F476408

General Info

Members Datasets Scaffolds Average Seq Length
705 329 695 281

Family's Representative Sequence

Representative Sequence 3300029957|Ga0265324_10009208|Ga0265324_100092083
Length 316
Sequence MVGWPVPCLPQLTMQPTVINPTLPTVPRRSTSESAAVRWLLIGTALAFMGLFLVLPLVSVFIQAFGKGLGFYLHMLADPLTLSALKLTVIAAAFAVPLNCVFGVAAAWAITKFDFRGKQLLLTLIDLPFSVSPVISGLIYVLVFGLQGWLGQYENADHPWFPWFQNWLNNHDIKIIFAVPGIVLATIFVTFPFVARELIPLMEAQGKSEEEAARVLGASGWQIFWRVTMPNIKWGLLYGVILCNARAMGEFGAVSVVSGHIRGVTDTLPLHIEVLYNEYNFTGAFAVASLLSLLGLVTLVVKSWVEYKNAAESPEA

Samples

Sample ID Description Type Environment
1 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
2 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
3 2671180694 Paenibacillus sp. A3 Isolate Unclassified
4 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
5 2734482264 Dyella sp. AD052 Isolate Unclassified
6 2738543009 Luteibacter sp. OK325 Isolate Unclassified
7 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
8 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
9 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
10 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
11 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
12 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
13 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
14 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
15 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
16 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
17 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
18 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
19 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
32 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
33 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
44 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
45 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
54 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
61 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
75 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
81 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
104 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
105 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
117 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
118 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
119 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
120 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
121 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
127 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
128 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
129 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
132 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
133 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
135 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
137 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
139 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
198 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
199 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
200 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
201 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
202 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
203 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
204 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
205 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
206 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
207 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
208 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
209 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
210 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
211 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
212 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
213 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
214 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
215 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
216 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
217 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
218 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
219 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
220 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
221 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
222 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
223 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
224 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
225 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
226 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
227 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
228 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
229 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
230 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
231 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
232 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
233 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
234 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
235 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
236 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
237 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
238 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
239 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
240 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
241 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
242 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
243 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
244 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
245 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
246 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
247 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
248 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
249 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
250 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
251 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
252 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
253 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
254 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
255 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
256 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
257 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
258 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
259 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
260 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
261 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
262 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
263 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
264 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
265 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
266 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
267 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
268 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
269 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
270 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
271 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
272 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
273 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
274 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
275 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
276 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
277 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
278 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
279 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
280 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
281 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
282 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
283 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
284 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
285 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
286 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
287 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
288 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
289 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
290 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
291 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
292 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
293 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
305 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
306 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
307 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
308 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
309 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
310 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
311 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
