | 3300050493 | nmdc:mga0k408_33293_c1 | nmdc:mga0k408_33293_c1_1935_2582 | 215 |
| 675 | 3300050493 | nmdc:mga0k408_41470_c1 | nmdc:mga0k408_41470_c1_1259_1906 | 215 |
| 676 | 3300050493 | nmdc:mga0k408_44081_c1 | nmdc:mga0k408_44081_c1_1428_2078 | 215 |
| 677 | 3300050493 | nmdc:mga0k408_791_c1 | nmdc:mga0k408_791_c1_14674_15321 | 215 |
| 678 | 3300050494 | nmdc:mga06z11_315376_c1 | nmdc:mga06z11_315376_c1_140_787 | 215 |
| 679 | 3300050494 | nmdc:mga06z11_3754_c1 | nmdc:mga06z11_3754_c1_4347_4994 | 215 |
| 680 | 3300050495 | nmdc:mga04h51_117335_c1 | nmdc:mga04h51_117335_c1_33_680 | 215 |
| 681 | 3300050496 | nmdc:mga07m45_1450_c1 | nmdc:mga07m45_1450_c1_572_1219 | 215 |
| 682 | 3300050496 | nmdc:mga07m45_17067_c1 | nmdc:mga07m45_17067_c1_2456_3103 | 215 |
| 683 | 3300050496 | nmdc:mga07m45_27438_c1 | nmdc:mga07m45_27438_c1_1938_2585 | 215 |
| 684 | 3300050496 | nmdc:mga07m45_410_c1 | nmdc:mga07m45_410_c1_6771_7418 | 215 |
| 685 | 3300050496 | nmdc:mga07m45_53099_c1 | nmdc:mga07m45_53099_c1_463_1110 | 215 |
| 686 | 3300050507 | nmdc:mga05p37_213124_c1 | nmdc:mga05p37_213124_c1_1194_1847 | 215 |
| 687 | 3300050508 | nmdc:mga09592_8800_c1 | nmdc:mga09592_8800_c1_2585_3232 | 215 |
| 688 | 3300050509 | nmdc:mga0qj67_46651_c1 | nmdc:mga0qj67_46651_c1_2417_3064 | 215 |
| 689 | 3300050511 | nmdc:mga08y16_439247_c1 | nmdc:mga08y16_439247_c1_164_811 | 215 |
| 690 | 3300050516 | nmdc:mga0sz30_28770_c1 | nmdc:mga0sz30_28770_c1_1629_2276 | 215 |
| 691 | 3300050516 | nmdc:mga0sz30_83374_c1 | nmdc:mga0sz30_83374_c1_334_981 | 215 |
| 692 | 3300053084 | Ga0495595_0142503 | Ga0495595_0142503_85_744 | 215 |
| 693 | 3300053085 | Ga0495619_0351664 | Ga0495619_0351664_271_918 | 215 |
| 694 | 3300053093 | Ga0500651_0012618 | Ga0500651_0012618_3387_4034 | 215 |
| 695 | 3300053098 | Ga0500650_0017430 | Ga0500650_0017430_2059_2706 | 215 |
| 696 | 3300053098 | Ga0500650_0064020 | Ga0500650_0064020_417_1064 | 215 |
| 697 | 3300053109 | Ga0500569_005309 | Ga0500569_005309_213_860 | 215 |
| 698 | 3300053121 | Ga0500607_145452 | Ga0500607_145452_141_788 | 215 |
| 699 | 3300053129 | Ga0500628_002165 | Ga0500628_002165_975_1622 | 215 |
| 700 | 3300053130 | Ga0500642_0041636 | Ga0500642_0041636_721_1368 | 215 |
| 701 | 3300053130 | Ga0500642_0119995 | Ga0500642_0119995_167_814 | 215 |
| 702 | 3300053131 | Ga0500652_008946 | Ga0500652_008946_588_1235 | 215 |
| 703 | 3300053142 | Ga0500577_0198743 | Ga0500577_0198743_71_718 | 215 |
| 704 | 3300053148 | Ga0500590_047089 | Ga0500590_047089_277_924 | 215 |
| 705 | 3300053156 | Ga0500622_0005574 | Ga0500622_0005574_2124_2771 | 215 |
| 706 | 3300053177 | Ga0500636_0072809 | Ga0500636_0072809_146_793 | 215 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1dl3-assembly1.cif.gz_A | crystal structure of mutually generated monomers of dimeric phosphoribosylantranilate isomerase from thermotoga maritima | 0.9345 | 5 | 204 |
| 1lbm-assembly1.cif.gz_A | crystal structure of phosphoribosyl anthranilate isomerase (prai) in complex with reduced 1-(o-carboxyphenylamino)-1-deoxyribulose 5-phosphate (rcdrp) | 0.9315 | 5 | 205 |
| 1dl3-assembly2.cif.gz_B | crystal structure of mutually generated monomers of dimeric phosphoribosylantranilate isomerase from thermotoga maritima | 0.9263 | 5 | 205 |
| 1nsj-assembly1.cif.gz_A-2 | crystal structure of phosphoribosyl anthranilate isomerase from thermotoga maritima | 0.9256 | 5 | 205 |
| 1lbm-assembly1.cif.gz_A | crystal structure of phosphoribosyl anthranilate isomerase (prai) in complex with reduced 1-(o-carboxyphenylamino)-1-deoxyribulose 5-phosphate (rcdrp) | 0.9176 | 5 | 205 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1dl3A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9345 | 5 | 204 | 3.20.20.70 |
| 1dl3A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9157 | 5 | 204 | 3.20.20.70 |
| af_Q2FYR5_1_206_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.8886 | 5 | 204 | 3.20.20.70 |
| 1v5xB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.8821 | 5 | 205 | 3.20.20.70 |
| af_P00909_260_447_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.8811 | 10 | 199 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3C0K872-F1-model_v4 | N-(5'-phosphoribosyl)anthranilate isomerase (EC 5.3.1.24) | 0.9972 | 4 | 103 |
GO:0000162
GO:0004640 GO:0006568 |
| AF-A0A7Y6NLA1-F1-model_v4 | N-(5'-phosphoribosyl)anthranilate isomerase (PRAI) (EC 5.3.1.24) | 0.993 | 1 | 212 |
GO:0000162
GO:0004640 GO:0006568 |
| AF-A0A0K8P1R1-F1-model_v4 | N-(5'-phosphoribosyl)anthranilate isomerase (PRAI) (EC 5.3.1.24) | 0.9879 | 3 | 215 |
GO:0000162
GO:0004640 GO:0006568 |
| AF-A0A521YU25-F1-model_v4 | N-(5'-phosphoribosyl)anthranilate isomerase (EC 5.3.1.24) | 0.9859 | 4 | 143 |
GO:0000162
GO:0004640 GO:0006568 |
| AF-A0A431MMR7-F1-model_v4 | N-(5'-phosphoribosyl)anthranilate isomerase (PRAI) (EC 5.3.1.24) | 0.983 | 1 | 207 |
GO:0000162
GO:0004640 GO:0006568 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar