F476481

General Info

Members Datasets Scaffolds Average Seq Length
706 307 703 215

Family's Representative Sequence

Representative Sequence 3300031239|Ga0265328_10059482|Ga0265328_100594822
Length 235
Sequence MRSGRFQPRFRPTTGCREKPLTHRTRIKICGLTRAEDVAAAVDAGADAIGFVFYDKSPRHIAPERAAELARKLPPFVVPVGLFVNAGAVEIARAVALIPNLLLQFHGDETPAQCRSAGRPYLRAVRMAPGFDLLDFARSYADAQGLLLDAFVEGYGGGGKVFDWSLVPRGVALPLVLSGGLNAANVAAGIVQVRPWAVDVSSGVESAKGIKDALAIRRFCDAVREADARIAACQT

Samples

Sample ID Description Type Environment
1 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
2 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
3 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
9 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
10 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
66 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
67 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
111 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
112 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
115 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
175 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
178 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
179 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
180 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
181 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
182 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
183 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
184 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
185 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
186 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
187 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
188 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
189 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
190 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
191 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
192 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
193 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
194 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
195 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
196 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
197 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
198 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
199 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
200 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
201 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
202 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
203 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
204 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
205 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
206 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
207 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
208 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
209 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
210 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
211 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
212 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
213 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
214 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
215 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
216 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
217 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
218 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
219 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
220 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
221 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
222 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
223 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
224 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
225 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
226 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
227 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
228 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
229 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
230 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
231 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
232 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
233 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
234 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
235 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
236 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
237 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
238 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
239 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
240 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
241 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
242 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
243 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
244 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
245 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
246 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
247 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
248 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
249 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
250 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
251 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
252 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
253 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
254 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
255 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
256 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
257 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
258 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
259 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
260 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
261 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
262 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
263 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
264 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
265 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
266 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
267 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
268 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
269 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
270 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
271 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
272 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
273 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
274 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
275 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
276 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
277 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
278 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
279 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
280 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
281 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
282 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
283 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
284 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
285 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
286 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
287 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
288 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
289 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
290 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
291 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
292 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
293 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
294 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
295 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
296 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
297 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
298 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
299 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
300 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
301 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
302 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
303 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
304 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
305 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
306 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
307 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.58
Metatranscriptomes 0
Isolates 0.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.31
Nodule 0.28
Rhizoplane 4.25
Rhizosphere 77.62
Stem 0
Stem Tuber 0
Unclassified 4.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25150J39212_1013974 3300002774 Bacteria 1375
2 JGI25153J46596_10005823 3300003215 Bacteria 6405
3 JGI25153J46596_10005931 3300003215 Bacteria 6301
4 JGI25153J46596_10010740 3300003215 Bacteria 4112
5 rootH1_10048080 3300003316 Bacteria 1793
6 Ga0055526_1018996 3300003771 Bacteria 2528
7 Ga0055524_1000079 3300003775 Bacteria 120203
8 Ga0055540_1000004 3300003792 Bacteria 395545
9 Ga0055531_10008300 3300003794 Bacteria 5508
10 Ga0065165_1046569 3300005262 Bacteria 1257
11 Ga0065707_10092687 3300005295 Bacteria 3734
12 Ga0070658_10070761 3300005327 Bacteria 2857
13 Ga0070658_10103249 3300005327 Bacteria 2358
14 Ga0070658_10250839 3300005327 Bacteria 1501
15 Ga0070676_10003580 3300005328 Bacteria 8119
16 Ga0070676_10036707 3300005328 Bacteria 2824
17 Ga0070690_100013302 3300005330 Bacteria 4861
18 Ga0070670_100004564 3300005331 Bacteria 11615
19 Ga0070670_100047389 3300005331 Bacteria 3698
20 Ga0070670_100104394 3300005331 Bacteria 2441
21 Ga0070670_100653351 3300005331 Bacteria 943
22 Ga0070677_10013875 3300005333 Bacteria 2828
23 Ga0070677_10017543 3300005333 Bacteria 2564
24 Ga0070677_10034440 3300005333 Bacteria 1956
25 Ga0070677_10064275 3300005333 Bacteria 1523
26 Ga0068869_100000287 3300005334 Bacteria 26922
27 Ga0068869_100007333 3300005334 Bacteria 7036
28 Ga0068869_100144210 3300005334 Bacteria 1842
29 Ga0070666_10038958 3300005335 Bacteria 3165
30 Ga0070666_10051094 3300005335 Bacteria 2782
31 Ga0070666_10096529 3300005335 Bacteria 2034
32 Ga0070666_10225758 3300005335 Bacteria 1322
33 Ga0070666_10524669 3300005335 Bacteria 860
34 Ga0070680_100029873 3300005336 Bacteria 4376
35 Ga0068868_100035131 3300005338 Bacteria 3873
36 Ga0068868_100043620 3300005338 Bacteria 3504
37 Ga0068868_100050267 3300005338 Bacteria 3273
38 Ga0068868_100199950 3300005338 Bacteria 1665
39 Ga0068868_100254955 3300005338 Bacteria 1477
40 Ga0068868_100605073 3300005338 Bacteria 971
41 Ga0070660_100075701 3300005339 Bacteria 2635
42 Ga0070660_100287217 3300005339 Bacteria 1347
43 Ga0070660_100339685 3300005339 Bacteria 1236
44 Ga0070687_100304885 3300005343 Bacteria 1012
45 Ga0070661_100001326 3300005344 Bacteria 17338
46 Ga0070661_100096521 3300005344 Bacteria 2194
47 Ga0070661_100551070 3300005344 Bacteria 928
48 Ga0070661_100590459 3300005344 Bacteria 897
49 Ga0070668_100006437 3300005347 Bacteria 8708
50 Ga0070668_100031606 3300005347 Bacteria 4028
51 Ga0070669_100008796 3300005353 Bacteria 7203
52 Ga0070669_100100348 3300005353 Bacteria 2183
53 Ga0070675_100000322 3300005354 Bacteria 32261
54 Ga0070675_100011400 3300005354 Bacteria 6958
55 Ga0070675_100025355 3300005354 Bacteria 4754
56 Ga0070675_100027488 3300005354 Bacteria 4571
57 Ga0070675_100047502 3300005354 Bacteria 3517
58 Ga0070675_100224039 3300005354 Bacteria 1638
59 Ga0070671_100014031 3300005355 Bacteria 6469
60 Ga0070671_100041904 3300005355 Bacteria 3805
61 Ga0070671_100062646 3300005355 Bacteria 3096
62 Ga0070671_100157386 3300005355 Bacteria 1920
63 Ga0070671_100482188 3300005355 Bacteria 1066
64 Ga0070674_100010469 3300005356 Bacteria 5609
65 Ga0070674_100167871 3300005356 Bacteria 1671
66 Ga0070674_100259095 3300005356 Bacteria 1369
67 Ga0070674_100271028 3300005356 Bacteria 1341
68 Ga0070673_100002962 3300005364 Bacteria 10471
69 Ga0070673_100132159 3300005364 Bacteria 2096
70 Ga0070673_100265472 3300005364 Bacteria 1501
71 Ga0070673_100290539 3300005364 Bacteria 1436
72 Ga0070673_100394347 3300005364 Bacteria 1236
73 Ga0070673_100687772 3300005364 Bacteria 938
74 Ga0070659_100000336 3300005366 Bacteria 36297
75 Ga0070667_100004438 3300005367 Bacteria 11832
76 Ga0070667_100009358 3300005367 Bacteria 8122
77 Ga0070667_100012223 3300005367 Bacteria 7101
78 Ga0070667_100029416 3300005367 Bacteria 4576
79 Ga0070667_100155900 3300005367 Bacteria 2009
80 Ga0070667_100175866 3300005367 Bacteria 1892
81 Ga0070667_100218257 3300005367 Bacteria 1697
82 Ga0070667_100230754 3300005367 Bacteria 1650
83 Ga0070667_100277639 3300005367 Bacteria 1504
84 Ga0070667_100321752 3300005367 Bacteria 1396
85 Ga0070701_10300297 3300005438 Bacteria 987
86 Ga0070700_100004808 3300005441 Bacteria 7085
87 Ga0070700_100172198 3300005441 Bacteria 1500
88 Ga0070663_100008422 3300005455 Bacteria 6343
89 Ga0070663_100059976 3300005455 Bacteria 2735
90 Ga0070663_100273119 3300005455 Bacteria 1345
91 Ga0070663_100539211 3300005455 Bacteria 974
92 Ga0070678_100027686 3300005456 Bacteria 3852
93 Ga0070678_100045697 3300005456 Bacteria 3135
94 Ga0070678_100076567 3300005456 Bacteria 2520
95 Ga0070678_100205439 3300005456 Bacteria 1628
96 Ga0070678_100222524 3300005456 Bacteria 1569
97 Ga0070678_100354784 3300005456 Bacteria 1262
98 Ga0070678_100460996 3300005456 Bacteria 1115
99 Ga0070678_100482982 3300005456 Bacteria 1090
100 Ga0070678_100743552 3300005456 Bacteria 887
101 Ga0070662_100038169 3300005457 Bacteria 3410
102 Ga0070662_100057681 3300005457 Bacteria 2822
103 Ga0070681_10314729 3300005458 Bacteria 1475
104 Ga0068867_100002034 3300005459 Bacteria 14144
105 Ga0068867_100101659 3300005459 Bacteria 2196
106 Ga0068867_100141393 3300005459 Bacteria 1882
107 Ga0068867_100193719 3300005459 Bacteria 1623
108 Ga0068867_100256975 3300005459 Bacteria 1423
109 Ga0068867_100559883 3300005459 Bacteria 991
110 Ga0070685_10074581 3300005466 Bacteria 2019
111 Ga0070685_10415401 3300005466 Bacteria 935
112 Ga0070706_100001359 3300005467 Bacteria 26010
113 Ga0070707_100097547 3300005468 Bacteria 2847
114 Ga0070679_100012199 3300005530 Bacteria 8209
115 Ga0070684_100160632 3300005535 Bacteria 2038
116 Ga0068853_100524126 3300005539 Bacteria 1120
117 Ga0068853_100604623 3300005539 Bacteria 1041
118 Ga0070672_100008994 3300005543 Bacteria 6865
119 Ga0070672_100015361 3300005543 Bacteria 5450
120 Ga0070672_100216745 3300005543 Bacteria 1604
121 Ga0070672_100238256 3300005543 Bacteria 1530
122 Ga0070672_100518423 3300005543 Bacteria 1032
123 Ga0070672_100538176 3300005543 Bacteria 1013
124 Ga0070672_100862763 3300005543 Unclassified 798
125 Ga0070696_100671760 3300005546 Bacteria 842
126 Ga0070665_100488282 3300005548 Bacteria 1243
127 Ga0068855_100404923 3300005563 Bacteria 1495
128 Ga0068855_100468355 3300005563 Bacteria 1373
129 Ga0070664_100017678 3300005564 Bacteria 5855
130 Ga0070664_100250050 3300005564 Bacteria 1593
131 Ga0070664_100574723 3300005564 Bacteria 1044
132 Ga0068857_100133634 3300005577 Bacteria 2239
133 Ga0068857_100306491 3300005577 Bacteria 1465
134 Ga0068857_101079164 3300005577 Bacteria 775
135 Ga0068854_100037572 3300005578 Bacteria 3400
136 Ga0068854_100059484 3300005578 Bacteria 2761
137 Ga0068854_100072892 3300005578 Bacteria 2515
138 Ga0068854_100553840 3300005578 Bacteria 976
139 Ga0070702_100122951 3300005615 Bacteria 1627
140 Ga0068852_100011794 3300005616 Bacteria 6600
141 Ga0068852_100092739 3300005616 Bacteria 2705
142 Ga0068852_100498015 3300005616 Bacteria 1213
143 Ga0068859_100008152 3300005617 Bacteria 10625
144 Ga0068859_100023977 3300005617 Bacteria 6124
145 Ga0068859_100057687 3300005617 Bacteria 3911
146 Ga0068859_100180990 3300005617 Bacteria 2191
147 Ga0068864_100006810 3300005618 Bacteria 9362
148 Ga0068864_100006813 3300005618 Bacteria 9361
149 Ga0068864_100052350 3300005618 Bacteria 3518
150 Ga0068864_100068692 3300005618 Bacteria 3079
151 Ga0068864_100170056 3300005618 Bacteria 1987
152 Ga0068864_100213981 3300005618 Bacteria 1776
153 Ga0068864_101049522 3300005618 Bacteria 810
154 Ga0068866_10115104 3300005718 Bacteria 1507
155 Ga0068861_100001256 3300005719 Bacteria 15820
156 Ga0068861_100033391 3300005719 Bacteria 3795
157 Ga0068861_100417916 3300005719 Bacteria 1194
158 Ga0068851_10031438 3300005834 Bacteria 2637
159 Ga0068851_10073763 3300005834 Bacteria 1770
160 Ga0068851_10075709 3300005834 Bacteria 1749
161 Ga0068851_10080770 3300005834 Bacteria 1697
162 Ga0068863_100008722 3300005841 Bacteria 9907
163 Ga0068863_100021758 3300005841 Bacteria 6118
164 Ga0068863_100038295 3300005841 Bacteria 4562
165 Ga0068863_100156834 3300005841 Bacteria 2179
166 Ga0068863_100224273 3300005841 Bacteria 1811
167 Ga0068858_100004522 3300005842 Bacteria 13638
168 Ga0068858_100021085 3300005842 Bacteria 6086
169 Ga0068858_100051898 3300005842 Bacteria 3794
170 Ga0068858_100167873 3300005842 Bacteria 2068
171 Ga0068860_100000989 3300005843 Bacteria 31420
172 Ga0068860_100005562 3300005843 Bacteria 12742
173 Ga0068860_100082121 3300005843 Bacteria 3065
174 Ga0068860_100085907 3300005843 Bacteria 2994
175 Ga0068860_100222431 3300005843 Bacteria 1833
176 Ga0068862_100078880 3300005844 Bacteria 2853
177 Ga0068862_100079156 3300005844 Bacteria 2849
178 Ga0068862_100171192 3300005844 Bacteria 1944
179 Ga0068862_100235457 3300005844 Bacteria 1663
180 Ga0070717_10722906 3300006028 Bacteria 905
181 Ga0075365_10024481 3300006038 Bacteria 3809
182 Ga0075365_10572908 3300006038 Bacteria 798
183 Ga0075368_10001139 3300006042 Bacteria 8381
184 Ga0075363_100000866 3300006048 Bacteria 10603
185 Ga0075363_100088685 3300006048 Bacteria 1700
186 Ga0075363_100206767 3300006048 Bacteria 1123
187 Ga0075363_100330071 3300006048 Bacteria 888
188 Ga0075364_10021082 3300006051 Bacteria 4105
189 Ga0075364_10060464 3300006051 Bacteria 2484
190 Ga0075362_10008657 3300006177 Bacteria 3906
191 Ga0075362_10064522 3300006177 Bacteria 1662
192 Ga0075362_10152163 3300006177 Bacteria 1110
193 Ga0075367_10013893 3300006178 Bacteria 4344
194 Ga0075367_10037441 3300006178 Bacteria 2819
195 Ga0075367_10039167 3300006178 Bacteria 2763
196 Ga0075369_10058088 3300006186 Bacteria 1684
197 Ga0075366_10000694 3300006195 Bacteria 15919
198 Ga0075366_10009550 3300006195 Bacteria 5418
199 Ga0075366_10033502 3300006195 Bacteria 3026
200 Ga0075366_10094778 3300006195 Bacteria 1789
201 Ga0075366_10167834 3300006195 Bacteria 1331
202 Ga0097621_100054327 3300006237 Bacteria 3266
203 Ga0097621_100145211 3300006237 Bacteria 2030
204 Ga0097621_100177209 3300006237 Bacteria 1840
205 Ga0097621_100379196 3300006237 Bacteria 1263
206 Ga0075370_10000326 3300006353 Bacteria 17238
207 Ga0075370_10000436 3300006353 Bacteria 15538
208 Ga0075370_10009246 3300006353 Bacteria 5108
209 Ga0075370_10011217 3300006353 Bacteria 4703
210 Ga0075370_10030032 3300006353 Bacteria 3031
211 Ga0075370_10235062 3300006353 Bacteria 1085
212 Ga0068871_100041817 3300006358 Bacteria 3677
213 Ga0068871_100769640 3300006358 Bacteria 886
214 Ga0075430_100072946 3300006846 Bacteria 2879
215 Ga0075429_100005458 3300006880 Bacteria 10949
216 Ga0068865_100013136 3300006881 Bacteria 5225
217 Ga0068865_100044231 3300006881 Bacteria 3047
218 Ga0068865_100259393 3300006881 Bacteria 1375
219 Ga0097620_100008153 3300006931 Bacteria 10625
220 Ga0097620_100023977 3300006931 Bacteria 6124
221 Ga0097620_100057688 3300006931 Bacteria 3911
222 Ga0097620_100180988 3300006931 Bacteria 2191
223 Ga0079104_1000352 3300006946 Bacteria 55479
224 Ga0105240_10123389 3300009093 Bacteria 3117
225 Ga0105240_10459432 3300009093 Bacteria 1423
226 Ga0105245_10012538 3300009098 Bacteria 7376
227 Ga0105245_10133816 3300009098 Bacteria 2328
228 Ga0105245_10342330 3300009098 Bacteria 1479
229 Ga0105247_10110819 3300009101 Bacteria 1766
230 Ga0114129_10252574 3300009147 Bacteria 2366
231 Ga0105243_10244094 3300009148 Bacteria 1600
232 Ga0105241_10092023 3300009174 Bacteria 2394
233 Ga0105242_10096246 3300009176 Bacteria 2500
234 Ga0105242_10123243 3300009176 Bacteria 2228
235 Ga0105242_10255866 3300009176 Bacteria 1580
236 Ga0105242_10575875 3300009176 Bacteria 1083
237 Ga0105248_10005678 3300009177 Bacteria 13707
238 Ga0105248_10037339 3300009177 Bacteria 5435
239 Ga0105248_10164097 3300009177 Bacteria 2505
240 Ga0105248_10546135 3300009177 Bacteria 1307
241 Ga0105237_10053047 3300009545 Bacteria 4068
242 Ga0105237_10186555 3300009545 Bacteria 2074
243 Ga0105237_10503317 3300009545 Bacteria 1218
244 Ga0105238_10197500 3300009551 Bacteria 1987
245 Ga0105249_10059678 3300009553 Bacteria 3499
246 Ga0105249_11000370 3300009553 Bacteria 905
247 Ga0105239_10094657 3300010375 Bacteria 3299
248 Ga0105239_10098645 3300010375 Bacteria 3230
249 Ga0105246_10516056 3300011119 Bacteria 1018
250 Ga0105246_10708553 3300011119 Bacteria 883
251 Ga0157373_10004841 3300013100 Bacteria 10129
252 Ga0157371_10204596 3300013102 Bacteria 1416
253 Ga0157370_10230937 3300013104 Bacteria 1712
254 Ga0157369_10064757 3300013105 Bacteria 3936
255 Ga0157369_10229909 3300013105 Bacteria 1939
256 Ga0157374_10132987 3300013296 Bacteria 2409
257 Ga0157374_10178734 3300013296 Bacteria 2072
258 Ga0157374_10442001 3300013296 Bacteria 1301
259 Ga0157374_10633625 3300013296 Bacteria 1080
260 Ga0157374_10656350 3300013296 Bacteria 1061
261 Ga0157378_10127038 3300013297 Bacteria 2356
262 Ga0157378_10236886 3300013297 Bacteria 1742
263 Ga0157378_10359092 3300013297 Bacteria 1425
264 Ga0163162_10002520 3300013306 Bacteria 17318
265 Ga0163162_10038029 3300013306 Bacteria 4803
266 Ga0163162_10107216 3300013306 Bacteria 2889
267 Ga0163162_10310114 3300013306 Bacteria 1710
268 Ga0157372_10268809 3300013307 Bacteria 1981
269 Ga0157375_10003007 3300013308 Bacteria 14639
270 Ga0157375_10003841 3300013308 Bacteria 13033
271 Ga0157375_10094724 3300013308 Bacteria 3055
272 Ga0157375_10153375 3300013308 Bacteria 2441
273 Ga0157375_10231241 3300013308 Bacteria 2008
274 Ga0157375_10643527 3300013308 Bacteria 1217
275 Ga0157375_11232497 3300013308 Unclassified 878
276 Ga0163163_10023012 3300014325 Bacteria 5908
277 Ga0163163_10378722 3300014325 Bacteria 1473
278 Ga0163163_10927844 3300014325 Bacteria 934
279 Ga0157380_10001456 3300014326 Bacteria 15479
280 Ga0157380_10015049 3300014326 Bacteria 5676
281 Ga0157380_10050553 3300014326 Bacteria 3284
282 Ga0157380_10104898 3300014326 Bacteria 2362
283 Ga0157377_10017784 3300014745 Bacteria 3685
284 Ga0157377_10337711 3300014745 Bacteria 1006
285 Ga0157377_10540347 3300014745 Bacteria 821
286 Ga0157379_10007711 3300014968 Bacteria 9320
287 Ga0157379_10046568 3300014968 Bacteria 3868
288 Ga0157379_10090299 3300014968 Bacteria 2748
289 Ga0157379_10091557 3300014968 Bacteria 2728
290 Ga0157379_10101466 3300014968 Bacteria 2583
291 Ga0157379_10114831 3300014968 Bacteria 2420
292 Ga0157379_10250806 3300014968 Bacteria 1607
293 Ga0157379_10707495 3300014968 Bacteria 946
294 Ga0157379_10831783 3300014968 Bacteria 873
295 Ga0157376_10057077 3300014969 Bacteria 3264
296 Ga0157376_10088944 3300014969 Bacteria 2669
297 Ga0157376_10641687 3300014969 Bacteria 1061
298 Ga0182007_10060635 3300015262 Bacteria 1240
299 Ga0163161_10010581 3300017792 Bacteria 6387
300 Ga0163161_10043893 3300017792 Bacteria 3219
301 Ga0163161_10180512 3300017792 Bacteria 1618
302 Ga0163161_10202527 3300017792 Bacteria 1530
303 Ga0207425_1001224 3300025245 Bacteria 11279
304 Ga0209129_1000041 3300025258 Bacteria 307590
305 Ga0209673_1021882 3300025273 Bacteria 2223
306 Ga0209564_1000029 3300025295 Bacteria 505995
307 Ga0209758_1000043 3300025297 Bacteria 402310
308 Ga0209758_1000057 3300025297 Bacteria 333111
309 Ga0209050_1003660 3300025298 Bacteria 11105
310 Ga0209256_1000011 3300025299 Bacteria 865309
311 Ga0209051_1000016 3300025303 Bacteria 541891
312 Ga0209257_1000102 3300025304 Bacteria 251074
313 Ga0207697_10033989 3300025315 Bacteria 2087
314 Ga0207656_10046886 3300025321 Bacteria 1856
315 Ga0207682_10008765 3300025893 Bacteria 4001
316 Ga0207682_10015590 3300025893 Bacteria 2959
317 Ga0207682_10016142 3300025893 Bacteria 2910
318 Ga0207682_10031014 3300025893 Bacteria 2144
319 Ga0207642_10004119 3300025899 Bacteria 4663
320 Ga0207642_10090705 3300025899 Bacteria 1509
321 Ga0207688_10094685 3300025901 Bacteria 1718
322 Ga0207688_10340443 3300025901 Bacteria 923
323 Ga0207680_10031915 3300025903 Bacteria 2988
324 Ga0207680_10047700 3300025903 Bacteria 2540
325 Ga0207645_10006800 3300025907 Bacteria 8163
326 Ga0207645_10043145 3300025907 Bacteria 2886
327 Ga0207645_10100275 3300025907 Bacteria 1868
328 Ga0207645_10269379 3300025907 Bacteria 1129
329 Ga0207643_10138303 3300025908 Bacteria 1453
330 Ga0207643_10159122 3300025908 Bacteria 1358
331 Ga0207705_10412832 3300025909 Bacteria 1045
332 Ga0207654_10048113 3300025911 Bacteria 2439
333 Ga0207695_10074259 3300025913 Bacteria 3462
334 Ga0207695_10290834 3300025913 Bacteria 1526
335 Ga0207671_10015949 3300025914 Bacteria 5858
336 Ga0207671_10072300 3300025914 Bacteria 2574
337 Ga0207671_10145005 3300025914 Bacteria 1831
338 Ga0207660_10108625 3300025917 Bacteria 2084
339 Ga0207662_10086628 3300025918 Bacteria 1920
340 Ga0207657_10095410 3300025919 Bacteria 2475
341 Ga0207649_10011600 3300025920 Bacteria 4864
342 Ga0207649_10094310 3300025920 Bacteria 1966
343 Ga0207649_10600990 3300025920 Bacteria 846
344 Ga0207652_10006543 3300025921 Bacteria 9389
345 Ga0207646_10084736 3300025922 Bacteria 2836
346 Ga0207681_10000205 3300025923 Bacteria 47034
347 Ga0207681_10083208 3300025923 Bacteria 2264
348 Ga0207681_10184498 3300025923 Bacteria 1592
349 Ga0207681_10444798 3300025923 Bacteria 1053
350 Ga0207694_10038195 3300025924 Bacteria 3691
351 Ga0207694_10220461 3300025924 Bacteria 1547
352 Ga0207650_10002265 3300025925 Bacteria 13428
353 Ga0207650_10002632 3300025925 Bacteria 12423
354 Ga0207650_10049976 3300025925 Bacteria 3090
355 Ga0207659_10000640 3300025926 Bacteria 20764
356 Ga0207659_10005482 3300025926 Bacteria 7696
357 Ga0207659_10029748 3300025926 Bacteria 3726
358 Ga0207659_10055002 3300025926 Bacteria 2844
359 Ga0207659_10077319 3300025926 Bacteria 2449
360 Ga0207659_10218711 3300025926 Bacteria 1530
361 Ga0207687_10062639 3300025927 Bacteria 2631
362 Ga0207687_10076478 3300025927 Bacteria 2405
363 Ga0207687_10105424 3300025927 Bacteria 2083
364 Ga0207644_10004364 3300025931 Bacteria 9173
365 Ga0207644_10115431 3300025931 Bacteria 2036
366 Ga0207644_10116173 3300025931 Bacteria 2030
367 Ga0207644_10148244 3300025931 Bacteria 1813
368 Ga0207644_10374540 3300025931 Bacteria 1160
369 Ga0207644_10868920 3300025931 Unclassified 755
370 Ga0207690_10013283 3300025932 Bacteria 4946
371 Ga0207690_10137966 3300025932 Bacteria 1793
372 Ga0207690_10422398 3300025932 Bacteria 1067
373 Ga0207706_10020517 3300025933 Bacteria 5940
374 Ga0207706_10134453 3300025933 Bacteria 2175
375 Ga0207706_10211252 3300025933 Bacteria 1701
376 Ga0207686_10166644 3300025934 Bacteria 1550
377 Ga0207709_10426815 3300025935 Bacteria 1019
378 Ga0207670_10016862 3300025936 Bacteria 4402
379 Ga0207670_10192515 3300025936 Bacteria 1544
380 Ga0207669_10025734 3300025937 Bacteria 3186
381 Ga0207669_10128822 3300025937 Bacteria 1734
382 Ga0207669_10153035 3300025937 Bacteria 1618
383 Ga0207704_10014643 3300025938 Bacteria 3967
384 Ga0207704_10040771 3300025938 Bacteria 2717
385 Ga0207704_10222617 3300025938 Bacteria 1397
386 Ga0207704_10374449 3300025938 Bacteria 1116
387 Ga0207691_10005244 3300025940 Bacteria 12509
388 Ga0207691_10013352 3300025940 Bacteria 7866
389 Ga0207691_10031282 3300025940 Bacteria 4968
390 Ga0207691_10033674 3300025940 Bacteria 4771
391 Ga0207691_10049278 3300025940 Bacteria 3858
392 Ga0207691_10125365 3300025940 Bacteria 2273
393 Ga0207691_10347673 3300025940 Bacteria 1269
394 Ga0207691_10429243 3300025940 Bacteria 1126
395 Ga0207691_10577625 3300025940 Bacteria 952
396 Ga0207711_10003076 3300025941 Bacteria 14559
397 Ga0207711_10004990 3300025941 Bacteria 11255
398 Ga0207711_10006526 3300025941 Bacteria 9821
399 Ga0207711_10044179 3300025941 Bacteria 3803
400 Ga0207711_10098658 3300025941 Bacteria 2581
401 Ga0207711_10373411 3300025941 Bacteria 1323
402 Ga0207711_10423257 3300025941 Bacteria 1239
403 Ga0207689_10000612 3300025942 Bacteria 34213
404 Ga0207689_10007315 3300025942 Bacteria 9689
405 Ga0207689_10036567 3300025942 Bacteria 4075
406 Ga0207689_10282697 3300025942 Bacteria 1374