312 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
313 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
315 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
316 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
317 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
318 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
319 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
320 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
321 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
322 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
323 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
324 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
325 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
326 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
327 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
328 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
329 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.73
Metatranscriptomes 0.85
Isolates 1.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.11
Nodule 0.14
Rhizoplane 2.41
Rhizosphere 90.92
Stem 0
Stem Tuber 0
Unclassified 2.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1002176 3300001915 Bacteria 5206
2 JGI24741J21665_1003052 3300001915 Bacteria 4130
3 JGI24741J21665_1004654 3300001915 Bacteria 2998
4 JGI24740J21852_10000633 3300001979 Bacteria 15172
5 JGI24740J21852_10000975 3300001979 Bacteria 12770
6 JGI25162J39368_1000871 3300002737 Bacteria 19773
7 JGI25164J39214_1000476 3300002772 Bacteria 19773
8 JGI25165J46597_1000080 3300003214 Bacteria 176649
9 JGI25165J46597_1000591 3300003214 Bacteria 31247
10 rootH1_10003874 3300003316 Bacteria 1617
11 Ga0055533_1000043 3300003756 Bacteria 229262
12 Ga0055533_1000667 3300003756 Bacteria 11379
13 Ga0055525_1001369 3300003759 Bacteria 4668
14 Ga0058861_11977762 3300004800 Bacteria 1022
15 Ga0070658_10046904 3300005327 Bacteria 3496
16 Ga0070658_10087981 3300005327 Bacteria 2557
17 Ga0070658_10151442 3300005327 Bacteria 1942
18 Ga0070676_10067770 3300005328 Bacteria 2135
19 Ga0070683_100016971 3300005329 Bacteria 6426
20 Ga0070683_100302830 3300005329 Bacteria 1521
21 Ga0070690_100021725 3300005330 Bacteria 3921
22 Ga0070690_100205882 3300005330 Bacteria 1371
23 Ga0070670_100000010 3300005331 Bacteria 277365
24 Ga0070670_100011884 3300005331 Bacteria 7445
25 Ga0070670_100099465 3300005331 Bacteria 2503
26 Ga0070670_100136041 3300005331 Bacteria 2123
27 Ga0070677_10028238 3300005333 Bacteria 2118
28 Ga0070666_10001402 3300005335 Bacteria 14566
29 Ga0070666_10070951 3300005335 Bacteria 2370
30 Ga0070680_100004255 3300005336 Bacteria 10748
31 Ga0070680_100005902 3300005336 Bacteria 9301
32 Ga0070680_100218960 3300005336 Bacteria 1606
33 Ga0070682_100005201 3300005337 Bacteria 7239
34 Ga0070682_100038340 3300005337 Bacteria 2939
35 Ga0070682_100056911 3300005337 Bacteria 2461
36 Ga0070682_100339492 3300005337 Bacteria 1116
37 Ga0068868_100009112 3300005338 Bacteria 7126
38 Ga0070660_100004136 3300005339 Bacteria 10017
39 Ga0070660_100165700 3300005339 Bacteria 1783
40 Ga0070660_100182697 3300005339 Bacteria 1697
41 Ga0070689_100004487 3300005340 Bacteria 9440
42 Ga0070691_10006919 3300005341 Bacteria 5190
43 Ga0070691_10214288 3300005341 Bacteria 1017
44 Ga0070687_100003573 3300005343 Bacteria 6059
45 Ga0070661_100261996 3300005344 Bacteria 1337
46 Ga0070692_10005282 3300005345 Bacteria 5485
47 Ga0070692_10083577 3300005345 Bacteria 1724
48 Ga0070668_100008773 3300005347 Bacteria 7508
49 Ga0070669_100004868 3300005353 Bacteria 9689
50 Ga0070675_100002590 3300005354 Bacteria 13558
51 Ga0070675_100020130 3300005354 Bacteria 5324
52 Ga0070675_100220854 3300005354 Bacteria 1650
53 Ga0070671_100011411 3300005355 Bacteria 7144
54 Ga0070673_100005879 3300005364 Bacteria 7913
55 Ga0070659_100089929 3300005366 Bacteria 2460
56 Ga0070659_100540755 3300005366 Bacteria 996
57 Ga0070667_100003252 3300005367 Bacteria 13886
58 Ga0070667_100039804 3300005367 Bacteria 3940
59 Ga0070714_100000020 3300005435 Bacteria 169262
60 Ga0070714_100025366 3300005435 Bacteria 4892
61 Ga0070711_100007824 3300005439 Bacteria 6513
62 Ga0070705_100011094 3300005440 Bacteria 4533
63 Ga0070700_100021791 3300005441 Bacteria 3728
64 Ga0070700_100083151 3300005441 Bacteria 2072
65 Ga0070694_100034546 3300005444 Bacteria 3335
66 Ga0070663_100002230 3300005455 Bacteria 10844
67 Ga0070663_100011142 3300005455 Bacteria 5630
68 Ga0070663_100235751 3300005455 Bacteria 1442
69 Ga0070678_100022994 3300005456 Bacteria 4145
70 Ga0070678_100028588 3300005456 Bacteria 3805
71 Ga0070662_100004570 3300005457 Bacteria 8764
72 Ga0070662_100178547 3300005457 Bacteria 1672
73 Ga0070681_10004454 3300005458 Bacteria 13341
74 Ga0070681_10030948 3300005458 Bacteria 5372
75 Ga0070681_10078792 3300005458 Bacteria 3252
76 Ga0070681_10120607 3300005458 Bacteria 2557
77 Ga0070681_10123174 3300005458 Bacteria 2525
78 Ga0070681_10142810 3300005458 Bacteria 2323
79 Ga0068867_100006452 3300005459 Bacteria 8283
80 Ga0068867_100015082 3300005459 Bacteria 5479
81 Ga0070685_10008770 3300005466 Bacteria 5207
82 Ga0070698_100166169 3300005471 Bacteria 2150
83 Ga0070679_100004157 3300005530 Bacteria 13341
84 Ga0070679_100017484 3300005530 Bacteria 6941
85 Ga0070679_100043671 3300005530 Bacteria 4463
86 Ga0070679_100055385 3300005530 Bacteria 3949
87 Ga0070679_100132245 3300005530 Bacteria 2476
88 Ga0070684_100014623 3300005535 Bacteria 6365
89 Ga0070684_100112339 3300005535 Bacteria 2444
90 Ga0070697_100069906 3300005536 Bacteria 2877
91 Ga0068853_100005744 3300005539 Bacteria 9766
92 Ga0068853_100063692 3300005539 Bacteria 3194
93 Ga0068853_100074261 3300005539 Bacteria 2967
94 Ga0070672_100001996 3300005543 Bacteria 12809
95 Ga0070672_100005492 3300005543 Bacteria 8407
96 Ga0070672_100120122 3300005543 Bacteria 2150
97 Ga0070672_100205301 3300005543 Bacteria 1649
98 Ga0070672_100540562 3300005543 Bacteria 1011
99 Ga0070696_100013276 3300005546 Bacteria 5525
100 Ga0070696_100054776 3300005546 Bacteria 2780
101 Ga0070693_100000948 3300005547 Bacteria 12879
102 Ga0070693_100013748 3300005547 Bacteria 4131
103 Ga0070665_100696753 3300005548 Bacteria 1029
104 Ga0070704_100102446 3300005549 Bacteria 2160
105 Ga0068855_100004225 3300005563 Bacteria 17534
106 Ga0068855_100019435 3300005563 Bacteria 8162
107 Ga0068855_100126419 3300005563 Bacteria 2923
108 Ga0068855_100347814 3300005563 Bacteria 1633
109 Ga0070664_100146368 3300005564 Bacteria 2084
110 Ga0070664_100178543 3300005564 Bacteria 1886
111 Ga0070664_100298477 3300005564 Bacteria 1455
112 Ga0070664_100425598 3300005564 Bacteria 1217
113 Ga0070664_100575969 3300005564 Bacteria 1043
114 Ga0068857_100004590 3300005577 Bacteria 11694
115 Ga0068857_100019781 3300005577 Bacteria 5915
116 Ga0068857_100160240 3300005577 Bacteria 2041
117 Ga0068856_100000400 3300005614 Bacteria 47424
118 Ga0068856_100087084 3300005614 Bacteria 3104
119 Ga0068856_100131680 3300005614 Bacteria 2506
120 Ga0070702_100052808 3300005615 Bacteria 2332
121 Ga0068852_100002597 3300005616 Bacteria 12479
122 Ga0068852_100404522 3300005616 Bacteria 1343
123 Ga0068859_100028230 3300005617 Bacteria 5625
124 Ga0068864_100104976 3300005618 Bacteria 2511
125 Ga0068864_100166800 3300005618 Bacteria 2005
126 Ga0068864_100214588 3300005618 Bacteria 1773
127 Ga0068864_100632456 3300005618 Bacteria 1041
128 Ga0068866_10053389 3300005718 Bacteria 2066
129 Ga0068866_10093540 3300005718 Bacteria 1642
130 Ga0068861_100097724 3300005719 Bacteria 2330
131 Ga0068861_100258396 3300005719 Bacteria 1490
132 Ga0068861_100508312 3300005719 Bacteria 1090
133 Ga0068851_10052235 3300005834 Bacteria 2078
134 Ga0068851_10149980 3300005834 Bacteria 1274
135 Ga0068870_10135326 3300005840 Bacteria 1436
136 Ga0068863_100015935 3300005841 Bacteria 7209
137 Ga0068863_100267206 3300005841 Bacteria 1655
138 Ga0068858_100014648 3300005842 Bacteria 7385
139 Ga0068860_100001260 3300005843 Bacteria 27630
140 Ga0068860_100015154 3300005843 Bacteria 7531
141 Ga0068860_100112190 3300005843 Bacteria 2607
142 Ga0068860_100667781 3300005843 Bacteria 1048
143 Ga0068862_100020918 3300005844 Bacteria 5466
144 Ga0068862_100580744 3300005844 Bacteria 1074
145 Ga0081538_10003893 3300005981 Bacteria 13942
146 Ga0075364_10059375 3300006051 Bacteria 2507
147 Ga0097621_100007337 3300006237 Bacteria 7881
148 Ga0097621_100053668 3300006237 Bacteria 3285
149 Ga0097621_100111291 3300006237 Bacteria 2314
150 Ga0097621_100166980 3300006237 Bacteria 1895
151 Ga0097621_100236125 3300006237 Bacteria 1597
152 Ga0068871_100025405 3300006358 Bacteria 4609
153 Ga0068871_100084481 3300006358 Bacteria 2634
154 Ga0068871_100113169 3300006358 Bacteria 2285
155 Ga0075433_10017300 3300006852 Bacteria 5968
156 Ga0075434_100001633 3300006871 Bacteria 19087
157 Ga0068865_100003521 3300006881 Bacteria 9386
158 Ga0068865_100039024 3300006881 Bacteria 3219
159 Ga0068865_100062498 3300006881 Bacteria 2614
160 Ga0068865_100082760 3300006881 Bacteria 2308
161 Ga0075436_100156370 3300006914 Bacteria 1606
162 Ga0075436_100353419 3300006914 Bacteria 1059
163 Ga0097620_100028228 3300006931 Bacteria 5625
164 Ga0075435_100035677 3300007076 Bacteria 3947
165 Ga0105240_10001676 3300009093 Bacteria 37586
166 Ga0105240_10073822 3300009093 Bacteria 4212
167 Ga0105240_10100373 3300009093 Bacteria 3522
168 Ga0105240_10251256 3300009093 Bacteria 2045
169 Ga0105240_10336732 3300009093 Bacteria 1715
170 Ga0111539_10012876 3300009094 Bacteria 10468
171 Ga0111539_10111025 3300009094 Bacteria 3217
172 Ga0111539_10142886 3300009094 Bacteria 2802
173 Ga0105245_10160243 3300009098 Bacteria 2134
174 Ga0105245_10411442 3300009098 Bacteria 1354
175 Ga0105247_10061763 3300009101 Bacteria 2323
176 Ga0105247_10095814 3300009101 Bacteria 1890
177 Ga0105243_10008704 3300009148 Bacteria 7781
178 Ga0105243_10081167 3300009148 Bacteria 2647
179 Ga0105241_10001696 3300009174 Bacteria 16746
180 Ga0105241_10012353 3300009174 Bacteria 6263
181 Ga0105241_10097829 3300009174 Bacteria 2327
182 Ga0105241_10127040 3300009174 Bacteria 2060
183 Ga0105241_10186925 3300009174 Bacteria 1722
184 Ga0105241_10259485 3300009174 Bacteria 1476
185 Ga0105242_10008496 3300009176 Bacteria 7886
186 Ga0105242_10023556 3300009176 Bacteria 4851
187 Ga0105242_10123992 3300009176 Bacteria 2221
188 Ga0105242_10280733 3300009176 Bacteria 1512
189 Ga0105242_10284951 3300009176 Bacteria 1502
190 Ga0105242_10291619 3300009176 Bacteria 1486
191 Ga0105248_10000001 3300009177 Bacteria 1881304
192 Ga0105248_10207268 3300009177 Bacteria 2209
193 Ga0105248_10276378 3300009177 Bacteria 1891
194 Ga0105248_10679427 3300009177 Bacteria 1162
195 Ga0105248_10806235 3300009177 Bacteria 1060
196 Ga0105237_10046750 3300009545 Bacteria 4353
197 Ga0105237_10114647 3300009545 Bacteria 2688
198 Ga0105238_10009736 3300009551 Bacteria 9624
199 Ga0105238_10017135 3300009551 Bacteria 7354
200 Ga0105238_10043434 3300009551 Bacteria 4548
201 Ga0105238_10044626 3300009551 Bacteria 4481
202 Ga0105238_10089051 3300009551 Bacteria 3073
203 Ga0105238_10139765 3300009551 Bacteria 2399
204 Ga0105249_10065053 3300009553 Bacteria 3353
205 Ga0105239_10026373 3300010375 Bacteria 6395
206 Ga0105239_10047517 3300010375 Bacteria 4704
207 Ga0105239_10048947 3300010375 Bacteria 4634
208 Ga0105239_10211780 3300010375 Bacteria 2172
209 Ga0105239_10377856 3300010375 Bacteria 1602
210 Ga0105246_10041703 3300011119 Bacteria 3104
211 Ga0105246_10108142 3300011119 Bacteria 2038
212 Ga0157373_10064238 3300013100 Bacteria 2599
213 Ga0157373_10199881 3300013100 Bacteria 1409
214 Ga0157373_10318311 3300013100 Bacteria 1106
215 Ga0157371_10046698 3300013102 Bacteria 3080
216 Ga0157371_10165609 3300013102 Bacteria 1579
217 Ga0157370_10000778 3300013104 Bacteria 39997
218 Ga0157370_10001994 3300013104 Bacteria 25102
219 Ga0157370_10005673 3300013104 Bacteria 13953
220 Ga0157370_10179040 3300013104 Bacteria 1970
221 Ga0157369_10003370 3300013105 Bacteria 18981
222 Ga0157369_10077733 3300013105 Bacteria 3557
223 Ga0157369_10183991 3300013105 Bacteria 2197
224 Ga0157369_10204052 3300013105 Bacteria 2074
225 Ga0157369_10552465 3300013105 Bacteria 1190
226 Ga0157374_10232846 3300013296 Bacteria 1810
227 Ga0157374_10360700 3300013296 Bacteria 1445
228 Ga0157378_10020487 3300013297 Bacteria 5814
229 Ga0157378_10629721 3300013297 Bacteria 1087
230 Ga0163162_10007061 3300013306 Bacteria 10891
231 Ga0163162_10178908 3300013306 Bacteria 2247
232 Ga0163162_10789966 3300013306 Bacteria 1067
233 Ga0157372_10009410 3300013307 Bacteria 10393
234 Ga0157372_10142858 3300013307 Bacteria 2759
235 Ga0157375_10046761 3300013308 Bacteria 4222
236 Ga0157375_10129431 3300013308 Bacteria 2642
237 Ga0157375_10289717 3300013308 Bacteria 1800
238 Ga0163163_10181302 3300014325 Bacteria 2153
239 Ga0157380_10051605 3300014326 Bacteria 3254
240 Ga0157380_10062408 3300014326 Bacteria 2985
241 Ga0157380_10062721 3300014326 Bacteria 2978
242 Ga0182008_10035653 3300014497 Bacteria 2490
243 Ga0157379_10008941 3300014968 Bacteria 8731
244 Ga0157379_10372529 3300014968 Bacteria 1309
245 Ga0157376_10033093 3300014969 Bacteria 4158
246 Ga0157376_10122498 3300014969 Bacteria 2307
247 Ga0157376_10479691 3300014969 Bacteria 1218
248 Ga0182006_1000005 3300015261 Bacteria 621201
249 Ga0182005_1010468 3300015265 Bacteria 2667
250 Ga0183368_1004 3300015687 Bacteria 1211761
251 Ga0163161_10001704 3300017792 Bacteria 16131
252 Ga0163161_10019256 3300017792 Bacteria 4786
253 Ga0163161_10037506 3300017792 Bacteria 3475
254 Ga0206356_10310333 3300020070 Bacteria 5473
255 Ga0206352_10691678 3300020078 Bacteria 1975
256 Ga0206354_10374811 3300020081 Bacteria 3062
257 Ga0206353_10342466 3300020082 Bacteria 2013
258 Ga0154015_1173610 3300020610 Bacteria 3811
259 Ga0213872_10000011 3300021361 Bacteria 194139
260 Ga0213872_10000525 3300021361 Bacteria 29968
261 Ga0213872_10001049 3300021361 Bacteria 19233
262 Ga0213872_10006595 3300021361 Bacteria 5791
263 Ga0213872_10011915 3300021361 Bacteria 4105
264 Ga0213876_10000498 3300021384 Bacteria 30587
265 Ga0209435_103741 3300025206 Bacteria 1727
266 Ga0209674_100016 3300025226 Bacteria 696756
267 Ga0209674_100067 3300025226 Bacteria 253824
268 Ga0209563_100068 3300025230 Bacteria 254802
269 Ga0207427_100111 3300025231 Bacteria 112775
270 Ga0207427_104279 3300025231 Bacteria 2478
271 Ga0207427_106258 3300025231 Bacteria 1534
272 Ga0209437_100223 3300025233 Bacteria 102763
273 Ga0209258_101024 3300025242 Bacteria 12600
274 Ga0209646_1010093 3300025246 Bacteria 1487
275 Ga0209677_100049 3300025253 Bacteria 180721
276 Ga0209677_101153 3300025253 Bacteria 12284
277 Ga0209233_1000006 3300025261 Bacteria 1473685
278 Ga0209233_1000272 3300025261 Bacteria 73393
279 Ga0207666_1008580 3300025271 Bacteria 1368
280 Ga0209025_1080404 3300025294 Bacteria 1109
281 Ga0207697_10051159 3300025315 Bacteria 1707
282 Ga0207656_10016237 3300025321 Bacteria 2896
283 Ga0207682_10000873 3300025893 Bacteria 13976
284 Ga0207642_10003560 3300025899 Bacteria 4936
285 Ga0207642_10080270 3300025899 Bacteria 1582
286 Ga0207680_10000525 3300025903 Bacteria 18250
287 Ga0207680_10037775 3300025903 Bacteria 2790
288 Ga0207647_10001393 3300025904 Bacteria 18564
289 Ga0207647_10005236 3300025904 Bacteria 9547
290 Ga0207647_10009247 3300025904 Bacteria 7008
291 Ga0207647_10011267 3300025904 Bacteria 6276
292 Ga0207647_10027938 3300025904 Bacteria 3673
293 Ga0207645_10003406 3300025907 Bacteria 12090
294 Ga0207645_10006705 3300025907 Bacteria 8229
295 Ga0207645_10012060 3300025907 Bacteria 5877
296 Ga0207643_10096926 3300025908 Bacteria 1725
297 Ga0207643_10123898 3300025908 Bacteria 1533
298 Ga0207705_10000089 3300025909 Bacteria 113394
299 Ga0207705_10002720 3300025909 Bacteria 13549
300 Ga0207705_10061090 3300025909 Bacteria 2722
301 Ga0207654_10036699 3300025911 Bacteria 2740
302 Ga0207654_10050298 3300025911 Bacteria 2394
303 Ga0207707_10001152 3300025912 Bacteria 25079
304 Ga0207707_10003824 3300025912 Bacteria 13336
305 Ga0207707_10008190 3300025912 Bacteria 9072
306 Ga0207707_10014155 3300025912 Bacteria 6951
307 Ga0207707_10026761 3300025912 Bacteria 5041
308 Ga0207707_10095721 3300025912 Bacteria 2595
309 Ga0207707_10114643 3300025912 Bacteria 2355
310 Ga0207707_10327333 3300025912 Bacteria 1322
311 Ga0207695_10002354 3300025913 Bacteria 28096
312 Ga0207695_10065151 3300025913 Bacteria 3746
313 Ga0207695_10110997 3300025913 Bacteria 2722
314 Ga0207695_10112260 3300025913 Bacteria 2704
315 Ga0207671_10098074 3300025914 Bacteria 2216
316 Ga0207671_10143383 3300025914 Bacteria 1842
317 Ga0207663_10025052 3300025916 Bacteria 3443
318 Ga0207660_10000311 3300025917 Bacteria 31934
319 Ga0207660_10008400 3300025917 Bacteria 6680
320 Ga0207660_10008420 3300025917 Bacteria 6672
321 Ga0207660_10012966 3300025917 Bacteria 5461
322 Ga0207660_10018270 3300025917 Bacteria 4671
323 Ga0207660_10107715 3300025917 Bacteria 2092
324 Ga0207662_10111956 3300025918 Bacteria 1703
325 Ga0207657_10000654 3300025919 Bacteria 36849
326 Ga0207657_10013655 3300025919 Bacteria 7960
327 Ga0207657_10014891 3300025919 Bacteria 7566
328 Ga0207657_10060782 3300025919 Bacteria 3242
329 Ga0207649_10022015 3300025920 Bacteria 3679
330 Ga0207649_10083812 3300025920 Bacteria 2070
331 Ga0207649_10308604 3300025920 Bacteria 1159
332 Ga0207652_10000117 3300025921 Bacteria 87807
333 Ga0207652_10005226 3300025921 Bacteria 10548
334 Ga0207652_10007462 3300025921 Bacteria 8817
335 Ga0207652_10062375 3300025921 Bacteria 3221
336 Ga0207652_10066093 3300025921 Bacteria 3133
337 Ga0207652_10066575 3300025921 Bacteria 3122
338 Ga0207652_10096273 3300025921 Bacteria 2608
339 Ga0207652_10289390 3300025921 Bacteria 1478
340 Ga0207652_10398028 3300025921 Bacteria 1243
341 Ga0207681_10004364 3300025923 Bacteria 8718
342 Ga0207681_10007115 3300025923 Bacteria 6859
343 Ga0207694_10014090 3300025924 Bacteria 6027
344 Ga0207694_10018692 3300025924 Bacteria 5238
345 Ga0207694_10036656 3300025924 Bacteria 3764
346 Ga0207694_10049082 3300025924 Bacteria 3267
347 Ga0207694_10084206 3300025924 Bacteria 2501