407 Ga0207661_10028032 3300025944 Bacteria 4309
408 Ga0207679_10000526 3300025945 Bacteria 25924
409 Ga0207679_10073308 3300025945 Bacteria 2590
410 Ga0207679_10133413 3300025945 Bacteria 1996
411 Ga0207679_10311431 3300025945 Bacteria 1360
412 Ga0207667_10505813 3300025949 Bacteria 1225
413 Ga0207651_10004882 3300025960 Bacteria 6836
414 Ga0207651_10062308 3300025960 Bacteria 2598
415 Ga0207651_10178703 3300025960 Bacteria 1681
416 Ga0207651_10377525 3300025960 Bacteria 1200
417 Ga0207651_10492238 3300025960 Bacteria 1058
418 Ga0207712_10021116 3300025961 Bacteria 4271
419 Ga0207712_10172443 3300025961 Bacteria 1692
420 Ga0207668_10006845 3300025972 Bacteria 6760
421 Ga0207640_10055213 3300025981 Bacteria 2601
422 Ga0207640_10145212 3300025981 Bacteria 1735
423 Ga0207658_10001252 3300025986 Bacteria 20100
424 Ga0207658_10005498 3300025986 Bacteria 8687
425 Ga0207658_10068012 3300025986 Bacteria 2686
426 Ga0207658_10131396 3300025986 Bacteria 2012
427 Ga0207658_10188708 3300025986 Bacteria 1711
428 Ga0207658_10191045 3300025986 Bacteria 1702
429 Ga0207658_10199074 3300025986 Bacteria 1671
430 Ga0207677_10001106 3300026023 Bacteria 14727
431 Ga0207677_10003691 3300026023 Bacteria 8119
432 Ga0207677_10029892 3300026023 Bacteria 3470
433 Ga0207677_10113150 3300026023 Bacteria 2025
434 Ga0207677_10155303 3300026023 Bacteria 1771
435 Ga0207703_10007447 3300026035 Bacteria 8694
436 Ga0207703_10015583 3300026035 Bacteria 5929
437 Ga0207703_10031846 3300026035 Bacteria 4172
438 Ga0207703_10035385 3300026035 Bacteria 3968
439 Ga0207703_10054951 3300026035 Bacteria 3239
440 Ga0207639_10218941 3300026041 Bacteria 1643
441 Ga0207639_10229905 3300026041 Bacteria 1607
442 Ga0207678_10069611 3300026067 Bacteria 3017
443 Ga0207678_10335539 3300026067 Bacteria 1302
444 Ga0207678_10808897 3300026067 Bacteria 828
445 Ga0207708_10021642 3300026075 Bacteria 4850
446 Ga0207708_10726361 3300026075 Bacteria 851
447 Ga0207702_10042415 3300026078 Bacteria 3816
448 Ga0207702_10577782 3300026078 Bacteria 1101
449 Ga0207641_10004081 3300026088 Bacteria 12733
450 Ga0207641_10010585 3300026088 Bacteria 7567
451 Ga0207641_10121844 3300026088 Bacteria 2328
452 Ga0207641_10133817 3300026088 Bacteria 2229
453 Ga0207641_10232078 3300026088 Bacteria 1715
454 Ga0207648_10000310 3300026089 Bacteria 53471
455 Ga0207648_10017210 3300026089 Bacteria 6588
456 Ga0207648_10114922 3300026089 Bacteria 2365
457 Ga0207648_10226719 3300026089 Bacteria 1661
458 Ga0207648_10337228 3300026089 Bacteria 1357
459 Ga0207676_10002699 3300026095 Bacteria 12624
460 Ga0207676_10018266 3300026095 Bacteria 5096
461 Ga0207676_10029671 3300026095 Bacteria 4097
462 Ga0207676_10066501 3300026095 Bacteria 2875
463 Ga0207676_10476556 3300026095 Bacteria 1181
464 Ga0207676_10638197 3300026095 Bacteria 1026
465 Ga0207674_10060222 3300026116 Bacteria 3840
466 Ga0207674_10293199 3300026116 Bacteria 1575
467 Ga0207675_100002511 3300026118 Bacteria 18156
468 Ga0207675_100012910 3300026118 Bacteria 7801
469 Ga0207675_100018129 3300026118 Bacteria 6564
470 Ga0207675_100079277 3300026118 Bacteria 3077
471 Ga0207675_100190784 3300026118 Bacteria 1965
472 Ga0207675_100212811 3300026118 Bacteria 1860
473 Ga0207683_10028632 3300026121 Bacteria 4819
474 Ga0207683_10037011 3300026121 Bacteria 4250
475 Ga0207683_10066783 3300026121 Bacteria 3172
476 Ga0207683_10083050 3300026121 Bacteria 2847
477 Ga0207683_10102365 3300026121 Bacteria 2557
478 Ga0207683_10262310 3300026121 Bacteria 1578
479 Ga0207683_10285400 3300026121 Bacteria 1509
480 Ga0207683_10349818 3300026121 Bacteria 1356
481 Ga0207698_10014722 3300026142 Bacteria 5210
482 Ga0207698_10095019 3300026142 Bacteria 2453
483 Ga0207698_10164835 3300026142 Bacteria 1943
484 Ga0207698_10380232 3300026142 Bacteria 1343
485 Ga0207698_10446677 3300026142 Bacteria 1247
486 Ga0209281_1000454 3300027111 Bacteria 58234
487 Ga0268265_10035164 3300028380 Bacteria 3658
488 Ga0268265_10062352 3300028380 Bacteria 2864
489 Ga0268265_10095674 3300028380 Bacteria 2385
490 Ga0268265_10428105 3300028380 Bacteria 1230
491 Ga0268264_10001585 3300028381 Bacteria 21062
492 Ga0268264_10004874 3300028381 Bacteria 11372
493 Ga0268264_10013175 3300028381 Bacteria 6803
494 Ga0268264_10242966 3300028381 Bacteria 1668
495 Ga0268264_10344600 3300028381 Bacteria 1416
496 Ga0307517_10059170 3300028786 Bacteria 3675
497 Ga0307515_10020164 3300028794 Bacteria 11918
498 Ga0307515_10094534 3300028794 Bacteria 3691
499 Ga0307515_10214253 3300028794 Bacteria 1761
500 Ga0307512_10077698 3300030522 Bacteria 2410
501 Ga0265328_10009284 3300031239 Bacteria 4010
502 Ga0265328_10059482 3300031239 Bacteria 1403
503 Ga0265331_10003982 3300031250 Bacteria 9334
504 Ga0265327_10000311 3300031251 Bacteria 93995
505 Ga0265327_10061279 3300031251 Bacteria 1920
506 Ga0307513_10012208 3300031456 Bacteria 10620
507 Ga0307513_10036776 3300031456 Bacteria 5456
508 Ga0307513_10082308 3300031456 Bacteria 3314
509 Ga0307509_10004656 3300031507 Bacteria 19591
510 Ga0307509_10016899 3300031507 Bacteria 8418
511 Ga0307509_10095855 3300031507 Bacteria 3021
512 Ga0307509_10142586 3300031507 Bacteria 2328
513 Ga0307509_10318850 3300031507 Bacteria 1292
514 Ga0307408_100565212 3300031548 Bacteria 1006
515 Ga0307508_10000140 3300031616 Bacteria 85941
516 Ga0307508_10002494 3300031616 Bacteria 19401
517 Ga0307508_10002594 3300031616 Bacteria 19009
518 Ga0307508_10023375 3300031616 Bacteria 5612
519 Ga0307514_10171368 3300031649 Bacteria 1417
520 Ga0307516_10001367 3300031730 Bacteria 33805
521 Ga0307516_10450473 3300031730 Bacteria 943
522 Ga0307405_10002079 3300031731 Bacteria 8724
523 Ga0307405_10303228 3300031731 Bacteria 1213
524 Ga0307413_10229201 3300031824 Bacteria 1363
525 Ga0307410_10091829 3300031852 Bacteria 2157
526 Ga0307406_10396714 3300031901 Bacteria 1092
527 Ga0307412_10042851 3300031911 Bacteria 2944
528 Ga0307409_100010869 3300031995 Bacteria 5696
529 Ga0307416_100010522 3300032002 Bacteria 6115
530 Ga0307416_100298896 3300032002 Bacteria 1599
531 Ga0307414_10416130 3300032004 Bacteria 1171
532 Ga0307411_10813272 3300032005 Bacteria 824
533 Ga0307507_10031471 3300033179 Bacteria 5569
534 Ga0307507_10099452 3300033179 Bacteria 2443
535 Ga0307510_10035300 3300033180 Bacteria 5587
536 Ga0307510_10060400 3300033180 Bacteria 3901
537 Ga0373950_0020532 3300034818 Bacteria 1162
538 Ga0373928_0010569 3300035084 Bacteria 1816
539 Ga0373940_0106463 3300035088 Bacteria 856
540 Ga0373944_0253281 3300035089 Bacteria 650
541 Ga0373923_0088198 3300035111 Bacteria 1354
542 Ga0373923_0150161 3300035111 Bacteria 1058
543 Ga0373932_0026400 3300035112 Bacteria 1579
544 Ga0373932_0136214 3300035112 Bacteria 831
545 Ga0373939_0010079 3300035114 Bacteria 2355
546 Ga0373945_0155260 3300035116 Bacteria 930
547 Ga0373954_0036049 3300035118 Bacteria 2295
548 Ga0373943_0037525 3300035170 Bacteria 2326
549 Ga0373943_0449363 3300035170 Bacteria 749
550 Ga0373955_0169413 3300035172 Bacteria 1292
551 Ga0373931_0009527 3300035691 Bacteria 4643
552 Ga0373931_0026741 3300035691 Bacteria 2940
553 Ga0373947_0034410 3300035725 Bacteria 2996
554 Ga0373937_0551889 3300036401 Bacteria 1094
555 Ga0373937_0683092 3300036401 Bacteria 973
556 Ga0373925_0002050 3300037068 Bacteria 16608
557 Ga0373925_0018803 3300037068 Bacteria 5022
558 Ga0373925_0064335 3300037068 Bacteria 2761
559 Ga0395905_0014692 3300037471 Bacteria 7467
560 Ga0395905_0102984 3300037471 Bacteria 2680
561 Ga0436365_0483654 3300039437 Bacteria 4339
562 Ga0451793_0214308 3300041452 Bacteria 1956
563 Ga0451795_0209198 3300041456 Bacteria 1164
564 Ga0451804_0983626 3300041463 Bacteria 1033
565 Ga0451853_1017854 3300041512 Bacteria 3064
566 Ga0451853_3243327 3300041512 Bacteria 1075
567 Ga0439455_0034325 3300042012 Bacteria 1276
568 Ga0450898_020290 3300042134 Bacteria 1163
569 Ga0451577_0341371 3300042876 Bacteria 1358
570 Ga0451577_0716562 3300042876 Bacteria 906
571 Ga0466961_0129667 3300044693 Bacteria 1581
572 Ga0453684_0047579 3300044712 Bacteria 5685
573 Ga0453684_0050849 3300044712 Bacteria 5444
574 Ga0453684_0583250 3300044712 Bacteria 1228
575 Ga0466971_0153358 3300044719 Bacteria 1076
576 Ga0466968_0010618 3300044735 Bacteria 3575
577 Ga0451576_0032948 3300045051 Bacteria 5509
578 Ga0451576_0176990 3300045051 Bacteria 2227
579 Ga0451576_0892800 3300045051 Bacteria 932
580 Ga0495629_0202920 3300046459 Bacteria 1370
581 Ga0495629_0287684 3300046459 Bacteria 1127
582 Ga0495638_0098925 3300046460 Bacteria 1747
583 Ga0495582_0047911 3300046473 Bacteria 2354
584 Ga0495582_0100993 3300046473 Bacteria 1615
585 Ga0495639_0186330 3300046475 Bacteria 1012
586 Ga0495583_0112415 3300046506 Bacteria 1153
587 Ga0495608_0122921 3300046511 Bacteria 1664
588 Ga0495616_0141655 3300046513 Bacteria 1094
589 Ga0495618_0257697 3300046514 Bacteria 1093
590 Ga0495630_0076893 3300046517 Bacteria 2516
591 Ga0495630_0210803 3300046517 Bacteria 1483
592 Ga0495632_0010620 3300046519 Bacteria 5434
593 Ga0495632_0014268 3300046519 Bacteria 4499
594 Ga0495586_0010100 3300046535 Bacteria 5024
595 Ga0495621_0043281 3300046539 Bacteria 1588
596 Ga0495597_0023049 3300046542 Bacteria 2881
597 Ga0495656_0226443 3300046615 Bacteria 937
598 Ga0495668_0365057 3300046616 Bacteria 793
599 Ga0495625_0112700 3300046660 Bacteria 1858
600 Ga0495635_0287995 3300046663 Bacteria 1103
601 Ga0495599_0171209 3300046678 Bacteria 1340
602 Ga0495647_0252674 3300046681 Bacteria 785
603 Ga0495658_0008156 3300046683 Bacteria 5188
604 Ga0495658_0058485 3300046683 Bacteria 2205
605 Ga0495658_0084402 3300046683 Bacteria 1870
606 Ga0495658_0091762 3300046683 Bacteria 1799
607 Ga0495658_0099971 3300046683 Bacteria 1730
608 Ga0495613_0189448 3300046689 Bacteria 1454
609 Ga0495624_0058215 3300046690 Bacteria 2428
610 Ga0495671_0023643 3300046692 Bacteria 3210
611 Ga0495649_0002061 3300046694 Bacteria 14469
612 Ga0495581_0359463 3300047315 Bacteria 850
613 Ga0495674_0224707 3300047319 Bacteria 1551
614 Ga0495676_0090835 3300047321 Bacteria 2284
615 Ga0495687_002698 3300047443 Bacteria 13771
616 Ga0495684_0153217 3300047471 Bacteria 1723
617 Ga0495684_0176233 3300047471 Bacteria 1587
618 Ga0495614_0091752 3300048089 Bacteria 1322
619 Ga0495614_0147259 3300048089 Bacteria 1049
620 Ga0496100_0042521 3300048903 Bacteria 2902
621 Ga0496101_0076512 3300048904 Bacteria 2465
622 Ga0496101_0616567 3300048904 Bacteria 858
623 Ga0496102_0047870 3300048905 Bacteria 3887
624 Ga0496103_0301411 3300048906 Bacteria 1031
625 Ga0496104_0155059 3300048907 Bacteria 2198
626 Ga0496105_0089172 3300048908 Bacteria 2548
627 Ga0496105_0109224 3300048908 Bacteria 2284
628 Ga0496106_0009675 3300048909 Bacteria 7120
629 Ga0496106_0699925 3300048909 Bacteria 808
630 Ga0496107_0033571 3300048910 Bacteria 3672
631 Ga0496108_0042916 3300048911 Bacteria 3776
632 Ga0496108_0114612 3300048911 Bacteria 2308
633 Ga0496108_0270411 3300048911 Bacteria 1479
634 Ga0496108_0362980 3300048911 Bacteria 1264
635 Ga0496109_0071475 3300048912 Bacteria 3186
636 Ga0496109_0147834 3300048912 Bacteria 2199
637 Ga0496109_0549562 3300048912 Bacteria 1089
638 Ga0496110_0019345 3300048913 Bacteria 5728
639 Ga0496110_0061842 3300048913 Bacteria 3306
640 Ga0496110_0158563 3300048913 Bacteria 2051
641 Ga0496111_0066099 3300048914 Bacteria 2625
642 Ga0496112_0009035 3300048915 Bacteria 8950
643 Ga0496113_0127874 3300048916 Bacteria 1991
644 Ga0496114_0019482 3300048917 Bacteria 5497
645 Ga0496114_0086981 3300048917 Bacteria 2649
646 Ga0496114_0565929 3300048917 Bacteria 1003
647 Ga0496121_0044818 3300048924 Bacteria 3809
648 Ga0496124_0018411 3300048927 Bacteria 6540
649 Ga0496125_0008691 3300048928 Bacteria 10576
650 nmdc:mga03683_1375_c1 3300050489 Bacteria 7227
651 nmdc:mga03683_14349_c1 3300050489 Bacteria 2929
652 nmdc:mga03683_81638_c1 3300050489 Bacteria 1397
653 nmdc:mga03n38_101530_c1 3300050490 Bacteria 1388
654 nmdc:mga03n38_10498_c1 3300050490 Bacteria 3411
655 nmdc:mga03n38_49835_c1 3300050490 Bacteria 1863
656 nmdc:mga03n38_83803_c1 3300050490 Bacteria 1504
657 nmdc:mga00v17_35885_c1 3300050491 Bacteria 2953
658 nmdc:mga00v17_70495_c1 3300050491 Bacteria 2165
659 nmdc:mga0yw44_13996_c1 3300050492 Bacteria 4243
660 nmdc:mga0yw44_615477_c1 3300050492 Bacteria 738
661 nmdc:mga0k408_126403_c1 3300050493 Bacteria 1517
662 nmdc:mga0k408_298_c1 3300050493 Bacteria 26818
663 nmdc:mga0k408_323886_c1 3300050493 Bacteria 920
664 nmdc:mga0k408_33293_c1 3300050493 Bacteria 2947
665 nmdc:mga0k408_41470_c1 3300050493 Bacteria 2650
666 nmdc:mga0k408_44081_c1 3300050493 Bacteria 2572
667 nmdc:mga0k408_791_c1 3300050493 Bacteria 17435
668 nmdc:mga06z11_315376_c1 3300050494 Bacteria 932
669 nmdc:mga06z11_3754_c1 3300050494 Bacteria 5906
670 nmdc:mga04h51_117335_c1 3300050495 Bacteria 988
671 nmdc:mga07m45_1450_c1 3300050496 Bacteria 10878
672 nmdc:mga07m45_17067_c1 3300050496 Bacteria 3893
673 nmdc:mga07m45_27438_c1 3300050496 Bacteria 3137
674 nmdc:mga07m45_410_c1 3300050496 Bacteria 17752
675 nmdc:mga07m45_53099_c1 3300050496 Bacteria 2290
676 nmdc:mga05p37_213124_c1 3300050507 Bacteria 2334
677 nmdc:mga09592_8800_c1 3300050508 Bacteria 8214
678 nmdc:mga0qj67_46651_c1 3300050509 Bacteria 3421
679 nmdc:mga08y16_439247_c1 3300050511 Bacteria 1332
680 nmdc:mga0sz30_28770_c1 3300050516 Bacteria 2288
681 nmdc:mga0sz30_83374_c1 3300050516 Bacteria 1385
682 Ga0495595_0142503 3300053084 Bacteria 1176
683 Ga0495619_0351664 3300053085 Bacteria 1019
684 Ga0500646_0087255 3300053090 Bacteria 961
685 Ga0500651_0012618 3300053093 Bacteria 5124
686 Ga0500651_0059615 3300053093 Bacteria 2386
687 Ga0500650_0017430 3300053098 Bacteria 3100
688 Ga0500650_0064020 3300053098 Bacteria 1718
689 Ga0500569_005309 3300053109 Bacteria 2763
690 Ga0500607_145452 3300053121 Bacteria 1108
691 Ga0500621_109017 3300053126 Bacteria 1084
692 Ga0500628_002165 3300053129 Bacteria 3275
693 Ga0500642_0041636 3300053130 Bacteria 1987
694 Ga0500642_0119995 3300053130 Bacteria 1229
695 Ga0500652_008946 3300053131 Bacteria 3364
696 Ga0500559_0000135 3300053136 Bacteria 56960
697 Ga0500577_0198743 3300053142 Bacteria 864
698 Ga0500590_047089 3300053148 Bacteria 2202
699 Ga0500616_0227219 3300053153 Bacteria 810
700 Ga0500622_0005574 3300053156 Bacteria 7513
701 Ga0500622_0038578 3300053156 Bacteria 2491
702 Ga0500636_0072809 3300053177 Bacteria 1991
703 Ga0500637_0345498 3300053178 Bacteria 794