348 Ga0207650_10001175 3300025925 Bacteria 19267
349 Ga0207650_10020978 3300025925 Bacteria 4615
350 Ga0207659_10001653 3300025926 Bacteria 13245
351 Ga0207659_10002446 3300025926 Bacteria 11075
352 Ga0207659_10010409 3300025926 Bacteria 5846
353 Ga0207659_10227087 3300025926 Bacteria 1504
354 Ga0207687_10013262 3300025927 Bacteria 5380
355 Ga0207664_10000023 3300025929 Bacteria 204730
356 Ga0207664_10104343 3300025929 Bacteria 2347
357 Ga0207644_10004577 3300025931 Bacteria 8994
358 Ga0207644_10022651 3300025931 Bacteria 4293
359 Ga0207690_10001386 3300025932 Bacteria 15230
360 Ga0207690_10007323 3300025932 Bacteria 6551
361 Ga0207690_10023064 3300025932 Bacteria 3880
362 Ga0207690_10024720 3300025932 Bacteria 3764
363 Ga0207690_10089298 3300025932 Bacteria 2173
364 Ga0207706_10006952 3300025933 Bacteria 10458
365 Ga0207706_10026518 3300025933 Bacteria 5186
366 Ga0207706_10250431 3300025933 Bacteria 1547
367 Ga0207686_10084115 3300025934 Bacteria 2084
368 Ga0207686_10136582 3300025934 Bacteria 1689
369 Ga0207686_10178503 3300025934 Bacteria 1504
370 Ga0207709_10007930 3300025935 Bacteria 5884
371 Ga0207670_10011987 3300025936 Bacteria 5053
372 Ga0207669_10068361 3300025937 Bacteria 2218
373 Ga0207669_10121610 3300025937 Bacteria 1773
374 Ga0207704_10033169 3300025938 Bacteria 2933
375 Ga0207704_10043983 3300025938 Bacteria 2642
376 Ga0207704_10088623 3300025938 Bacteria 2025
377 Ga0207704_10115295 3300025938 Bacteria 1826
378 Ga0207691_10021975 3300025940 Bacteria 6020
379 Ga0207691_10285957 3300025940 Bacteria 1418
380 Ga0207711_10000001 3300025941 Bacteria 1325674
381 Ga0207711_10028527 3300025941 Bacteria 4697
382 Ga0207711_10070914 3300025941 Bacteria 3022
383 Ga0207711_10321613 3300025941 Bacteria 1430
384 Ga0207689_10018156 3300025942 Bacteria 5939
385 Ga0207661_10037401 3300025944 Bacteria 3796
386 Ga0207661_10135201 3300025944 Bacteria 2116
387 Ga0207661_10138017 3300025944 Bacteria 2096
388 Ga0207661_10317248 3300025944 Bacteria 1400
389 Ga0207679_10118291 3300025945 Bacteria 2104
390 Ga0207679_10169266 3300025945 Bacteria 1797
391 Ga0207679_10428295 3300025945 Bacteria 1169
392 Ga0207667_10005736 3300025949 Bacteria 15149
393 Ga0207667_10008462 3300025949 Bacteria 12220
394 Ga0207667_10017214 3300025949 Bacteria 8143
395 Ga0207667_10029251 3300025949 Bacteria 5976
396 Ga0207667_10037782 3300025949 Bacteria 5160
397 Ga0207667_10051115 3300025949 Bacteria 4358
398 Ga0207651_10001133 3300025960 Bacteria 11888
399 Ga0207651_10250262 3300025960 Bacteria 1449
400 Ga0207712_10003405 3300025961 Bacteria 10053
401 Ga0207668_10017174 3300025972 Bacteria 4529
402 Ga0207668_10146968 3300025972 Bacteria 1820
403 Ga0207640_10050390 3300025981 Bacteria 2701
404 Ga0207658_10000458 3300025986 Bacteria 38200
405 Ga0207658_10072107 3300025986 Bacteria 2617
406 Ga0207677_10016438 3300026023 Bacteria 4384
407 Ga0207677_10032068 3300026023 Bacteria 3374
408 Ga0207703_10266840 3300026035 Bacteria 1549
409 Ga0207639_10000591 3300026041 Bacteria 24978
410 Ga0207639_10004906 3300026041 Bacteria 9015
411 Ga0207639_10015738 3300026041 Bacteria 5337
412 Ga0207639_10024341 3300026041 Bacteria 4380
413 Ga0207639_10082227 3300026041 Bacteria 2552
414 Ga0207678_10004292 3300026067 Bacteria 12790
415 Ga0207678_10010644 3300026067 Bacteria 8081
416 Ga0207678_10216851 3300026067 Bacteria 1638
417 Ga0207678_10270576 3300026067 Bacteria 1457
418 Ga0207702_10000125 3300026078 Bacteria 90604
419 Ga0207702_10029705 3300026078 Bacteria 4549
420 Ga0207702_10073135 3300026078 Bacteria 2955
421 Ga0207702_10088165 3300026078 Bacteria 2710
422 Ga0207702_10403312 3300026078 Bacteria 1319
423 Ga0207641_10064300 3300026088 Bacteria 3135
424 Ga0207641_10200187 3300026088 Bacteria 1841
425 Ga0207641_10372325 3300026088 Bacteria 1366
426 Ga0207648_10002148 3300026089 Bacteria 21431
427 Ga0207648_10006679 3300026089 Bacteria 11445
428 Ga0207648_10074013 3300026089 Bacteria 2968
429 Ga0207676_10066079 3300026095 Bacteria 2882
430 Ga0207676_10115865 3300026095 Bacteria 2251
431 Ga0207674_10015601 3300026116 Bacteria 8341
432 Ga0207674_10016923 3300026116 Bacteria 7963
433 Ga0207674_10024871 3300026116 Bacteria 6391
434 Ga0207674_10039752 3300026116 Bacteria 4875
435 Ga0207674_10088007 3300026116 Bacteria 3099
436 Ga0207674_10102952 3300026116 Bacteria 2835
437 Ga0207675_100170853 3300026118 Bacteria 2078
438 Ga0207683_10001702 3300026121 Bacteria 19675
439 Ga0207683_10032821 3300026121 Bacteria 4510
440 Ga0207698_10004762 3300026142 Bacteria 8304
441 Ga0207698_10009095 3300026142 Bacteria 6312
442 Ga0207698_10011035 3300026142 Bacteria 5841
443 Ga0268266_10187533 3300028379 Bacteria 1887
444 Ga0268266_10495193 3300028379 Bacteria 1166
445 Ga0268264_10000963 3300028381 Bacteria 29539
446 Ga0268264_10044671 3300028381 Bacteria 3675
447 Ga0268264_10066388 3300028381 Bacteria 3042
448 Ga0268264_10104322 3300028381 Bacteria 2471
449 Ga0265323_10000793 3300028653 Bacteria 16923
450 Ga0265338_10279597 3300028800 Bacteria 1220
451 Ga0265324_10009208 3300029957 Bacteria 3867
452 Ga0265320_10000539 3300031240 Bacteria 29285
453 Ga0265320_10033584 3300031240 Bacteria 2617
454 Ga0265325_10011915 3300031241 Bacteria 4986
455 Ga0265325_10136992 3300031241 Bacteria 1167
456 Ga0265340_10036132 3300031247 Bacteria 2450
457 Ga0265339_10059428 3300031249 Bacteria 2062
458 Ga0265331_10000003 3300031250 Bacteria 499358
459 Ga0265331_10000638 3300031250 Bacteria 30301
460 Ga0265331_10081825 3300031250 Bacteria 1499
461 Ga0265316_10133322 3300031344 Bacteria 1870
462 Ga0265316_10220006 3300031344 Bacteria 1402
463 Ga0307513_10002839 3300031456 Bacteria 23740
464 Ga0307408_100054768 3300031548 Bacteria 2885
465 Ga0265313_10006022 3300031595 Bacteria 8751
466 Ga0265314_10000675 3300031711 Bacteria 41616
467 Ga0265314_10002520 3300031711 Bacteria 18664
468 Ga0265314_10058297 3300031711 Bacteria 2646
469 Ga0265314_10192471 3300031711 Bacteria 1212
470 Ga0265342_10075227 3300031712 Bacteria 1960
471 Ga0265342_10096308 3300031712 Bacteria 1691
472 Ga0307413_10027655 3300031824 Bacteria 3146
473 Ga0307410_10003413 3300031852 Bacteria 7968
474 Ga0307406_10180862 3300031901 Bacteria 1535
475 Ga0307407_10043257 3300031903 Bacteria 2531
476 Ga0307412_10024686 3300031911 Bacteria 3713
477 Ga0307409_100021169 3300031995 Bacteria 4452
478 Ga0307416_100024582 3300032002 Bacteria 4401
479 Ga0307411_10019771 3300032005 Bacteria 3898
480 Ga0307415_100060869 3300032126 Bacteria 2611
481 Ga0373940_0042610 3300035088 Bacteria 1252
482 Ga0373927_0000253 3300035695 Bacteria 42014
483 Ga0373947_0126801 3300035725 Bacteria 1626
484 Ga0373937_0000389 3300036401 Bacteria 40860
485 Ga0373937_0060710 3300036401 Bacteria 3474
486 Ga0373925_0076400 3300037068 Bacteria 2540
487 Ga0373925_0090657 3300037068 Bacteria 2337
488 Ga0373925_0402810 3300037068 Bacteria 1116
489 Ga0373925_0537194 3300037068 Bacteria 961
490 Ga0395899_0022054 3300037312 Bacteria 4829
491 Ga0395899_0023376 3300037312 Bacteria 4682
492 Ga0395900_0019258 3300037418 Bacteria 6958
493 Ga0395898_0035060 3300037466 Bacteria 4994
494 Ga0395905_0010620 3300037471 Bacteria 8937
495 Ga0395905_0012063 3300037471 Bacteria 8328
496 Ga0395905_0053882 3300037471 Bacteria 3764
497 Ga0395905_0106981 3300037471 Bacteria 2626
498 Ga0395901_0001910 3300038443 Bacteria 21454
499 Ga0395901_0092957 3300038443 Bacteria 3157
500 Ga0436365_1194130 3300039437 Bacteria 2743
501 Ga0436365_1234622 3300039437 Bacteria 117941
502 Ga0436361_0001464 3300039447 Bacteria 13289
503 Ga0436361_0028109 3300039447 Bacteria 9820
504 Ga0436361_0076715 3300039447 Bacteria 40178
505 Ga0436361_0270082 3300039447 Bacteria 7438
506 Ga0436361_0296121 3300039447 Bacteria 160237
507 Ga0436361_0365808 3300039447 Bacteria 1686
508 Ga0436361_0614937 3300039447 Bacteria 8160
509 Ga0436361_0621527 3300039447 Bacteria 17412
510 Ga0439433_0034573 3300041999 Bacteria 1164
511 Ga0451577_0000009 3300042876 Bacteria 646744
512 Ga0451577_0008808 3300042876 Bacteria 9773
513 Ga0466972_0010618 3300044658 Bacteria 4618
514 Ga0453683_0000847 3300044673 Bacteria 29561
515 Ga0453683_0003255 3300044673 Bacteria 12071
516 Ga0453683_0008771 3300044673 Bacteria 6778
517 Ga0453683_0062762 3300044673 Bacteria 2323
518 Ga0453683_0080245 3300044673 Bacteria 2044
519 Ga0466966_0035094 3300044684 Bacteria 3242
520 Ga0453684_0000358 3300044712 Bacteria 188931
521 Ga0453684_0009048 3300044712 Bacteria 17577
522 Ga0453684_0012200 3300044712 Bacteria 14241
523 Ga0453684_0054005 3300044712 Bacteria 5238
524 Ga0466957_0194816 3300044842 Bacteria 1329
525 Ga0451576_0003725 3300045051 Bacteria 20614
526 Ga0451576_0403746 3300045051 Bacteria 1433
527 Ga0451576_0524834 3300045051 Bacteria 1244
528 Ga0466958_0005292 3300045836 Bacteria 6922
529 Ga0466967_0693530 3300045976 Bacteria 1008
530 Ga0495617_000016 3300046452 Bacteria 253600
531 Ga0495617_001385 3300046452 Bacteria 10677
532 Ga0495603_0014873 3300046455 Bacteria 4708
533 Ga0495590_0003984 3300046457 Bacteria 5998