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035089 Ga0373944_0253281 Ga0373944_0253281_12_491 159
2 3300026075 Ga0207708_10726361 Ga0207708_107263611 164
3 3300005844 Ga0068862_100235457 Ga0068862_1002354572 189
4 3300033180 Ga0307510_10060400 Ga0307510_100604003 189
5 3300053090 Ga0500646_0087255 Ga0500646_0087255_112_759 189
6 3300053093 Ga0500651_0059615 Ga0500651_0059615_646_1293 189
7 3300053126 Ga0500621_109017 Ga0500621_109017_235_882 189
8 3300053136 Ga0500559_0000135 Ga0500559_0000135_13241_13888 189
9 3300053153 Ga0500616_0227219 Ga0500616_0227219_145_792 189
10 3300053156 Ga0500622_0038578 Ga0500622_0038578_570_1217 189
11 3300005367 Ga0070667_100218257 Ga0070667_1002182572 193
12 3300005441 Ga0070700_100172198 Ga0070700_1001721982 193
13 3300005456 Ga0070678_100354784 Ga0070678_1003547842 193
14 3300005543 Ga0070672_100518423 Ga0070672_1005184233 193
15 3300005719 Ga0068861_100001256 Ga0068861_1000012562 193
16 3300005843 Ga0068860_100000989 Ga0068860_10000098910 193
17 3300013297 Ga0157378_10127038 Ga0157378_101270383 193
18 3300013308 Ga0157375_10094724 Ga0157375_100947242 193
19 3300014968 Ga0157379_10007711 Ga0157379_100077115 193
20 3300014969 Ga0157376_10641687 Ga0157376_106416872 193
21 3300025938 Ga0207704_10014643 Ga0207704_100146432 193
22 3300025940 Ga0207691_10429243 Ga0207691_104292432 193
23 3300025942 Ga0207689_10282697 Ga0207689_102826972 193
24 3300025961 Ga0207712_10172443 Ga0207712_101724432 193
25 3300025986 Ga0207658_10191045 Ga0207658_101910452 193
26 3300026035 Ga0207703_10031846 Ga0207703_100318462 193
27 3300026089 Ga0207648_10000310 Ga0207648_1000031029 193
28 3300026118 Ga0207675_100012910 Ga0207675_1000129105 193
29 3300026121 Ga0207683_10037011 Ga0207683_100370113 193
30 3300028381 Ga0268264_10013175 Ga0268264_100131754 193
31 3300005459 Ga0068867_100002034 Ga0068867_10000203414 195
32 3300005844 Ga0068862_100078880 Ga0068862_1000788802 195
33 3300009176 Ga0105242_10123243 Ga0105242_101232432 195
34 3300026089 Ga0207648_10114922 Ga0207648_101149222 195
35 3300028380 Ga0268265_10428105 Ga0268265_104281052 195
36 3300042876 Ga0451577_0341371 Ga0451577_0341371_347_946 196
37 3300044712 Ga0453684_0583250 Ga0453684_0583250_412_1011 196
38 3300045051 Ga0451576_0892800 Ga0451576_0892800_183_782 196
39 3300013306 Ga0163162_10002520 Ga0163162_100025204 197
40 3300005335 Ga0070666_10524669 Ga0070666_105246692 206
41 3300005367 Ga0070667_100175866 Ga0070667_1001758662 206
42 3300009545 Ga0105237_10186555 Ga0105237_101865552 206
43 3300041463 Ga0451804_0983626 Ga0451804_0983626_169_789 206
44 3300044712 Ga0453684_0050849 Ga0453684_0050849_317_946 206
45 3300046459 Ga0495629_0287684 Ga0495629_0287684_373_1011 206
46 3300025914 Ga0207671_10145005 Ga0207671_101450052 207
47 3300025986 Ga0207658_10068012 Ga0207658_100680123 207
48 3300031239 Ga0265328_10009284 Ga0265328_100092843 207
49 3300031250 Ga0265331_10003982 Ga0265331_100039825 207
50 3300031251 Ga0265327_10000311 Ga0265327_1000031135 207
51 3300031507 Ga0307509_10142586 Ga0307509_101425862 207
52 3300032005 Ga0307411_10813272 Ga0307411_108132721 207
53 3300005331 Ga0070670_100047389 Ga0070670_1000473893 209
54 3300005354 Ga0070675_100224039 Ga0070675_1002240392 209
55 3300005367 Ga0070667_100321752 Ga0070667_1003217522 209
56 3300005456 Ga0070678_100743552 Ga0070678_1007435521 209
57 3300025926 Ga0207659_10077319 Ga0207659_100773192 209
58 3300025933 Ga0207706_10211252 Ga0207706_102112522 209
59 3300026121 Ga0207683_10102365 Ga0207683_101023653 209
60 3300035084 Ga0373928_0010569 Ga0373928_0010569_669_1316 209
61 3300035691 Ga0373931_0026741 Ga0373931_0026741_489_1136 209
62 3300046514 Ga0495618_0257697 Ga0495618_0257697_298_945 209
63 3300046517 Ga0495630_0076893 Ga0495630_0076893_480_1127 209
64 3300046690 Ga0495624_0058215 Ga0495624_0058215_1447_2094 209
65 3300047315 Ga0495581_0359463 Ga0495581_0359463_120_767 209
66 3300047321 Ga0495676_0090835 Ga0495676_0090835_618_1265 209
67 3300048089 Ga0495614_0147259 Ga0495614_0147259_281_928 209
68 3300003316 rootH1_10048080 rootH1_100480802 210
69 3300031507 Ga0307509_10004656 Ga0307509_100046567 210
70 iso_pu_bacteria 2585428057 2587726333 211
71 iso_pu_bacteria 2585428058 2587731763 211
72 iso_pu_bacteria 2643221644 2644245425 211
73 3300005336 Ga0070680_100029873 Ga0070680_1000298733 213
74 3300005530 Ga0070679_100012199 Ga0070679_1000121996 213
75 3300014326 Ga0157380_10104898 Ga0157380_101048983 213
76 3300025917 Ga0207660_10108625 Ga0207660_101086252 213
77 3300025921 Ga0207652_10006543 Ga0207652_100065436 213
78 3300037471 Ga0395905_0014692 Ga0395905_0014692_6132_6836 213
79 3300044693 Ga0466961_0129667 Ga0466961_0129667_510_1214 213
80 3300044719 Ga0466971_0153358 Ga0466971_0153358_241_945 213
81 3300003775 Ga0055524_1000079 Ga0055524_1000079100 214
82 3300005262 Ga0065165_1046569 Ga0065165_10465691 214
83 3300006353 Ga0075370_10235062 Ga0075370_102350622 214
84 3300025299 Ga0209256_1000011 Ga0209256_1000011101 214
85 3300025933 Ga0207706_10134453 Ga0207706_101344533 214
86 3300026078 Ga0207702_10042415 Ga0207702_100424153 214
87 3300042876 Ga0451577_0716562 Ga0451577_0716562_74_718 214
88 3300044712 Ga0453684_0047579 Ga0453684_0047579_4410_5057 214
89 3300045051 Ga0451576_0032948 Ga0451576_0032948_4135_4779 214
90 3300048917 Ga0496114_0019482 Ga0496114_0019482_1060_1707 214
91 3300053178 Ga0500637_0345498 Ga0500637_0345498_59_718 214
92 3300002774 JGI25150J39212_1013974 JGI25150J39212_10139741 215
93 3300003215 JGI25153J46596_10005823 JGI25153J46596_100058232 215
94 3300003215 JGI25153J46596_10005931 JGI25153J46596_100059313 215
95 3300003215 JGI25153J46596_10010740 JGI25153J46596_100107403 215
96 3300003771 Ga0055526_1018996 Ga0055526_10189962 215
97 3300003792 Ga0055540_1000004 Ga0055540_1000004137 215
98 3300003794 Ga0055531_10008300 Ga0055531_100083003 215
99 3300005295 Ga0065707_10092687 Ga0065707_100926873 215
100 3300005327 Ga0070658_10070761 Ga0070658_100707613 215
101 3300005327 Ga0070658_10103249 Ga0070658_101032492 215
102 3300005327 Ga0070658_10250839 Ga0070658_102508392 215
103 3300005328 Ga0070676_10003580 Ga0070676_100035804 215
104 3300005328 Ga0070676_10036707 Ga0070676_100367073 215
105 3300005330 Ga0070690_100013302 Ga0070690_1000133023 215
106 3300005331 Ga0070670_100004564 Ga0070670_1000045647 215
107 3300005331 Ga0070670_100104394 Ga0070670_1001043943 215
108 3300005331 Ga0070670_100653351 Ga0070670_1006533511 215
109 3300005333 Ga0070677_10013875 Ga0070677_100138752 215
110 3300005333 Ga0070677_10017543 Ga0070677_100175432 215
111 3300005333 Ga0070677_10034440 Ga0070677_100344402 215
112 3300005333 Ga0070677_10064275 Ga0070677_100642752 215
113 3300005334 Ga0068869_100000287 Ga0068869_1000002878 215
114 3300005334 Ga0068869_100007333 Ga0068869_1000073334 215
115 3300005334 Ga0068869_100144210 Ga0068869_1001442102 215
116 3300005335 Ga0070666_10038958 Ga0070666_100389583 215
117 3300005335 Ga0070666_10051094 Ga0070666_100510943 215
118 3300005335 Ga0070666_10096529 Ga0070666_100965291 215
119 3300005335 Ga0070666_10225758 Ga0070666_102257582 215
120 3300005338 Ga0068868_100035131 Ga0068868_1000351313 215
121 3300005338 Ga0068868_100043620 Ga0068868_1000436202 215
122 3300005338 Ga0068868_100050267 Ga0068868_1000502674 215
123 3300005338 Ga0068868_100199950 Ga0068868_1001999501 215
124 3300005338 Ga0068868_100254955 Ga0068868_1002549552 215
125 3300005338 Ga0068868_100605073 Ga0068868_1006050731 215
126 3300005339 Ga0070660_100075701 Ga0070660_1000757012 215
127 3300005339 Ga0070660_100287217 Ga0070660_1002872172 215
128 3300005339 Ga0070660_100339685 Ga0070660_1003396852 215
129 3300005343 Ga0070687_100304885 Ga0070687_1003048851 215
130 3300005344 Ga0070661_100001326 Ga0070661_1000013269 215
131 3300005344 Ga0070661_100096521 Ga0070661_1000965212 215
132 3300005344 Ga0070661_100551070 Ga0070661_1005510701 215
133 3300005344 Ga0070661_100590459 Ga0070661_1005904591 215
134 3300005347 Ga0070668_100006437 Ga0070668_1000064376 215
135 3300005347 Ga0070668_100031606 Ga0070668_1000316062 215
136 3300005353 Ga0070669_100008796 Ga0070669_1000087964 215
137 3300005353 Ga0070669_100100348 Ga0070669_1001003482 215
138 3300005354 Ga0070675_100000322 Ga0070675_1000003225 215
139 3300005354 Ga0070675_100011400 Ga0070675_1000114004 215
140 3300005354 Ga0070675_100025355 Ga0070675_1000253555 215
141 3300005354 Ga0070675_100027488 Ga0070675_1000274883 215
142 3300005354 Ga0070675_100047502 Ga0070675_1000475023 215
143 3300005355 Ga0070671_100014031 Ga0070671_1000140315 215
144 3300005355 Ga0070671_100041904 Ga0070671_1000419044 215
145 3300005355 Ga0070671_100062646 Ga0070671_1000626463 215
146 3300005355 Ga0070671_100157386 Ga0070671_1001573862 215
147 3300005355 Ga0070671_100482188 Ga0070671_1004821882 215
148 3300005356 Ga0070674_100010469 Ga0070674_1000104693 215
149 3300005356 Ga0070674_100167871 Ga0070674_1001678712 215
150 3300005356 Ga0070674_100259095 Ga0070674_1002590951 215
151 3300005356 Ga0070674_100271028 Ga0070674_1002710282 215
152 3300005364 Ga0070673_100002962 Ga0070673_1000029628 215
153 3300005364 Ga0070673_100132159 Ga0070673_1001321592 215
154 3300005364 Ga0070673_100265472 Ga0070673_1002654721 215
155 3300005364 Ga0070673_100290539 Ga0070673_1002905392 215
156 3300005364 Ga0070673_100394347 Ga0070673_1003943472 215
157 3300005364 Ga0070673_100687772 Ga0070673_1006877722 215
158 3300005366 Ga0070659_100000336 Ga0070659_10000033630 215
159 3300005367 Ga0070667_100004438 Ga0070667_1000044389 215
160 3300005367 Ga0070667_100009358 Ga0070667_1000093587 215
161 3300005367 Ga0070667_100012223 Ga0070667_1000122237 215
162 3300005367 Ga0070667_100029416 Ga0070667_1000294162 215
163 3300005367 Ga0070667_100155900 Ga0070667_1001559003 215
164 3300005367 Ga0070667_100230754 Ga0070667_1002307542 215
165 3300005367 Ga0070667_100277639 Ga0070667_1002776392 215
166 3300005438 Ga0070701_10300297 Ga0070701_103002972 215
167 3300005441 Ga0070700_100004808 Ga0070700_1000048082 215
168 3300005455 Ga0070663_100008422 Ga0070663_1000084227 215
169 3300005455 Ga0070663_100059976 Ga0070663_1000599762 215
170 3300005455 Ga0070663_100273119 Ga0070663_1002731191 215
171 3300005455 Ga0070663_100539211 Ga0070663_1005392112 215
172 3300005456 Ga0070678_100027686 Ga0070678_1000276863 215
173 3300005456 Ga0070678_100045697 Ga0070678_1000456973 215
174 3300005456 Ga0070678_100076567 Ga0070678_1000765672 215
175 3300005456 Ga0070678_100205439 Ga0070678_1002054392 215
176 3300005456 Ga0070678_100222524 Ga0070678_1002225242 215
177 3300005456 Ga0070678_100460996 Ga0070678_1004609962 215
178 3300005456 Ga0070678_100482982 Ga0070678_1004829821 215
179 3300005457 Ga0070662_100038169 Ga0070662_1000381692 215