534 Ga0495638_0000044 3300046460 Bacteria 221595
535 Ga0495638_0000916 3300046460 Bacteria 30114
536 Ga0495650_0000536 3300046471 Bacteria 54546
537 Ga0495650_0001214 3300046471 Bacteria 27066
538 Ga0495605_0105323 3300046474 Bacteria 1292
539 Ga0495584_0003894 3300046491 Bacteria 8073
540 Ga0495585_0000007 3300046492 Bacteria 288113
541 Ga0495585_0027100 3300046492 Bacteria 3271
542 Ga0495607_0000030 3300046501 Bacteria 154557
543 Ga0495607_0169378 3300046501 Bacteria 1104
544 Ga0495583_0000090 3300046506 Bacteria 158988
545 Ga0495583_0014996 3300046506 Bacteria 4240
546 Ga0495606_0000073 3300046507 Bacteria 171657
547 Ga0495606_0000260 3300046507 Bacteria 93381
548 Ga0495606_0002085 3300046507 Bacteria 24403
549 Ga0495606_0039963 3300046507 Bacteria 3155
550 Ga0495610_0016504 3300046512 Bacteria 4246
551 Ga0495616_0000001 3300046513 Bacteria 780061
552 Ga0495620_0000078 3300046515 Bacteria 80641
553 Ga0495620_0000732 3300046515 Bacteria 20244
554 Ga0495631_0000051 3300046518 Bacteria 71756
555 Ga0495631_0000077 3300046518 Bacteria 63179
556 Ga0495632_0001645 3300046519 Bacteria 18316
557 Ga0495648_0000584 3300046524 Bacteria 39055
558 Ga0495648_0003567 3300046524 Bacteria 13616
559 Ga0495654_0038759 3300046530 Bacteria 2381
560 Ga0495609_0018043 3300046538 Bacteria 3273
561 Ga0495622_0029916 3300046557 Bacteria 2544
562 Ga0495668_0009414 3300046616 Bacteria 6001
563 Ga0495668_0031488 3300046616 Bacteria 2989
564 Ga0495668_0034110 3300046616 Bacteria 2857
565 Ga0495611_0000001 3300046648 Bacteria 2628469
566 Ga0495611_0000006 3300046648 Bacteria 249842
567 Ga0495611_0070221 3300046648 Bacteria 1601
568 Ga0495625_0000001 3300046660 Bacteria 1641829
569 Ga0495625_0004921 3300046660 Bacteria 12434
570 Ga0495661_0002549 3300046665 Bacteria 13974
571 Ga0495647_0071872 3300046681 Bacteria 1387
572 Ga0495658_0001841 3300046683 Bacteria 10840
573 Ga0495669_0009832 3300046684 Bacteria 4040
574 Ga0495670_0017804 3300046691 Bacteria 3499
575 Ga0495649_0000203 3300046694 Bacteria 52758
576 Ga0495649_0004336 3300046694 Bacteria 9298
577 Ga0495589_0000172 3300046794 Bacteria 58738
578 Ga0495589_0059301 3300046794 Bacteria 1881
579 Ga0495660_0000018 3300046810 Bacteria 317061
580 Ga0495660_0000025 3300046810 Bacteria 260275
581 Ga0495660_0058530 3300046810 Bacteria 2075
582 Ga0495672_0005079 3300047320 Bacteria 10517
583 Ga0495683_0004279 3300047323 Bacteria 8138
584 Ga0495679_000001 3300047446 Bacteria 1607568
585 Ga0495673_0000001 3300047469 Bacteria 1630730
586 Ga0495673_0000018 3300047469 Bacteria 569190
587 Ga0495673_0000129 3300047469 Bacteria 139549
588 Ga0495686_0000017 3300047472 Bacteria 435554
589 Ga0495686_0000037 3300047472 Bacteria 307937
590 Ga0495686_0019170 3300047472 Bacteria 4575
591 Ga0495686_0029670 3300047472 Bacteria 3557
592 Ga0496100_0008675 3300048903 Bacteria 5677
593 Ga0496100_0126992 3300048903 Bacteria 1791
594 Ga0496101_0004321 3300048904 Bacteria 8920
595 Ga0496101_0028900 3300048904 Bacteria 3875
596 Ga0496102_0050437 3300048905 Bacteria 3789
597 Ga0496103_0008641 3300048906 Bacteria 6050
598 Ga0496104_0010035 3300048907 Bacteria 8454
599 Ga0496104_0244525 3300048907 Bacteria 1707
600 Ga0496105_0067510 3300048908 Bacteria 2953
601 Ga0496105_0137711 3300048908 Bacteria 2010
602 Ga0496106_0008180 3300048909 Bacteria 7727
603 Ga0496106_0240135 3300048909 Bacteria 1448
604 Ga0496107_0010495 3300048910 Bacteria 6438
605 Ga0496114_0202854 3300048917 Bacteria 1737
606 Ga0496114_0425883 3300048917 Bacteria 1176
607 Ga0496115_0000024 3300048918 Bacteria 154488
608 Ga0496115_0001590 3300048918 Bacteria 16293
609 Ga0496117_0223707 3300048920 Bacteria 1045
610 Ga0496118_0002826 3300048921 Bacteria 22723
611 Ga0496121_0000666 3300048924 Bacteria 64148
612 Ga0496121_0011440 3300048924 Bacteria 9852
613 Ga0496121_0052630 3300048924 Bacteria 3417
614 Ga0495678_000209 3300049459 Bacteria 68248
615 Ga0495682_0003698 3300049460 Bacteria 6739
616 Ga0495682_0023440 3300049460 Bacteria 2303
617 Ga0501032_0005754 3300049569 Bacteria 9170
618 Ga0501032_0074237 3300049569 Bacteria 2266
619 Ga0501032_0076263 3300049569 Bacteria 2232
620 Ga0501032_0214110 3300049569 Bacteria 1255
621 Ga0501033_0002380 3300049570 Bacteria 16017
622 Ga0501033_0019956 3300049570 Bacteria 5065
623 Ga0501033_0134863 3300049570 Bacteria 1786
624 Ga0501034_0013490 3300049571 Bacteria 8412
625 Ga0501034_0076554 3300049571 Bacteria 3352
626 Ga0501034_0461379 3300049571 Bacteria 1187
627 Ga0501036_0030936 3300049572 Bacteria 4523
628 Ga0501036_0174659 3300049572 Bacteria 1809
629 Ga0501037_0080203 3300049573 Bacteria 2368
630 Ga0501037_0226307 3300049573 Bacteria 1314
631 Ga0501038_0017190 3300049574 Bacteria 6539
632 Ga0501038_0047113 3300049574 Bacteria 3735
633 Ga0501038_0087246 3300049574 Bacteria 2620
634 Ga0501038_0094148 3300049574 Bacteria 2504
635 Ga0501038_0143175 3300049574 Bacteria 1954
636 Ga0501038_0251668 3300049574 Bacteria 1399
637 Ga0501039_0120120 3300049575 Bacteria 2059
638 Ga0501040_0281081 3300049576 Bacteria 1189
639 Ga0501043_0062949 3300049579 Bacteria 2913
640 Ga0501043_0140754 3300049579 Bacteria 1889
641 Ga0501046_0068564 3300049580 Bacteria 2760
642 Ga0501046_0396461 3300049580 Bacteria 997
643 Ga0501047_0003456 3300049581 Bacteria 14926
644 Ga0501047_0009987 3300049581 Bacteria 8972
645 Ga0501047_0028409 3300049581 Bacteria 5392
646 Ga0501047_0375555 3300049581 Bacteria 1256
647 Ga0501067_0054764 3300049583 Bacteria 2210
648 Ga0501068_0077004 3300049584 Bacteria 2042
649 Ga0501069_0041850 3300049585 Bacteria 2533
650 Ga0501070_0035616 3300049586 Bacteria 4158
651 Ga0501070_0053798 3300049586 Bacteria 3338
652 Ga0501070_0113972 3300049586 Bacteria 2233
653 Ga0501072_0002100 3300049588 Bacteria 14838
654 Ga0501073_0001773 3300049589 Bacteria 16050
655 Ga0501073_0020612 3300049589 Bacteria 4754
656 Ga0501074_0004341 3300049590 Bacteria 10126
657 Ga0501074_0035709 3300049590 Bacteria 3601
658 Ga0501074_0106227 3300049590 Bacteria 2010
659 Ga0501079_0021809 3300049741 Bacteria 4903
660 Ga0501080_0005029 3300049742 Bacteria 11781
661 Ga0501080_0010940 3300049742 Bacteria 8302
662 Ga0501080_0024247 3300049742 Bacteria 5624
663 Ga0501080_0052659 3300049742 Bacteria 3788
664 Ga0501080_0097119 3300049742 Bacteria 2735
665 Ga0501080_0240181 3300049742 Bacteria 1654
666 Ga0501080_0603315 3300049742 Bacteria 974
667 Ga0501035_0001650 3300049822 Bacteria 22551
668 Ga0501035_0002475 3300049822 Bacteria 18046
669 Ga0501035_0003494 3300049822 Bacteria 15025
670 Ga0501035_0009642 3300049822 Bacteria 8980
671 Ga0501035_0063469 3300049822 Bacteria 3285
672 Ga0501035_0111966 3300049822 Bacteria 2391
673 Ga0501035_0189936 3300049822 Bacteria 1766
674 Ga0501035_0467117 3300049822 Bacteria 1042
675 Ga0501044_0015835 3300049823 Bacteria 8114
676 Ga0501044_0019468 3300049823 Bacteria 7259
677 Ga0501044_0128019 3300049823 Bacteria 2535
678 nmdc:mga00v17_79865_c1 3300050491 Bacteria 2040
679 nmdc:mga0qj67_323760_c1 3300050509 Bacteria 1248
680 nmdc:mga08y16_129183_c1 3300050511 Bacteria 2628
681 nmdc:mga08y16_25798_c1 3300050511 Bacteria 6202
682 nmdc:mga08y16_519984_c1 3300050511 Bacteria 1207
683 nmdc:mga0n895_25655_c1 3300050512 Bacteria 5572
684 nmdc:mga0rr50_94778_c1 3300050513 Bacteria 2332
685 nmdc:mga08x19_270916_c1 3300050514 Bacteria 1175
686 nmdc:mga0a205_232460_c1 3300050515 Bacteria 1726
687 nmdc:mga0a205_2343_c1 3300050515 Bacteria 16709
688 Ga0500643_000002 3300053087 Bacteria 1277657
689 Ga0500555_011022 3300053103 Bacteria 2595
690 Ga0500604_0040923 3300053151 Bacteria 1399
691 Ga0500616_0036706 3300053153 Bacteria 2658
692 Ga0500633_0001679 3300053160 Bacteria 4291
693 Ga0500637_0001230 3300053178 Bacteria 10710
694 Ga0500645_002013 3300053730 Bacteria 9517
695 Ga0590071_003216 3300059421 Bacteria 4035

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013296 Ga0157374_10232846 Ga0157374_102328462 235
2 3300005327 Ga0070658_10087981 Ga0070658_100879812 242
3 3300005339 Ga0070660_100004136 Ga0070660_1000041363 242
4 3300005341 Ga0070691_10006919 Ga0070691_100069192 242
5 3300005455 Ga0070663_100011142 Ga0070663_1000111422 242
6 3300005458 Ga0070681_10120607 Ga0070681_101206072 242
7 3300005530 Ga0070679_100055385 Ga0070679_1000553852 242
8 3300009551 Ga0105238_10009736 Ga0105238_100097366 242
9 3300013100 Ga0157373_10199881 Ga0157373_101998812 242
10 3300013102 Ga0157371_10046698 Ga0157371_100466982 242
11 3300013104 Ga0157370_10001994 Ga0157370_1000199414 242
12 3300013307 Ga0157372_10009410 Ga0157372_100094104 242
13 3300025909 Ga0207705_10000089 Ga0207705_1000008957 242
14 3300025912 Ga0207707_10001152 Ga0207707_100011523 242
15 3300025917 Ga0207660_10000311 Ga0207660_1000031113 242
16 3300025919 Ga0207657_10000654 Ga0207657_1000065414 242
17 3300025921 Ga0207652_10005226 Ga0207652_100052266 242
18 3300025949 Ga0207667_10017214 Ga0207667_100172142 242
19 3300003756 Ga0055533_1000667 Ga0055533_10006672 243
20 3300025226 Ga0209674_100016 Ga0209674_100016389 243
21 3300025231 Ga0207427_106258 Ga0207427_1062582 243