180 3300005457 Ga0070662_100057681 Ga0070662_1000576812 215
181 3300005458 Ga0070681_10314729 Ga0070681_103147292 215
182 3300005459 Ga0068867_100101659 Ga0068867_1001016593 215
183 3300005459 Ga0068867_100141393 Ga0068867_1001413932 215
184 3300005459 Ga0068867_100193719 Ga0068867_1001937192 215
185 3300005459 Ga0068867_100256975 Ga0068867_1002569751 215
186 3300005459 Ga0068867_100559883 Ga0068867_1005598832 215
187 3300005466 Ga0070685_10074581 Ga0070685_100745812 215
188 3300005466 Ga0070685_10415401 Ga0070685_104154012 215
189 3300005467 Ga0070706_100001359 Ga0070706_10000135914 215
190 3300005468 Ga0070707_100097547 Ga0070707_1000975472 215
191 3300005535 Ga0070684_100160632 Ga0070684_1001606323 215
192 3300005539 Ga0068853_100524126 Ga0068853_1005241262 215
193 3300005539 Ga0068853_100604623 Ga0068853_1006046232 215
194 3300005543 Ga0070672_100008994 Ga0070672_1000089943 215
195 3300005543 Ga0070672_100015361 Ga0070672_1000153612 215
196 3300005543 Ga0070672_100216745 Ga0070672_1002167451 215
197 3300005543 Ga0070672_100238256 Ga0070672_1002382561 215
198 3300005543 Ga0070672_100538176 Ga0070672_1005381762 215
199 3300005543 Ga0070672_100862763 Ga0070672_1008627631 215
200 3300005546 Ga0070696_100671760 Ga0070696_1006717601 215
201 3300005548 Ga0070665_100488282 Ga0070665_1004882822 215
202 3300005563 Ga0068855_100404923 Ga0068855_1004049231 215
203 3300005563 Ga0068855_100468355 Ga0068855_1004683552 215
204 3300005564 Ga0070664_100017678 Ga0070664_1000176785 215
205 3300005564 Ga0070664_100250050 Ga0070664_1002500501 215
206 3300005564 Ga0070664_100574723 Ga0070664_1005747232 215
207 3300005577 Ga0068857_100133634 Ga0068857_1001336343 215
208 3300005577 Ga0068857_100306491 Ga0068857_1003064912 215
209 3300005577 Ga0068857_101079164 Ga0068857_1010791641 215
210 3300005578 Ga0068854_100037572 Ga0068854_1000375723 215
211 3300005578 Ga0068854_100059484 Ga0068854_1000594842 215
212 3300005578 Ga0068854_100072892 Ga0068854_1000728922 215
213 3300005578 Ga0068854_100553840 Ga0068854_1005538402 215
214 3300005615 Ga0070702_100122951 Ga0070702_1001229512 215
215 3300005616 Ga0068852_100011794 Ga0068852_1000117942 215
216 3300005616 Ga0068852_100092739 Ga0068852_1000927393 215
217 3300005616 Ga0068852_100498015 Ga0068852_1004980152 215
218 3300005617 Ga0068859_100008152 Ga0068859_10000815213 215
219 3300005617 Ga0068859_100023977 Ga0068859_1000239774 215
220 3300005617 Ga0068859_100057687 Ga0068859_1000576873 215
221 3300005617 Ga0068859_100180990 Ga0068859_1001809902 215
222 3300005618 Ga0068864_100006810 Ga0068864_1000068103 215
223 3300005618 Ga0068864_100006813 Ga0068864_1000068135 215
224 3300005618 Ga0068864_100052350 Ga0068864_1000523503 215
225 3300005618 Ga0068864_100068692 Ga0068864_1000686922 215
226 3300005618 Ga0068864_100170056 Ga0068864_1001700563 215
227 3300005618 Ga0068864_100213981 Ga0068864_1002139812 215
228 3300005618 Ga0068864_101049522 Ga0068864_1010495221 215
229 3300005718 Ga0068866_10115104 Ga0068866_101151042 215
230 3300005719 Ga0068861_100033391 Ga0068861_1000333913 215
231 3300005719 Ga0068861_100417916 Ga0068861_1004179162 215
232 3300005834 Ga0068851_10031438 Ga0068851_100314382 215
233 3300005834 Ga0068851_10073763 Ga0068851_100737632 215
234 3300005834 Ga0068851_10075709 Ga0068851_100757092 215
235 3300005834 Ga0068851_10080770 Ga0068851_100807702 215
236 3300005841 Ga0068863_100008722 Ga0068863_1000087222 215
237 3300005841 Ga0068863_100021758 Ga0068863_1000217582 215
238 3300005841 Ga0068863_100038295 Ga0068863_1000382954 215
239 3300005841 Ga0068863_100156834 Ga0068863_1001568343 215
240 3300005841 Ga0068863_100224273 Ga0068863_1002242732 215
241 3300005842 Ga0068858_100004522 Ga0068858_1000045222 215
242 3300005842 Ga0068858_100021085 Ga0068858_1000210853 215
243 3300005842 Ga0068858_100051898 Ga0068858_1000518983 215
244 3300005842 Ga0068858_100167873 Ga0068858_1001678732 215
245 3300005843 Ga0068860_100005562 Ga0068860_10000556211 215
246 3300005843 Ga0068860_100082121 Ga0068860_1000821213 215
247 3300005843 Ga0068860_100085907 Ga0068860_1000859071 215
248 3300005843 Ga0068860_100222431 Ga0068860_1002224312 215
249 3300005844 Ga0068862_100079156 Ga0068862_1000791563 215
250 3300005844 Ga0068862_100171192 Ga0068862_1001711922 215
251 3300006028 Ga0070717_10722906 Ga0070717_107229062 215
252 3300006038 Ga0075365_10024481 Ga0075365_100244813 215
253 3300006038 Ga0075365_10572908 Ga0075365_105729082 215
254 3300006042 Ga0075368_10001139 Ga0075368_100011393 215
255 3300006048 Ga0075363_100000866 Ga0075363_1000008665 215
256 3300006048 Ga0075363_100088685 Ga0075363_1000886852 215
257 3300006048 Ga0075363_100206767 Ga0075363_1002067671 215
258 3300006048 Ga0075363_100330071 Ga0075363_1003300711 215
259 3300006051 Ga0075364_10021082 Ga0075364_100210823 215
260 3300006051 Ga0075364_10060464 Ga0075364_100604642 215
261 3300006177 Ga0075362_10008657 Ga0075362_100086572 215
262 3300006177 Ga0075362_10064522 Ga0075362_100645222 215
263 3300006177 Ga0075362_10152163 Ga0075362_101521632 215
264 3300006178 Ga0075367_10013893 Ga0075367_100138933 215
265 3300006178 Ga0075367_10037441 Ga0075367_100374413 215
266 3300006178 Ga0075367_10039167 Ga0075367_100391672 215
267 3300006186 Ga0075369_10058088 Ga0075369_100580883 215
268 3300006195 Ga0075366_10000694 Ga0075366_1000069421 215
269 3300006195 Ga0075366_10009550 Ga0075366_100095502 215
270 3300006195 Ga0075366_10033502 Ga0075366_100335022 215
271 3300006195 Ga0075366_10094778 Ga0075366_100947782 215
272 3300006195 Ga0075366_10167834 Ga0075366_101678342 215
273 3300006237 Ga0097621_100054327 Ga0097621_1000543273 215
274 3300006237 Ga0097621_100145211 Ga0097621_1001452112 215
275 3300006237 Ga0097621_100177209 Ga0097621_1001772092 215
276 3300006237 Ga0097621_100379196 Ga0097621_1003791962 215
277 3300006353 Ga0075370_10000326 Ga0075370_100003267 215
278 3300006353 Ga0075370_10000436 Ga0075370_100004365 215
279 3300006353 Ga0075370_10009246 Ga0075370_100092462 215
280 3300006353 Ga0075370_10011217 Ga0075370_100112173 215
281 3300006353 Ga0075370_10030032 Ga0075370_100300323 215
282 3300006358 Ga0068871_100041817 Ga0068871_1000418172 215
283 3300006358 Ga0068871_100769640 Ga0068871_1007696402 215
284 3300006846 Ga0075430_100072946 Ga0075430_1000729462 215
285 3300006880 Ga0075429_100005458 Ga0075429_1000054587 215
286 3300006881 Ga0068865_100013136 Ga0068865_1000131364 215
287 3300006881 Ga0068865_100044231 Ga0068865_1000442312 215
288 3300006881 Ga0068865_100259393 Ga0068865_1002593932 215
289 3300006931 Ga0097620_100008153 Ga0097620_10000815313 215
290 3300006931 Ga0097620_100023977 Ga0097620_1000239774 215
291 3300006931 Ga0097620_100057688 Ga0097620_1000576883 215
292 3300006931 Ga0097620_100180988 Ga0097620_1001809882 215
293 3300006946 Ga0079104_1000352 Ga0079104_100035231 215
294 3300009093 Ga0105240_10123389 Ga0105240_101233893 215
295 3300009093 Ga0105240_10459432 Ga0105240_104594322 215
296 3300009098 Ga0105245_10012538 Ga0105245_100125382 215
297 3300009098 Ga0105245_10133816 Ga0105245_101338163 215
298 3300009098 Ga0105245_10342330 Ga0105245_103423302 215
299 3300009101 Ga0105247_10110819 Ga0105247_101108193 215
300 3300009147 Ga0114129_10252574 Ga0114129_102525742 215
301 3300009148 Ga0105243_10244094 Ga0105243_102440942 215
302 3300009174 Ga0105241_10092023 Ga0105241_100920233 215
303 3300009176 Ga0105242_10096246 Ga0105242_100962462 215
304 3300009176 Ga0105242_10255866 Ga0105242_102558662 215
305 3300009176 Ga0105242_10575875 Ga0105242_105758752 215
306 3300009177 Ga0105248_10005678 Ga0105248_1000567810 215
307 3300009177 Ga0105248_10037339 Ga0105248_100373395 215
308 3300009177 Ga0105248_10164097 Ga0105248_101640972 215
309 3300009177 Ga0105248_10546135 Ga0105248_105461352 215
310 3300009545 Ga0105237_10053047 Ga0105237_100530473 215
311 3300009545 Ga0105237_10503317 Ga0105237_105033172 215
312 3300009551 Ga0105238_10197500 Ga0105238_101975002 215
313 3300009553 Ga0105249_10059678 Ga0105249_100596784 215
314 3300009553 Ga0105249_11000370 Ga0105249_110003702 215
315 3300010375 Ga0105239_10094657 Ga0105239_100946573 215
316 3300010375 Ga0105239_10098645 Ga0105239_100986452 215
317 3300011119 Ga0105246_10516056 Ga0105246_105160562 215
318 3300011119 Ga0105246_10708553 Ga0105246_107085531 215
319 3300013100 Ga0157373_10004841 Ga0157373_100048413 215
320 3300013102 Ga0157371_10204596 Ga0157371_102045961 215
321 3300013104 Ga0157370_10230937 Ga0157370_102309372 215
322 3300013105 Ga0157369_10064757 Ga0157369_100647572 215
323 3300013105 Ga0157369_10229909 Ga0157369_102299092 215
324 3300013296 Ga0157374_10132987 Ga0157374_101329872 215
325 3300013296 Ga0157374_10178734 Ga0157374_101787343 215
326 3300013296 Ga0157374_10442001 Ga0157374_104420012 215
327 3300013296 Ga0157374_10633625 Ga0157374_106336252 215
328 3300013296 Ga0157374_10656350 Ga0157374_106563502 215
329 3300013297 Ga0157378_10236886 Ga0157378_102368862 215
330 3300013297 Ga0157378_10359092 Ga0157378_103590922 215
331 3300013306 Ga0163162_10038029 Ga0163162_100380293 215
332 3300013306 Ga0163162_10107216 Ga0163162_101072162 215
333 3300013306 Ga0163162_10310114 Ga0163162_103101141 215
334 3300013307 Ga0157372_10268809 Ga0157372_102688092 215
335 3300013308 Ga0157375_10003007 Ga0157375_100030073 215
336 3300013308 Ga0157375_10003841 Ga0157375_100038414 215
337 3300013308 Ga0157375_10153375 Ga0157375_101533752 215
338 3300013308 Ga0157375_10231241 Ga0157375_102312412 215
339 3300013308 Ga0157375_10643527 Ga0157375_106435272 215
340 3300013308 Ga0157375_11232497 Ga0157375_112324971 215
341 3300014325 Ga0163163_10023012 Ga0163163_100230124 215
342 3300014325 Ga0163163_10378722 Ga0163163_103787222 215
343 3300014325 Ga0163163_10927844 Ga0163163_109278441 215
344 3300014326 Ga0157380_10001456 Ga0157380_100014569 215
345 3300014326 Ga0157380_10015049 Ga0157380_100150494 215
346 3300014326 Ga0157380_10050553 Ga0157380_100505533 215
347 3300014745 Ga0157377_10017784 Ga0157377_100177843 215
348 3300014745 Ga0157377_10337711 Ga0157377_103377112 215
349 3300014745 Ga0157377_10540347 Ga0157377_105403471 215
350 3300014968 Ga0157379_10046568 Ga0157379_100465684 215
351 3300014968 Ga0157379_10090299 Ga0157379_100902993 215
352 3300014968 Ga0157379_10091557 Ga0157379_100915574 215
353 3300014968 Ga0157379_10101466 Ga0157379_101014663 215
354 3300014968 Ga0157379_10114831 Ga0157379_101148312 215
355 3300014968 Ga0157379_10250806 Ga0157379_102508062 215
356 3300014968 Ga0157379_10707495 Ga0157379_107074952 215
357 3300014968 Ga0157379_10831783 Ga0157379_108317832 215
358 3300014969 Ga0157376_10057077 Ga0157376_100570772 215
359 3300014969 Ga0157376_10088944 Ga0157376_100889443 215
360 3300015262 Ga0182007_10060635 Ga0182007_100606352 215
361 3300017792 Ga0163161_10010581 Ga0163161_100105812 215
362 3300017792 Ga0163161_10043893 Ga0163161_100438932 215
363 3300017792 Ga0163161_10180512 Ga0163161_101805122 215
364 3300017792 Ga0163161_10202527 Ga0163161_102025272 215
365 3300025245 Ga0207425_1001224 Ga0207425_10012249 215
366 3300025258 Ga0209129_1000041 Ga0209129_100004123 215
367 3300025273 Ga0209673_1021882 Ga0209673_10218822 215
368 3300025295 Ga0209564_1000029 Ga0209564_1000029169 215
369 3300025297 Ga0209758_1000043 Ga0209758_1000043271 215
370 3300025297 Ga0209758_1000057 Ga0209758_10000573 215
371 3300025298 Ga0209050_1003660 Ga0209050_10036602 215
372 3300025303 Ga0209051_1000016 Ga0209051_1000016229 215
373 3300025304 Ga0209257_1000102 Ga0209257_100010264 215
374 3300025315 Ga0207697_10033989 Ga0207697_100339893 215
375 3300025321 Ga0207656_10046886 Ga0207656_100468863 215
376 3300025893 Ga0207682_10008765 Ga0207682_100087653 215
377 3300025893 Ga0207682_10015590 Ga0207682_100155903 215
378 3300025893 Ga0207682_10016142 Ga0207682_100161422 215
379 3300025893 Ga0207682_10031014 Ga0207682_100310142 215
380 3300025899 Ga0207642_10004119 Ga0207642_100041192 215
381 3300025899 Ga0207642_10090705 Ga0207642_100907052 215
382 3300025901 Ga0207688_10094685 Ga0207688_100946852 215
383 3300025901 Ga0207688_10340443 Ga0207688_103404432 215
384 3300025903 Ga0207680_10031915 Ga0207680_100319152 215
385 3300025903 Ga0207680_10047700 Ga0207680_100477003 215
386 3300025907 Ga0207645_10006800 Ga0207645_100068004 215
387 3300025907 Ga0207645_10043145 Ga0207645_100431452 215
388 3300025907 Ga0207645_10100275 Ga0207645_101002752 215
389 3300025907 Ga0207645_10269379 Ga0207645_102693792 215
390 3300025908 Ga0207643_10138303 Ga0207643_101383032 215
391 3300025908 Ga0207643_10159122 Ga0207643_101591222 215
392 3300025909 Ga0207705_10412832 Ga0207705_104128322 215
393 3300025911 Ga0207654_10048113 Ga0207654_100481133 215
394 3300025913 Ga0207695_10074259 Ga0207695_100742594 215
395 3300025913 Ga0207695_10290834 Ga0207695_102908342 215
396 3300025914 Ga0207671_10015949 Ga0207671_100159493 215
397 3300025914 Ga0207671_10072300 Ga0207671_100723002 215
398 3300025918 Ga0207662_10086628 Ga0207662_100866282 215
399 3300025919 Ga0207657_10095410 Ga0207657_100954102 215
400 3300025920 Ga0207649_10011600 Ga0207649_100116005 215
401 3300025920 Ga0207649_10094310 Ga0207649_100943102 215
402 3300025920 Ga0207649_10600990 Ga0207649_106009901 215
403 3300025922 Ga0207646_10084736 Ga0207646_100847363 215
404 3300025923 Ga0207681_10000205 Ga0207681_100002058 215
405 3300025923 Ga0207681_10083208 Ga0207681_100832082 215
406 3300025923 Ga0207681_10184498 Ga0207681_101844982 215
407 3300025923 Ga0207681_10444798 Ga0207681_104447982 215
408 3300025924 Ga0207694_10038195 Ga0207694_100381952 215
409 3300025924 Ga0207694_10220461 Ga0207694_102204612 215
410 3300025925 Ga0207650_10002265 Ga0207650_100022653 215
411 3300025925 Ga0207650_10002632 Ga0207650_100026323 215
412 3300025925 Ga0207650_10049976 Ga0207650_100499762 215
413 3300025926 Ga0207659_10000640 Ga0207659_100006402 215
414 3300025926 Ga0207659_10005482 Ga0207659_100054824 215
415 3300025926 Ga0207659_10029748 Ga0207659_100297483 215
416 3300025926 Ga0207659_10055002 Ga0207659_100550022 215
417 3300025926 Ga0207659_10218711 Ga0207659_102187112 215
418 3300025927 Ga0207687_10062639 Ga0207687_100626393 215
419 3300025927 Ga0207687_10076478 Ga0207687_100764783 215
420 3300025927 Ga0207687_10105424 Ga0207687_101054242 215
421 3300025931 Ga0207644_10004364 Ga0207644_100043645 215
422 3300025931 Ga0207644_10115431 Ga0207644_101154313 215
423 3300025931 Ga0207644_10116173 Ga0207644_101161732 215
424 3300025931 Ga0207644_10148244 Ga0207644_101482442 215
425 3300025931 Ga0207644_10374540 Ga0207644_103745402 215
426 3300025931 Ga0207644_10868920 Ga0207644_108689201 215
427 3300025932 Ga0207690_10013283 Ga0207690_100132833 215
428 3300025932 Ga0207690_10137966 Ga0207690_101379663 215
429 3300025932 Ga0207690_10422398 Ga0207690_104223982 215
430 3300025933 Ga0207706_10020517 Ga0207706_100205173 215
431 3300025934 Ga0207686_10166644 Ga0207686_101666442 215
432 3300025935 Ga0207709_10426815 Ga0207709_104268152 215
433 3300025936 Ga0207670_10016862 Ga0207670_100168621 215
434 3300025936 Ga0207670_10192515 Ga0207670_101925152 215
435 3300025937 Ga0207669_10025734 Ga0207669_100257342 215
436 3300025937 Ga0207669_10128822 Ga0207669_101288222 215
437 3300025937 Ga0207669_10153035 Ga0207669_101530352 215
438 3300025938 Ga0207704_10040771 Ga0207704_100407712 215
439 3300025938 Ga0207704_10222617 Ga0207704_102226172 215
440 3300025938 Ga0207704_10374449 Ga0207704_103744492 215
441 3300025940 Ga0207691_10005244 Ga0207691_100052444 215
442 3300025940 Ga0207691_10013352 Ga0207691_100133523 215
443 3300025940 Ga0207691_10031282 Ga0207691_100312821 215
444 3300025940 Ga0207691_10033674 Ga0207691_100336742 215
445 3300025940 Ga0207691_10049278 Ga0207691_100492782 215
446 3300025940 Ga0207691_10125365 Ga0207691_101253653 215
447 3300025940 Ga0207691_10347673 Ga0207691_103476732 215
448 3300025940 Ga0207691_10577625 Ga0207691_105776252 215
449 3300025941 Ga0207711_10003076 Ga0207711_1000307615 215
450 3300025941 Ga0207711_10004990 Ga0207711_100049909 215
451 3300025941 Ga0207711_10006526 Ga0207711_100065267 215
452 3300025941 Ga0207711_10044179 Ga0207711_100441793 215
453 3300025941 Ga0207711_10098658 Ga0207711_100986583 215
454 3300025941 Ga0207711_10373411 Ga0207711_103734112 215
455 3300025941 Ga0207711_10423257 Ga0207711_104232572 215
456 3300025942 Ga0207689_10000612 Ga0207689_1000061220 215
457 3300025942 Ga0207689_10007315 Ga0207689_100073157 215
458 3300025942 Ga0207689_10036567 Ga0207689_100365673 215
459 3300025944 Ga0207661_10028032 Ga0207661_100280322 215
460 3300025945 Ga0207679_10000526 Ga0207679_1000052622 215
461 3300025945 Ga0207679_10073308 Ga0207679_100733083 215
462 3300025945 Ga0207679_10133413 Ga0207679_101334132 215
463 3300025945 Ga0207679_10311431 Ga0207679_103114312 215
464 3300025949 Ga0207667_10505813 Ga0207667_105058132 215
465 3300025960 Ga0207651_10004882 Ga0207651_100048823 215
466 3300025960 Ga0207651_10062308 Ga0207651_100623083 215
467 3300025960 Ga0207651_10178703 Ga0207651_101787032 215
468 3300025960 Ga0207651_10377525 Ga0207651_103775252 215
469 3300025960 Ga0207651_10492238 Ga0207651_104922381 215
470 3300025961 Ga0207712_10021116 Ga0207712_100211164 215
471 3300025972 Ga0207668_10006845 Ga0207668_100068454 215
472 3300025981 Ga0207640_10055213 Ga0207640_100552133 215
473 3300025981 Ga0207640_10145212 Ga0207640_101452122 215
474 3300025986 Ga0207658_10001252 Ga0207658_1000125210 215
475 3300025986 Ga0207658_10005498 Ga0207658_100054986 215
476 3300025986 Ga0207658_10131396 Ga0207658_101313963 215
477 3300025986 Ga0207658_10188708 Ga0207658_101887082 215
478 3300025986 Ga0207658_10199074 Ga0207658_101990742 215
479 3300026023 Ga0207677_10001106 Ga0207677_1000110611 215
480 3300026023 Ga0207677_10003691 Ga0207677_100036915 215
481 3300026023 Ga0207677_10029892 Ga0207677_100298923 215
482 3300026023 Ga0207677_10113150 Ga0207677_101131502 215
483 3300026023 Ga0207677_10155303 Ga0207677_101553032 215
484 3300026035 Ga0207703_10007447 Ga0207703_100074477 215
485 3300026035 Ga0207703_10015583 Ga0207703_100155834 215
486 3300026035 Ga0207703_10035385 Ga0207703_100353853 215
487 3300026035 Ga0207703_10054951 Ga0207703_100549512 215
488 3300026041 Ga0207639_10218941 Ga0207639_102189412 215
489 3300026041 Ga0207639_10229905 Ga0207639_102299052 215
490 3300026067 Ga0207678_10069611 Ga0207678_100696112 215
491 3300026067 Ga0207678_10335539 Ga0207678_103355391 215
492 3300026067 Ga0207678_10808897 Ga0207678_108088971 215
493 3300026075 Ga0207708_10021642 Ga0207708_100216424 215
494 3300026078 Ga0207702_10577782 Ga0207702_105777822 215
495 3300026088 Ga0207641_10004081 Ga0207641_1000408110 215
496 3300026088 Ga0207641_10010585 Ga0207641_100105858 215
497 3300026088 Ga0207641_10121844 Ga0207641_101218442 215
498 3300026088 Ga0207641_10133817 Ga0207641_101338172 215
499 3300026088 Ga0207641_10232078 Ga0207641_102320782 215
500 3300026089 Ga0207648_10017210 Ga0207648_100172104 215
501 3300026089 Ga0207648_10226719 Ga0207648_102267192 215
502 3300026089 Ga0207648_10337228 Ga0207648_103372282 215
503 3300026095 Ga0207676_10002699 Ga0207676_100026999 215
504 3300026095 Ga0207676_10018266 Ga0207676_100182664 215
505 3300026095 Ga0207676_10029671 Ga0207676_100296713 215
506 3300026095 Ga0207676_10066501 Ga0207676_100665013 215
507 3300026095 Ga0207676_10476556 Ga0207676_104765562 215
508 3300026095 Ga0207676_10638197 Ga0207676_106381972 215
509 3300026116 Ga0207674_10060222 Ga0207674_100602224 215
510 3300026116 Ga0207674_10293199 Ga0207674_102931992 215
511 3300026118 Ga0207675_100002511 Ga0207675_10000251116 215
512 3300026118 Ga0207675_100018129 Ga0207675_1000181291 215
513 3300026118 Ga0207675_100079277 Ga0207675_1000792772 215
514 3300026118 Ga0207675_100190784 Ga0207675_1001907842 215
515 3300026118 Ga0207675_100212811 Ga0207675_1002128112 215
516 3300026121 Ga0207683_10028632 Ga0207683_100286324 215
517 3300026121 Ga0207683_10066783 Ga0207683_100667832 215
518 3300026121 Ga0207683_10083050 Ga0207683_100830502 215
519 3300026121 Ga0207683_10262310 Ga0207683_102623102 215
520 3300026121 Ga0207683_10285400 Ga0207683_102854002 215
521 3300026121 Ga0207683_10349818 Ga0207683_103498182 215
522 3300026142 Ga0207698_10014722 Ga0207698_100147224 215
523 3300026142 Ga0207698_10095019 Ga0207698_100950193 215
524 3300026142 Ga0207698_10164835 Ga0207698_101648352 215
525 3300026142 Ga0207698_10380232 Ga0207698_103802322 215
526 3300026142 Ga0207698_10446677 Ga0207698_104466771 215
527 3300027111 Ga0209281_1000454 Ga0209281_100045426 215
528 3300028380 Ga0268265_10035164 Ga0268265_100351643 215
529 3300028380 Ga0268265_10062352 Ga0268265_100623522 215
530 3300028380 Ga0268265_10095674 Ga0268265_100956743 215
531 3300028381 Ga0268264_10001585 Ga0268264_1000158510 215
532 3300028381 Ga0268264_10004874 Ga0268264_100048746 215
533 3300028381 Ga0268264_10242966 Ga0268264_102429662 215
534 3300028381 Ga0268264_10344600 Ga0268264_103446001 215
535 3300028786 Ga0307517_10059170 Ga0307517_100591702 215
536 3300028794 Ga0307515_10020164 Ga0307515_100201645 215
537 3300028794 Ga0307515_10094534 Ga0307515_100945341 215
538 3300028794 Ga0307515_10214253 Ga0307515_102142532 215
539 3300030522 Ga0307512_10077698 Ga0307512_100776983 215
540 3300031239 Ga0265328_10059482 Ga0265328_100594822 215
541 3300031251 Ga0265327_10061279 Ga0265327_100612793 215
542 3300031456 Ga0307513_10012208 Ga0307513_100122084 215