22 3300025294 Ga0209025_1080404 Ga0209025_10804041 244
23 3300046681 Ga0495647_0071872 Ga0495647_0071872_467_1372 244
24 3300046519 Ga0495632_0001645 Ga0495632_0001645_14257_15105 245
25 3300046524 Ga0495648_0003567 Ga0495648_0003567_12426_13274 245
26 3300025933 Ga0207706_10250431 Ga0207706_102504312 247
27 3300047469 Ga0495673_0000018 Ga0495673_0000018_181306_182154 247
28 3300005331 Ga0070670_100136041 Ga0070670_1001360412 248
29 3300025271 Ga0207666_1008580 Ga0207666_10085802 248
30 3300046471 Ga0495650_0000536 Ga0495650_0000536_32322_33170 248
31 3300046507 Ga0495606_0039963 Ga0495606_0039963_968_1816 248
32 3300046515 Ga0495620_0000732 Ga0495620_0000732_12590_13438 248
33 3300046518 Ga0495631_0000077 Ga0495631_0000077_17616_18464 248
34 3300046648 Ga0495611_0000006 Ga0495611_0000006_141175_142023 248
35 3300049589 Ga0501073_0020612 Ga0501073_0020612_1245_2138 248
36 3300053160 Ga0500633_0001679 Ga0500633_0001679_604_1452 248
37 3300039447 Ga0436361_0365808 Ga0436361_0365808_226_1140 249
38 3300025206 Ga0209435_103741 Ga0209435_1037412 250
39 3300025242 Ga0209258_101024 Ga0209258_1010244 250
40 3300025246 Ga0209646_1010093 Ga0209646_10100932 250
41 3300036401 Ga0373937_0060710 Ga0373937_0060710_460_1386 250
42 3300046474 Ga0495605_0105323 Ga0495605_0105323_228_1094 250
43 3300046491 Ga0495584_0003894 Ga0495584_0003894_2538_3386 250
44 3300046492 Ga0495585_0027100 Ga0495585_0027100_1357_2205 250
45 3300046507 Ga0495606_0000073 Ga0495606_0000073_111338_112216 250
46 3300046691 Ga0495670_0017804 Ga0495670_0017804_1124_1972 250
47 3300047323 Ga0495683_0004279 Ga0495683_0004279_191_1039 250
48 3300047472 Ga0495686_0000017 Ga0495686_0000017_368442_369293 250
49 3300048905 Ga0496102_0050437 Ga0496102_0050437_2067_2891 250
50 3300048920 Ga0496117_0223707 Ga0496117_0223707_37_888 250
51 3300048921 Ga0496118_0002826 Ga0496118_0002826_8892_9743 250
52 3300048924 Ga0496121_0011440 Ga0496121_0011440_7051_7899 250
53 3300053153 Ga0500616_0036706 Ga0500616_0036706_537_1436 252
54 3300031240 Ga0265320_10033584 Ga0265320_100335842 253
55 3300031250 Ga0265331_10000638 Ga0265331_1000063816 253
56 3300031711 Ga0265314_10000675 Ga0265314_1000067513 253
57 3300009174 Ga0105241_10097829 Ga0105241_100978293 254
58 3300049588 Ga0501072_0002100 Ga0501072_0002100_8172_9029 254
59 3300049589 Ga0501073_0001773 Ga0501073_0001773_5668_6525 254
60 3300049741 Ga0501079_0021809 Ga0501079_0021809_1545_2402 254
61 3300049742 Ga0501080_0010940 Ga0501080_0010940_5860_6717 254
62 3300025907 Ga0207645_10012060 Ga0207645_100120602 255
63 3300026023 Ga0207677_10032068 Ga0207677_100320682 255
64 3300026089 Ga0207648_10006679 Ga0207648_1000667913 255
65 3300031247 Ga0265340_10036132 Ga0265340_100361322 255
66 3300039437 Ga0436365_1194130 Ga0436365_1194130_1791_2582 255
67 3300053151 Ga0500604_0040923 Ga0500604_0040923_360_1172 255
68 3300044712 Ga0453684_0009048 Ga0453684_0009048_15112_15972 256
69 3300049569 Ga0501032_0076263 Ga0501032_0076263_11_826 256
70 3300049572 Ga0501036_0030936 Ga0501036_0030936_1510_2325 256
71 3300049574 Ga0501038_0094148 Ga0501038_0094148_1510_2325 256
72 3300049822 Ga0501035_0001650 Ga0501035_0001650_20227_21042 256
73 3300005843 Ga0068860_100015154 Ga0068860_1000151546 257
74 3300005843 Ga0068860_100667781 Ga0068860_1006677811 257
75 3300009093 Ga0105240_10251256 Ga0105240_102512563 257
76 3300009101 Ga0105247_10061763 Ga0105247_100617632 257
77 3300009176 Ga0105242_10023556 Ga0105242_100235565 257
78 3300010375 Ga0105239_10026373 Ga0105239_100263732 257
79 3300013105 Ga0157369_10003370 Ga0157369_100033709 257
80 3300013306 Ga0163162_10178908 Ga0163162_101789082 257
81 3300014968 Ga0157379_10372529 Ga0157379_103725292 257
82 3300014969 Ga0157376_10033093 Ga0157376_100330934 257
83 3300025899 Ga0207642_10080270 Ga0207642_100802701 257
84 3300025903 Ga0207680_10037775 Ga0207680_100377753 257
85 3300026089 Ga0207648_10074013 Ga0207648_100740133 257
86 3300028381 Ga0268264_10044671 Ga0268264_100446712 257
87 3300028381 Ga0268264_10066388 Ga0268264_100663884 257
88 3300037068 Ga0373925_0537194 Ga0373925_0537194_136_951 257
89 3300005344 Ga0070661_100261996 Ga0070661_1002619962 258
90 3300005543 Ga0070672_100540562 Ga0070672_1005405621 258
91 3300005614 Ga0068856_100000400 Ga0068856_10000040011 258
92 3300005719 Ga0068861_100258396 Ga0068861_1002583962 258
93 3300005844 Ga0068862_100580744 Ga0068862_1005807442 258
94 3300026078 Ga0207702_10000125 Ga0207702_1000012511 258
95 3300046460 Ga0495638_0000916 Ga0495638_0000916_14944_15807 258
96 3300046471 Ga0495650_0001214 Ga0495650_0001214_14333_15196 258
97 3300046507 Ga0495606_0000260 Ga0495606_0000260_45932_46753 258
98 3300049570 Ga0501033_0002380 Ga0501033_0002380_627_1442 258
99 3300049579 Ga0501043_0140754 Ga0501043_0140754_463_1278 258
100 3300049580 Ga0501046_0068564 Ga0501046_0068564_536_1351 258
101 3300049581 Ga0501047_0375555 Ga0501047_0375555_182_997 258
102 3300005327 Ga0070658_10046904 Ga0070658_100469043 259
103 3300005329 Ga0070683_100016971 Ga0070683_1000169712 259
104 3300005338 Ga0068868_100009112 Ga0068868_1000091124 259
105 3300005458 Ga0070681_10123174 Ga0070681_101231742 259
106 3300005458 Ga0070681_10142810 Ga0070681_101428103 259
107 3300005530 Ga0070679_100043671 Ga0070679_1000436714 259
108 3300005563 Ga0068855_100004225 Ga0068855_1000042257 259
109 3300005564 Ga0070664_100575969 Ga0070664_1005759692 259
110 3300005577 Ga0068857_100004590 Ga0068857_1000045902 259
111 3300005577 Ga0068857_100019781 Ga0068857_1000197815 259
112 3300005614 Ga0068856_100131680 Ga0068856_1001316802 259
113 3300005718 Ga0068866_10053389 Ga0068866_100533893 259
114 3300006237 Ga0097621_100007337 Ga0097621_1000073374 259
115 3300006237 Ga0097621_100111291 Ga0097621_1001112912 259
116 3300006358 Ga0068871_100113169 Ga0068871_1001131692 259
117 3300006881 Ga0068865_100062498 Ga0068865_1000624983 259
118 3300006914 Ga0075436_100353419 Ga0075436_1003534192 259
119 3300009093 Ga0105240_10001676 Ga0105240_1000167617 259
120 3300009174 Ga0105241_10127040 Ga0105241_101270402 259
121 3300009176 Ga0105242_10291619 Ga0105242_102916192 259
122 3300009177 Ga0105248_10806235 Ga0105248_108062352 259
123 3300009551 Ga0105238_10043434 Ga0105238_100434342 259
124 3300010375 Ga0105239_10048947 Ga0105239_100489474 259
125 3300011119 Ga0105246_10108142 Ga0105246_101081422 259
126 3300013297 Ga0157378_10020487 Ga0157378_100204876 259
127 3300013308 Ga0157375_10289717 Ga0157375_102897172 259
128 3300014325 Ga0163163_10181302 Ga0163163_101813023 259
129 3300025911 Ga0207654_10050298 Ga0207654_100502983 259
130 3300025912 Ga0207707_10026761 Ga0207707_100267616 259
131 3300025912 Ga0207707_10114643 Ga0207707_101146432 259
132 3300025913 Ga0207695_10002354 Ga0207695_1000235410 259
133 3300025921 Ga0207652_10096273 Ga0207652_100962734 259
134 3300025921 Ga0207652_10398028 Ga0207652_103980282 259
135 3300025924 Ga0207694_10014090 Ga0207694_100140908 259
136 3300025927 Ga0207687_10013262 Ga0207687_100132622 259
137 3300025934 Ga0207686_10136582 Ga0207686_101365822 259
138 3300025938 Ga0207704_10043983 Ga0207704_100439832 259
139 3300025944 Ga0207661_10037401 Ga0207661_100374012 259
140 3300025945 Ga0207679_10169266 Ga0207679_101692662 259
141 3300025949 Ga0207667_10005736 Ga0207667_100057362 259
142 3300026023 Ga0207677_10016438 Ga0207677_100164382 259
143 3300026035 Ga0207703_10266840 Ga0207703_102668402 259
144 3300026116 Ga0207674_10024871 Ga0207674_100248715 259
145 3300026116 Ga0207674_10039752 Ga0207674_100397522 259
146 3300031249 Ga0265339_10059428 Ga0265339_100594282 259
147 3300031250 Ga0265331_10081825 Ga0265331_100818252 259
148 3300031344 Ga0265316_10220006 Ga0265316_102200062 259
149 3300031711 Ga0265314_10002520 Ga0265314_1000252011 259
150 3300045051 Ga0451576_0403746 Ga0451576_0403746_209_1117 259
151 3300001915 JGI24741J21665_1004654 JGI24741J21665_10046542 260
152 3300005340 Ga0070689_100004487 Ga0070689_10000448710 260
153 3300005842 Ga0068858_100014648 Ga0068858_1000146487 260
154 3300013306 Ga0163162_10789966 Ga0163162_107899662 260
155 3300025936 Ga0207670_10011987 Ga0207670_100119873 260
156 3300026067 Ga0207678_10216851 Ga0207678_102168512 260
157 3300048924 Ga0496121_0052630 Ga0496121_0052630_2088_2951 260
158 3300005331 Ga0070670_100099465 Ga0070670_1000994652 261
159 3300005335 Ga0070666_10001402 Ga0070666_1000140216 261
160 3300005466 Ga0070685_10008770 Ga0070685_100087703 261
161 3300005548 Ga0070665_100696753 Ga0070665_1006967531 261
162 3300005563 Ga0068855_100019435 Ga0068855_1000194358 261
163 3300009177 Ga0105248_10679427 Ga0105248_106794271 261
164 3300021361 Ga0213872_10000525 Ga0213872_1000052515 261
165 3300021361 Ga0213872_10006595 Ga0213872_100065955 261
166 3300021361 Ga0213872_10011915 Ga0213872_100119153 261
167 3300025903 Ga0207680_10000525 Ga0207680_100005255 261
168 3300026088 Ga0207641_10200187 Ga0207641_102001872 261
169 3300028379 Ga0268266_10495193 Ga0268266_104951932 261
170 3300039447 Ga0436361_0001464 Ga0436361_0001464_4372_5184 261