543 3300031456 Ga0307513_10036776 Ga0307513_100367763 215
544 3300031456 Ga0307513_10082308 Ga0307513_100823083 215
545 3300031507 Ga0307509_10016899 Ga0307509_100168995 215
546 3300031507 Ga0307509_10095855 Ga0307509_100958553 215
547 3300031507 Ga0307509_10318850 Ga0307509_103188502 215
548 3300031548 Ga0307408_100565212 Ga0307408_1005652122 215
549 3300031616 Ga0307508_10000140 Ga0307508_1000014036 215
550 3300031616 Ga0307508_10002494 Ga0307508_100024946 215
551 3300031616 Ga0307508_10002594 Ga0307508_100025949 215
552 3300031616 Ga0307508_10023375 Ga0307508_100233754 215
553 3300031649 Ga0307514_10171368 Ga0307514_101713682 215
554 3300031730 Ga0307516_10001367 Ga0307516_1000136727 215
555 3300031730 Ga0307516_10450473 Ga0307516_104504732 215
556 3300031731 Ga0307405_10002079 Ga0307405_100020793 215
557 3300031731 Ga0307405_10303228 Ga0307405_103032282 215
558 3300031824 Ga0307413_10229201 Ga0307413_102292012 215
559 3300031852 Ga0307410_10091829 Ga0307410_100918293 215
560 3300031901 Ga0307406_10396714 Ga0307406_103967142 215
561 3300031911 Ga0307412_10042851 Ga0307412_100428512 215
562 3300031995 Ga0307409_100010869 Ga0307409_1000108693 215
563 3300032002 Ga0307416_100010522 Ga0307416_1000105222 215
564 3300032002 Ga0307416_100298896 Ga0307416_1002988962 215
565 3300032004 Ga0307414_10416130 Ga0307414_104161302 215
566 3300033179 Ga0307507_10031471 Ga0307507_100314712 215
567 3300033179 Ga0307507_10099452 Ga0307507_100994522 215
568 3300033180 Ga0307510_10035300 Ga0307510_100353004 215
569 3300034818 Ga0373950_0020532 Ga0373950_0020532_166_825 215
570 3300035088 Ga0373940_0106463 Ga0373940_0106463_59_718 215
571 3300035111 Ga0373923_0088198 Ga0373923_0088198_111_770 215
572 3300035111 Ga0373923_0150161 Ga0373923_0150161_199_846 215
573 3300035112 Ga0373932_0026400 Ga0373932_0026400_791_1450 215
574 3300035112 Ga0373932_0136214 Ga0373932_0136214_132_779 215
575 3300035114 Ga0373939_0010079 Ga0373939_0010079_443_1102 215
576 3300035116 Ga0373945_0155260 Ga0373945_0155260_98_745 215
577 3300035118 Ga0373954_0036049 Ga0373954_0036049_1519_2178 215
578 3300035170 Ga0373943_0037525 Ga0373943_0037525_1448_2107 215
579 3300035170 Ga0373943_0449363 Ga0373943_0449363_14_661 215
580 3300035172 Ga0373955_0169413 Ga0373955_0169413_584_1231 215
581 3300035691 Ga0373931_0009527 Ga0373931_0009527_1867_2526 215
582 3300035725 Ga0373947_0034410 Ga0373947_0034410_1489_2136 215
583 3300036401 Ga0373937_0551889 Ga0373937_0551889_345_992 215
584 3300036401 Ga0373937_0683092 Ga0373937_0683092_245_892 215
585 3300037068 Ga0373925_0002050 Ga0373925_0002050_3199_3846 215
586 3300037068 Ga0373925_0018803 Ga0373925_0018803_308_955 215
587 3300037068 Ga0373925_0064335 Ga0373925_0064335_1374_2021 215
588 3300037471 Ga0395905_0102984 Ga0395905_0102984_1658_2320 215
589 3300039437 Ga0436365_0483654 Ga0436365_0483654_908_1567 215
590 3300041452 Ga0451793_0214308 Ga0451793_0214308_249_896 215
591 3300041456 Ga0451795_0209198 Ga0451795_0209198_152_799 215
592 3300041512 Ga0451853_1017854 Ga0451853_1017854_1870_2517 215
593 3300041512 Ga0451853_3243327 Ga0451853_3243327_346_1011 215
594 3300042012 Ga0439455_0034325 Ga0439455_0034325_304_954 215
595 3300042134 Ga0450898_020290 Ga0450898_020290_344_1006 215
596 3300044735 Ga0466968_0010618 Ga0466968_0010618_814_1467 215
597 3300045051 Ga0451576_0176990 Ga0451576_0176990_231_890 215
598 3300046459 Ga0495629_0202920 Ga0495629_0202920_599_1258 215
599 3300046460 Ga0495638_0098925 Ga0495638_0098925_951_1598 215
600 3300046473 Ga0495582_0047911 Ga0495582_0047911_1165_1812 215
601 3300046473 Ga0495582_0100993 Ga0495582_0100993_473_1120 215
602 3300046475 Ga0495639_0186330 Ga0495639_0186330_246_905 215
603 3300046506 Ga0495583_0112415 Ga0495583_0112415_379_1026 215
604 3300046511 Ga0495608_0122921 Ga0495608_0122921_269_928 215
605 3300046513 Ga0495616_0141655 Ga0495616_0141655_225_872 215
606 3300046517 Ga0495630_0210803 Ga0495630_0210803_357_1016 215
607 3300046519 Ga0495632_0010620 Ga0495632_0010620_694_1341 215
608 3300046519 Ga0495632_0014268 Ga0495632_0014268_3093_3752 215
609 3300046535 Ga0495586_0010100 Ga0495586_0010100_451_1098 215
610 3300046539 Ga0495621_0043281 Ga0495621_0043281_727_1374 215
611 3300046542 Ga0495597_0023049 Ga0495597_0023049_1587_2246 215
612 3300046615 Ga0495656_0226443 Ga0495656_0226443_192_839 215
613 3300046616 Ga0495668_0365057 Ga0495668_0365057_77_736 215
614 3300046660 Ga0495625_0112700 Ga0495625_0112700_425_1072 215
615 3300046663 Ga0495635_0287995 Ga0495635_0287995_142_789 215
616 3300046678 Ga0495599_0171209 Ga0495599_0171209_456_1115 215
617 3300046681 Ga0495647_0252674 Ga0495647_0252674_89_736 215
618 3300046683 Ga0495658_0008156 Ga0495658_0008156_2412_3059 215
619 3300046683 Ga0495658_0058485 Ga0495658_0058485_1349_2008 215
620 3300046683 Ga0495658_0084402 Ga0495658_0084402_797_1444 215
621 3300046683 Ga0495658_0091762 Ga0495658_0091762_463_1110 215
622 3300046683 Ga0495658_0099971 Ga0495658_0099971_832_1479 215
623 3300046689 Ga0495613_0189448 Ga0495613_0189448_463_1110 215
624 3300046692 Ga0495671_0023643 Ga0495671_0023643_1862_2509 215
625 3300046694 Ga0495649_0002061 Ga0495649_0002061_1499_2158 215
626 3300047319 Ga0495674_0224707 Ga0495674_0224707_524_1183 215
627 3300047443 Ga0495687_002698 Ga0495687_002698_507_1166 215
628 3300047471 Ga0495684_0153217 Ga0495684_0153217_807_1454 215
629 3300047471 Ga0495684_0176233 Ga0495684_0176233_259_918 215
630 3300048089 Ga0495614_0091752 Ga0495614_0091752_361_1008 215
631 3300048903 Ga0496100_0042521 Ga0496100_0042521_577_1236 215
632 3300048904 Ga0496101_0076512 Ga0496101_0076512_1361_2020 215
633 3300048904 Ga0496101_0616567 Ga0496101_0616567_63_710 215
634 3300048905 Ga0496102_0047870 Ga0496102_0047870_1433_2092 215
635 3300048906 Ga0496103_0301411 Ga0496103_0301411_348_1007 215
636 3300048907 Ga0496104_0155059 Ga0496104_0155059_575_1222 215
637 3300048908 Ga0496105_0089172 Ga0496105_0089172_1780_2439 215
638 3300048908 Ga0496105_0109224 Ga0496105_0109224_835_1482 215
639 3300048909 Ga0496106_0009675 Ga0496106_0009675_1547_2206 215
640 3300048909 Ga0496106_0699925 Ga0496106_0699925_60_707 215
641 3300048910 Ga0496107_0033571 Ga0496107_0033571_1662_2321 215
642 3300048911 Ga0496108_0042916 Ga0496108_0042916_1870_2529 215
643 3300048911 Ga0496108_0114612 Ga0496108_0114612_753_1400 215
644 3300048911 Ga0496108_0270411 Ga0496108_0270411_598_1257 215
645 3300048911 Ga0496108_0362980 Ga0496108_0362980_565_1248 215
646 3300048912 Ga0496109_0071475 Ga0496109_0071475_44_727 215
647 3300048912 Ga0496109_0147834 Ga0496109_0147834_1085_1744 215
648 3300048912 Ga0496109_0549562 Ga0496109_0549562_370_1017 215
649 3300048913 Ga0496110_0019345 Ga0496110_0019345_263_922 215
650 3300048913 Ga0496110_0061842 Ga0496110_0061842_2277_2960 215
651 3300048913 Ga0496110_0158563 Ga0496110_0158563_274_921 215
652 3300048914 Ga0496111_0066099 Ga0496111_0066099_1443_2102 215
653 3300048915 Ga0496112_0009035 Ga0496112_0009035_7618_8301 215
654 3300048916 Ga0496113_0127874 Ga0496113_0127874_500_1159 215
655 3300048917 Ga0496114_0086981 Ga0496114_0086981_1708_2367 215
656 3300048917 Ga0496114_0565929 Ga0496114_0565929_81_728 215
657 3300048924 Ga0496121_0044818 Ga0496121_0044818_2586_3242 215
658 3300048927 Ga0496124_0018411 Ga0496124_0018411_5184_5840 215
659 3300048928 Ga0496125_0008691 Ga0496125_0008691_3963_4619 215
660 3300050489 nmdc:mga03683_1375_c1 nmdc:mga03683_1375_c1_4104_4751 215
661 3300050489 nmdc:mga03683_14349_c1 nmdc:mga03683_14349_c1_1908_2555 215
662 3300050489 nmdc:mga03683_81638_c1 nmdc:mga03683_81638_c1_229_876 215
663 3300050490 nmdc:mga03n38_101530_c1 nmdc:mga03n38_101530_c1_147_794 215
664 3300050490 nmdc:mga03n38_10498_c1 nmdc:mga03n38_10498_c1_323_970 215
665 3300050490 nmdc:mga03n38_49835_c1 nmdc:mga03n38_49835_c1_793_1443 215
666 3300050490 nmdc:mga03n38_83803_c1 nmdc:mga03n38_83803_c1_673_1320 215
667 3300050491 nmdc:mga00v17_35885_c1 nmdc:mga00v17_35885_c1_1698_2345 215
668 3300050491 nmdc:mga00v17_70495_c1 nmdc:mga00v17_70495_c1_1390_2037 215
669 3300050492 nmdc:mga0yw44_13996_c1 nmdc:mga0yw44_13996_c1_670_1317 215
670 3300050492 nmdc:mga0yw44_615477_c1 nmdc:mga0yw44_615477_c1_71_718 215
671 3300050493 nmdc:mga0k408_126403_c1 nmdc:mga0k408_126403_c1_285_941 215
672 3300050493 nmdc:mga0k408_298_c1 nmdc:mga0k408_298_c1_14932_15591 215
673 3300050493 nmdc:mga0k408_323886_c1 nmdc:mga0k408_323886_c1_103_750 215
674 3300050493 nmdc:mga0k408_33293_c1 nmdc:mga0k408_33293_c1_1935_2582 215
675 3300050493 nmdc:mga0k408_41470_c1 nmdc:mga0k408_41470_c1_1259_1906 215
676 3300050493 nmdc:mga0k408_44081_c1 nmdc:mga0k408_44081_c1_1428_2078 215
677 3300050493 nmdc:mga0k408_791_c1 nmdc:mga0k408_791_c1_14674_15321 215
678 3300050494 nmdc:mga06z11_315376_c1 nmdc:mga06z11_315376_c1_140_787 215
679 3300050494 nmdc:mga06z11_3754_c1 nmdc:mga06z11_3754_c1_4347_4994 215
680 3300050495 nmdc:mga04h51_117335_c1 nmdc:mga04h51_117335_c1_33_680 215
681 3300050496 nmdc:mga07m45_1450_c1 nmdc:mga07m45_1450_c1_572_1219 215
682 3300050496 nmdc:mga07m45_17067_c1 nmdc:mga07m45_17067_c1_2456_3103 215
683 3300050496 nmdc:mga07m45_27438_c1 nmdc:mga07m45_27438_c1_1938_2585 215
684 3300050496 nmdc:mga07m45_410_c1 nmdc:mga07m45_410_c1_6771_7418 215
685 3300050496 nmdc:mga07m45_53099_c1 nmdc:mga07m45_53099_c1_463_1110 215
686 3300050507 nmdc:mga05p37_213124_c1 nmdc:mga05p37_213124_c1_1194_1847 215
687 3300050508 nmdc:mga09592_8800_c1 nmdc:mga09592_8800_c1_2585_3232 215
688 3300050509 nmdc:mga0qj67_46651_c1 nmdc:mga0qj67_46651_c1_2417_3064 215
689 3300050511 nmdc:mga08y16_439247_c1 nmdc:mga08y16_439247_c1_164_811 215
690 3300050516 nmdc:mga0sz30_28770_c1 nmdc:mga0sz30_28770_c1_1629_2276 215
691 3300050516 nmdc:mga0sz30_83374_c1 nmdc:mga0sz30_83374_c1_334_981 215
692 3300053084 Ga0495595_0142503 Ga0495595_0142503_85_744 215
693 3300053085 Ga0495619_0351664 Ga0495619_0351664_271_918 215
694 3300053093 Ga0500651_0012618 Ga0500651_0012618_3387_4034 215
695 3300053098 Ga0500650_0017430 Ga0500650_0017430_2059_2706 215
696 3300053098 Ga0500650_0064020 Ga0500650_0064020_417_1064 215
697 3300053109 Ga0500569_005309 Ga0500569_005309_213_860 215
698 3300053121 Ga0500607_145452 Ga0500607_145452_141_788 215
699 3300053129 Ga0500628_002165 Ga0500628_002165_975_1622 215
700 3300053130 Ga0500642_0041636 Ga0500642_0041636_721_1368 215
701 3300053130 Ga0500642_0119995 Ga0500642_0119995_167_814 215
702 3300053131 Ga0500652_008946 Ga0500652_008946_588_1235 215
703 3300053142 Ga0500577_0198743 Ga0500577_0198743_71_718 215
704 3300053148 Ga0500590_047089 Ga0500590_047089_277_924 215
705 3300053156 Ga0500622_0005574 Ga0500622_0005574_2124_2771 215
706 3300053177 Ga0500636_0072809 Ga0500636_0072809_146_793 215

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00697

PRAI

N-(5'phosphoribosyl)anthranilate (PRA) isomerase

27

222

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1dl3-assembly1.cif.gz_A crystal structure of mutually generated monomers of dimeric phosphoribosylantranilate isomerase from thermotoga maritima 0.9345 5 204
1lbm-assembly1.cif.gz_A crystal structure of phosphoribosyl anthranilate isomerase (prai) in complex with reduced 1-(o-carboxyphenylamino)-1-deoxyribulose 5-phosphate (rcdrp) 0.9315 5 205
1dl3-assembly2.cif.gz_B crystal structure of mutually generated monomers of dimeric phosphoribosylantranilate isomerase from thermotoga maritima 0.9263 5 205
1nsj-assembly1.cif.gz_A-2 crystal structure of phosphoribosyl anthranilate isomerase from thermotoga maritima 0.9256 5 205
1lbm-assembly1.cif.gz_A crystal structure of phosphoribosyl anthranilate isomerase (prai) in complex with reduced 1-(o-carboxyphenylamino)-1-deoxyribulose 5-phosphate (rcdrp) 0.9176 5 205
ID Description Score Start End Superfamily
1dl3A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9345 5 204 3.20.20.70
1dl3A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9157 5 204 3.20.20.70
af_Q2FYR5_1_206_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8886 5 204 3.20.20.70
1v5xB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8821 5 205 3.20.20.70
af_P00909_260_447_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8811 10 199 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A3C0K872-F1-model_v4 N-(5'-phosphoribosyl)anthranilate isomerase (EC 5.3.1.24) 0.9972 4 103 GO:0000162
GO:0004640
GO:0006568
AF-A0A7Y6NLA1-F1-model_v4 N-(5'-phosphoribosyl)anthranilate isomerase (PRAI) (EC 5.3.1.24) 0.993 1 212 GO:0000162
GO:0004640
GO:0006568
AF-A0A0K8P1R1-F1-model_v4 N-(5'-phosphoribosyl)anthranilate isomerase (PRAI) (EC 5.3.1.24) 0.9879 3 215 GO:0000162
GO:0004640
GO:0006568
AF-A0A521YU25-F1-model_v4 N-(5'-phosphoribosyl)anthranilate isomerase (EC 5.3.1.24) 0.9859 4 143 GO:0000162
GO:0004640
GO:0006568
AF-A0A431MMR7-F1-model_v4 N-(5'-phosphoribosyl)anthranilate isomerase (PRAI) (EC 5.3.1.24) 0.983 1 207 GO:0000162
GO:0004640
GO:0006568

Feature Viewer

pLDDT pTM Quality
92.65 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map