171 3300039447 Ga0436361_0028109 Ga0436361_0028109_7489_8301 261
172 3300049569 Ga0501032_0005754 Ga0501032_0005754_7854_8690 261
173 3300049569 Ga0501032_0074237 Ga0501032_0074237_255_1091 261
174 3300049570 Ga0501033_0134863 Ga0501033_0134863_390_1244 261
175 3300049574 Ga0501038_0047113 Ga0501038_0047113_229_1065 261
176 3300049576 Ga0501040_0281081 Ga0501040_0281081_258_1094 261
177 3300049580 Ga0501046_0396461 Ga0501046_0396461_107_943 261
178 3300049581 Ga0501047_0003456 Ga0501047_0003456_484_1320 261
179 3300049822 Ga0501035_0003494 Ga0501035_0003494_11865_12701 261
180 3300049822 Ga0501035_0467117 Ga0501035_0467117_74_928 261
181 3300049823 Ga0501044_0128019 Ga0501044_0128019_1229_2065 261
182 3300005336 Ga0070680_100004255 Ga0070680_1000042555 262
183 3300005339 Ga0070660_100165700 Ga0070660_1001657002 262
184 3300005366 Ga0070659_100089929 Ga0070659_1000899292 262
185 3300005458 Ga0070681_10004454 Ga0070681_1000445411 262
186 3300005530 Ga0070679_100004157 Ga0070679_1000041575 262
187 3300005543 Ga0070672_100205301 Ga0070672_1002053012 262
188 3300005563 Ga0068855_100126419 Ga0068855_1001264192 262
189 3300005618 Ga0068864_100632456 Ga0068864_1006324562 262
190 3300005719 Ga0068861_100097724 Ga0068861_1000977242 262
191 3300009093 Ga0105240_10100373 Ga0105240_101003735 262
192 3300009094 Ga0111539_10142886 Ga0111539_101428862 262
193 3300013104 Ga0157370_10005673 Ga0157370_100056732 262
194 3300013296 Ga0157374_10360700 Ga0157374_103607002 262
195 3300014326 Ga0157380_10062721 Ga0157380_100627212 262
196 3300025912 Ga0207707_10003824 Ga0207707_100038245 262
197 3300025912 Ga0207707_10327333 Ga0207707_103273332 262
198 3300025917 Ga0207660_10008420 Ga0207660_100084205 262
199 3300025921 Ga0207652_10000117 Ga0207652_1000011710 262
200 3300025932 Ga0207690_10089298 Ga0207690_100892982 262
201 3300026095 Ga0207676_10115865 Ga0207676_101158652 262
202 3300026118 Ga0207675_100170853 Ga0207675_1001708532 262
203 3300039447 Ga0436361_0614937 Ga0436361_0614937_6090_6905 262
204 3300049574 Ga0501038_0143175 Ga0501038_0143175_347_1228 262
205 3300049822 Ga0501035_0189936 Ga0501035_0189936_228_1106 262
206 3300050511 nmdc:mga08y16_129183_c1 nmdc:mga08y16_129183_c1_271_1197 262
207 3300050511 nmdc:mga08y16_519984_c1 nmdc:mga08y16_519984_c1_104_928 262
208 3300005535 Ga0070684_100014623 Ga0070684_1000146236 263
209 3300009094 Ga0111539_10111025 Ga0111539_101110254 263
210 3300009176 Ga0105242_10123992 Ga0105242_101239922 263
211 3300010375 Ga0105239_10377856 Ga0105239_103778562 263
212 3300028653 Ga0265323_10000793 Ga0265323_1000079311 263
213 3300028800 Ga0265338_10279597 Ga0265338_102795971 263
214 3300031711 Ga0265314_10192471 Ga0265314_101924711 263
215 3300039447 Ga0436361_0076715 Ga0436361_0076715_1723_2559 263
216 3300042876 Ga0451577_0000009 Ga0451577_0000009_139742_140617 263
217 3300044673 Ga0453683_0000847 Ga0453683_0000847_8241_9119 263
218 3300044673 Ga0453683_0003255 Ga0453683_0003255_5927_6802 263
219 3300044673 Ga0453683_0062762 Ga0453683_0062762_238_1113 263
220 3300044673 Ga0453683_0080245 Ga0453683_0080245_845_1723 263
221 3300044712 Ga0453684_0000358 Ga0453684_0000358_6170_7045 263
222 3300044712 Ga0453684_0012200 Ga0453684_0012200_10847_11722 263
223 3300044712 Ga0453684_0054005 Ga0453684_0054005_2818_3693 263
224 3300045051 Ga0451576_0003725 Ga0451576_0003725_11341_12216 263
225 3300048907 Ga0496104_0244525 Ga0496104_0244525_701_1543 263
226 3300050511 nmdc:mga08y16_25798_c1 nmdc:mga08y16_25798_c1_2135_2968 263
227 3300003214 JGI25165J46597_1000080 JGI25165J46597_1000080132 264
228 3300005439 Ga0070711_100007824 Ga0070711_1000078244 264
229 3300005458 Ga0070681_10078792 Ga0070681_100787922 264
230 3300005618 Ga0068864_100104976 Ga0068864_1001049761 264
231 3300006237 Ga0097621_100236125 Ga0097621_1002361252 264
232 3300013104 Ga0157370_10179040 Ga0157370_101790403 264
233 3300025231 Ga0207427_104279 Ga0207427_1042791 264
234 3300025261 Ga0209233_1000006 Ga0209233_1000006927 264
235 3300025916 Ga0207663_10025052 Ga0207663_100250523 264
236 3300026088 Ga0207641_10372325 Ga0207641_103723252 264
237 3300026116 Ga0207674_10088007 Ga0207674_100880073 264
238 3300031250 Ga0265331_10000003 Ga0265331_10000003279 264
239 3300031548 Ga0307408_100054768 Ga0307408_1000547682 264
240 3300031711 Ga0265314_10058297 Ga0265314_100582972 264
241 3300031824 Ga0307413_10027655 Ga0307413_100276553 264
242 3300031852 Ga0307410_10003413 Ga0307410_100034136 264
243 3300031903 Ga0307407_10043257 Ga0307407_100432572 264
244 3300031911 Ga0307412_10024686 Ga0307412_100246863 264
245 3300031995 Ga0307409_100021169 Ga0307409_1000211693 264
246 3300032005 Ga0307411_10019771 Ga0307411_100197713 264
247 3300032126 Ga0307415_100060869 Ga0307415_1000608692 264
248 3300037471 Ga0395905_0012063 Ga0395905_0012063_4670_5527 264
249 3300044658 Ga0466972_0010618 Ga0466972_0010618_133_1038 264
250 3300048917 Ga0496114_0425883 Ga0496114_0425883_339_1157 264
251 3300049569 Ga0501032_0214110 Ga0501032_0214110_352_1191 264
252 3300049570 Ga0501033_0019956 Ga0501033_0019956_552_1391 264
253 3300049571 Ga0501034_0013490 Ga0501034_0013490_1954_2793 264
254 3300049573 Ga0501037_0226307 Ga0501037_0226307_119_958 264
255 3300049574 Ga0501038_0017190 Ga0501038_0017190_4610_5488 264
256 3300049574 Ga0501038_0251668 Ga0501038_0251668_370_1209 264
257 3300049575 Ga0501039_0120120 Ga0501039_0120120_34_873 264
258 3300049579 Ga0501043_0062949 Ga0501043_0062949_311_1150 264
259 3300049581 Ga0501047_0028409 Ga0501047_0028409_3865_4704 264
260 3300049584 Ga0501068_0077004 Ga0501068_0077004_906_1745 264
261 3300049586 Ga0501070_0053798 Ga0501070_0053798_2047_2886 264
262 3300049590 Ga0501074_0106227 Ga0501074_0106227_903_1742 264
263 3300049742 Ga0501080_0097119 Ga0501080_0097119_516_1355 264
264 3300049742 Ga0501080_0603315 Ga0501080_0603315_30_872 264
265 3300049822 Ga0501035_0009642 Ga0501035_0009642_3387_4226 264
266 3300049823 Ga0501044_0019468 Ga0501044_0019468_3631_4470 264
267 3300005327 Ga0070658_10151442 Ga0070658_101514422 265
268 3300005330 Ga0070690_100205882 Ga0070690_1002058822 265
269 3300005336 Ga0070680_100218960 Ga0070680_1002189602 265
270 3300005337 Ga0070682_100005201 Ga0070682_1000052015 265
271 3300005354 Ga0070675_100020130 Ga0070675_1000201305 265
272 3300005354 Ga0070675_100220854 Ga0070675_1002208542 265
273 3300005440 Ga0070705_100011094 Ga0070705_1000110945 265
274 3300005444 Ga0070694_100034546 Ga0070694_1000345463 265
275 3300005455 Ga0070663_100002230 Ga0070663_1000022304 265
276 3300005456 Ga0070678_100022994 Ga0070678_1000229942 265
277 3300005458 Ga0070681_10030948 Ga0070681_100309484 265
278 3300005530 Ga0070679_100132245 Ga0070679_1001322452 265
279 3300005539 Ga0068853_100005744 Ga0068853_1000057445 265
280 3300005547 Ga0070693_100000948 Ga0070693_1000009485 265
281 3300005549 Ga0070704_100102446 Ga0070704_1001024462 265
282 3300005615 Ga0070702_100052808 Ga0070702_1000528081 265
283 3300005843 Ga0068860_100112190 Ga0068860_1001121903 265
284 3300006881 Ga0068865_100082760 Ga0068865_1000827602 265
285 3300009094 Ga0111539_10012876 Ga0111539_100128762 265
286 3300009101 Ga0105247_10095814 Ga0105247_100958142 265
287 3300009174 Ga0105241_10001696 Ga0105241_100016962 265
288 3300009545 Ga0105237_10046750 Ga0105237_100467503 265
289 3300009551 Ga0105238_10044626 Ga0105238_100446265 265
290 3300011119 Ga0105246_10041703 Ga0105246_100417034 265
291 3300013105 Ga0157369_10077733 Ga0157369_100777332 265
292 3300013105 Ga0157369_10552465 Ga0157369_105524652 265
293 3300014326 Ga0157380_10051605 Ga0157380_100516053 265
294 3300021361 Ga0213872_10001049 Ga0213872_100010495 265
295 3300025904 Ga0207647_10005236 Ga0207647_100052365 265
296 3300025904 Ga0207647_10009247 Ga0207647_100092477 265
297 3300025911 Ga0207654_10036699 Ga0207654_100366992 265
298 3300025912 Ga0207707_10014155 Ga0207707_100141554 265
299 3300025914 Ga0207671_10098074 Ga0207671_100980742 265
300 3300025917 Ga0207660_10107715 Ga0207660_101077152 265
301 3300025921 Ga0207652_10066575 Ga0207652_100665752 265
302 3300025924 Ga0207694_10084206 Ga0207694_100842063 265
303 3300025926 Ga0207659_10227087 Ga0207659_102270872 265
304 3300025938 Ga0207704_10033169 Ga0207704_100331694 265
305 3300026041 Ga0207639_10015738 Ga0207639_100157385 265
306 3300026067 Ga0207678_10004292 Ga0207678_1000429210 265
307 3300026121 Ga0207683_10032821 Ga0207683_100328215 265
308 3300028381 Ga0268264_10104322 Ga0268264_101043223 265
309 3300031240 Ga0265320_10000539 Ga0265320_1000053910 265
310 3300031241 Ga0265325_10011915 Ga0265325_100119156 265
311 3300031595 Ga0265313_10006022 Ga0265313_100060222 265
312 3300031712 Ga0265342_10096308 Ga0265342_100963081 265
313 3300039447 Ga0436361_0270082 Ga0436361_0270082_5795_6640 265
314 3300039447 Ga0436361_0621527 Ga0436361_0621527_3242_4090 265
315 3300044684 Ga0466966_0035094 Ga0466966_0035094_545_1393 265
316 3300045836 Ga0466958_0005292 Ga0466958_0005292_5084_5932 265
317 3300048903 Ga0496100_0008675 Ga0496100_0008675_4305_5201 265
318 3300048904 Ga0496101_0028900 Ga0496101_0028900_2417_3313 265
319 3300048906 Ga0496103_0008641 Ga0496103_0008641_633_1529 265
320 3300048907 Ga0496104_0010035 Ga0496104_0010035_5271_6167 265
321 3300048908 Ga0496105_0067510 Ga0496105_0067510_887_1738 265
322 3300048908 Ga0496105_0137711 Ga0496105_0137711_550_1446 265
323 3300048909 Ga0496106_0008180 Ga0496106_0008180_5238_6134 265
324 3300048909 Ga0496106_0240135 Ga0496106_0240135_352_1248 265
325 3300048910 Ga0496107_0010495 Ga0496107_0010495_1218_2114 265
326 3300048917 Ga0496114_0202854 Ga0496114_0202854_784_1680 265
327 3300048918 Ga0496115_0001590 Ga0496115_0001590_6389_7285 265
328 3300050491 nmdc:mga00v17_79865_c1 nmdc:mga00v17_79865_c1_1027_1875 265
329 iso_pu_bacteria 2513237146 2513929068 265
330 3300005329 Ga0070683_100302830 Ga0070683_1003028302 266
331 3300005435 Ga0070714_100025366 Ga0070714_1000253665 266
332 3300005563 Ga0068855_100347814 Ga0068855_1003478142 266
333 3300005719 Ga0068861_100508312 Ga0068861_1005083122 266
334 3300006852 Ga0075433_10017300 Ga0075433_100173003 266
335 3300006871 Ga0075434_100001633 Ga0075434_10000163312 266
336 3300006914 Ga0075436_100156370 Ga0075436_1001563702 266
337 3300007076 Ga0075435_100035677 Ga0075435_1000356773 266
338 3300009093 Ga0105240_10336732 Ga0105240_103367322 266
339 3300009551 Ga0105238_10139765 Ga0105238_101397653 266
340 3300013105 Ga0157369_10204052 Ga0157369_102040522 266
341 3300014497 Ga0182008_10035653 Ga0182008_100356532 266
342 3300015261 Ga0182006_1000005 Ga0182006_1000005421 266
343 3300015265 Ga0182005_1010468 Ga0182005_10104681 266
344 3300025913 Ga0207695_10112260 Ga0207695_101122603 266
345 3300025920 Ga0207649_10308604 Ga0207649_103086041 266
346 3300025924 Ga0207694_10018692 Ga0207694_100186923 266
347 3300025929 Ga0207664_10104343 Ga0207664_101043432 266
348 3300025944 Ga0207661_10317248 Ga0207661_103172482 266
349 3300031241 Ga0265325_10136992 Ga0265325_101369922 266
350 3300031712 Ga0265342_10075227 Ga0265342_100752272 266
351 3300037312 Ga0395899_0022054 Ga0395899_0022054_2117_2968 266
352 3300037418 Ga0395900_0019258 Ga0395900_0019258_3447_4298 266
353 3300037471 Ga0395905_0010620 Ga0395905_0010620_6333_7184 266
354 3300038443 Ga0395901_0001910 Ga0395901_0001910_15505_16356 266
355 3300045051 Ga0451576_0524834 Ga0451576_0524834_215_1105 266
356 3300045976 Ga0466967_0693530 Ga0466967_0693530_132_983 266
357 3300046452 Ga0495617_000016 Ga0495617_000016_90408_91253 266
358 3300046492 Ga0495585_0000007 Ga0495585_0000007_224927_225772 266
359 3300046513 Ga0495616_0000001 Ga0495616_0000001_772174_773040 266
360 3300046515 Ga0495620_0000078 Ga0495620_0000078_46854_47699 266
361 3300046518 Ga0495631_0000051 Ga0495631_0000051_16893_17738 266
362 3300046524 Ga0495648_0000584 Ga0495648_0000584_26928_27773 266
363 3300046616 Ga0495668_0009414 Ga0495668_0009414_3736_4581 266
364 3300046665 Ga0495661_0002549 Ga0495661_0002549_963_1808 266
365 3300046810 Ga0495660_0000025 Ga0495660_0000025_111040_111885 266
366 3300046810 Ga0495660_0058530 Ga0495660_0058530_547_1413 266
367 3300047469 Ga0495673_0000001 Ga0495673_0000001_352722_353567 266
368 3300047472 Ga0495686_0000037 Ga0495686_0000037_105884_106729 266
369 3300047472 Ga0495686_0029670 Ga0495686_0029670_596_1444 266
370 3300048924 Ga0496121_0000666 Ga0496121_0000666_51767_52612 266
371 3300049460 Ga0495682_0003698 Ga0495682_0003698_1563_2408 266
372 3300050512 nmdc:mga0n895_25655_c1 nmdc:mga0n895_25655_c1_3148_4020 266
373 3300050513 nmdc:mga0rr50_94778_c1 nmdc:mga0rr50_94778_c1_1065_1937 266
374 3300050514 nmdc:mga08x19_270916_c1 nmdc:mga08x19_270916_c1_128_1000 266
375 3300050515 nmdc:mga0a205_2343_c1 nmdc:mga0a205_2343_c1_4108_4980 266
376 3300053730 Ga0500645_002013 Ga0500645_002013_323_1168 266
377 iso_pu_bacteria 2593339198 2595315230 266
378 iso_pu_bacteria 2956897341 2956899596 266
379 iso_pu_bacteria 2980125574 2980126009 266
380 3300005328 Ga0070676_10067770 Ga0070676_100677701 267
381 3300005345 Ga0070692_10005282 Ga0070692_100052823 267
382 3300005536 Ga0070697_100069906 Ga0070697_1000699063 267
383 3300005844 Ga0068862_100020918 Ga0068862_1000209182 267
384 3300006881 Ga0068865_100039024 Ga0068865_1000390244 267
385 3300017792 Ga0163161_10001704 Ga0163161_1000170414 267
386 3300021361 Ga0213872_10000011 Ga0213872_1000001153 267
387 3300025934 Ga0207686_10178503 Ga0207686_101785032 267
388 3300025938 Ga0207704_10088623 Ga0207704_100886232 267
389 3300025941 Ga0207711_10321613 Ga0207711_103216132 267
390 3300031344 Ga0265316_10133322 Ga0265316_101333222 267
391 3300036401 Ga0373937_0000389 Ga0373937_0000389_37436_38311 267
392 3300037068 Ga0373925_0402810 Ga0373925_0402810_181_1086 267
393 3300037471 Ga0395905_0053882 Ga0395905_0053882_663_1565 267
394 3300037471 Ga0395905_0106981 Ga0395905_0106981_1538_2440 267
395 3300039447 Ga0436361_0296121 Ga0436361_0296121_30563_31414 267
396 3300041999 Ga0439433_0034573 Ga0439433_0034573_129_1031 267
397 3300044673 Ga0453683_0008771 Ga0453683_0008771_5484_6362 267
398 3300044842 Ga0466957_0194816 Ga0466957_0194816_114_965 267
399 3300046452 Ga0495617_001385 Ga0495617_001385_964_1812 267
400 3300046460 Ga0495638_0000044 Ga0495638_0000044_70860_71708 267
401 3300046501 Ga0495607_0000030 Ga0495607_0000030_14459_15307 267
402 3300046501 Ga0495607_0169378 Ga0495607_0169378_63_911 267
403 3300046506 Ga0495583_0014996 Ga0495583_0014996_713_1561 267
404 3300046538 Ga0495609_0018043 Ga0495609_0018043_1552_2400 267
405 3300046616 Ga0495668_0034110 Ga0495668_0034110_323_1171 267
406 3300046648 Ga0495611_0000001 Ga0495611_0000001_1550447_1551295 267
407 3300046660 Ga0495625_0000001 Ga0495625_0000001_364742_365590 267
408 3300046794 Ga0495589_0000172 Ga0495589_0000172_41130_41978 267
409 3300046810 Ga0495660_0000018 Ga0495660_0000018_132704_133552 267
410 3300047446 Ga0495679_000001 Ga0495679_000001_35660_36508 267
411 3300047469 Ga0495673_0000129 Ga0495673_0000129_2078_2926 267
412 3300047472 Ga0495686_0019170 Ga0495686_0019170_204_1052 267
413 3300049459 Ga0495678_000209 Ga0495678_000209_33799_34647 267
414 3300049460 Ga0495682_0023440 Ga0495682_0023440_183_1031 267
415 3300050515 nmdc:mga0a205_232460_c1 nmdc:mga0a205_232460_c1_866_1702 267
416 3300053087 Ga0500643_000002 Ga0500643_000002_270463_271311 267
417 3300053103 Ga0500555_011022 Ga0500555_011022_116_964 267
418 iso_pu_bacteria 2671180694 2673822346 267
419 3300005330 Ga0070690_100021725 Ga0070690_1000217253 268
420 3300005335 Ga0070666_10070951 Ga0070666_100709512 268
421 3300005336 Ga0070680_100005902 Ga0070680_1000059028 268
422 3300005343 Ga0070687_100003573 Ga0070687_1000035736 268
423 3300005347 Ga0070668_100008773 Ga0070668_1000087737 268
424 3300005367 Ga0070667_100003252 Ga0070667_10000325212 268
425 3300005441 Ga0070700_100021791 Ga0070700_1000217914 268
426 3300005457 Ga0070662_100178547 Ga0070662_1001785471 268
427 3300005459 Ga0068867_100006452 Ga0068867_1000064522 268
428 3300005530 Ga0070679_100017484 Ga0070679_1000174846 268
429 3300005539 Ga0068853_100063692 Ga0068853_1000636923 268
430 3300005543 Ga0070672_100001996 Ga0070672_1000019968 268
431 3300005543 Ga0070672_100120122 Ga0070672_1001201222 268
432 3300005564 Ga0070664_100298477 Ga0070664_1002984772 268
433 3300005616 Ga0068852_100404522 Ga0068852_1004045222 268
434 3300005618 Ga0068864_100166800 Ga0068864_1001668002 268
435 3300005618 Ga0068864_100214588 Ga0068864_1002145882 268
436 3300005718 Ga0068866_10093540 Ga0068866_100935401 268
437 3300005841 Ga0068863_100015935 Ga0068863_1000159358 268
438 3300005843 Ga0068860_100001260 Ga0068860_10000126019 268
439 3300006358 Ga0068871_100084481 Ga0068871_1000844813 268
440 3300006881 Ga0068865_100003521 Ga0068865_1000035213 268
441 3300009093 Ga0105240_10073822 Ga0105240_100738224 268
442 3300009098 Ga0105245_10160243 Ga0105245_101602431 268
443 3300009098 Ga0105245_10411442 Ga0105245_104114422 268
444 3300009148 Ga0105243_10081167 Ga0105243_100811672 268
445 3300009174 Ga0105241_10012353 Ga0105241_100123532 268
446 3300009176 Ga0105242_10008496 Ga0105242_100084969 268
447 3300009176 Ga0105242_10280733 Ga0105242_102807332 268
448 3300009177 Ga0105248_10000001 Ga0105248_100000011003 268
449 3300009177 Ga0105248_10207268 Ga0105248_102072682 268
450 3300009177 Ga0105248_10276378 Ga0105248_102763782 268
451 3300009553 Ga0105249_10065053 Ga0105249_100650533 268
452 3300013102 Ga0157371_10165609 Ga0157371_101656092 268
453 3300013306 Ga0163162_10007061 Ga0163162_100070619 268
454 3300013308 Ga0157375_10046761 Ga0157375_100467612 268
455 3300013308 Ga0157375_10129431 Ga0157375_101294312 268
456 3300014968 Ga0157379_10008941 Ga0157379_100089413 268
457 3300017792 Ga0163161_10037506 Ga0163161_100375063 268
458 3300025315 Ga0207697_10051159 Ga0207697_100511592 268
459 3300025899 Ga0207642_10003560 Ga0207642_100035605 268
460 3300025907 Ga0207645_10006705 Ga0207645_100067052 268
461 3300025908 Ga0207643_10096926 Ga0207643_100969262 268
462 3300025913 Ga0207695_10065151 Ga0207695_100651513 268
463 3300025917 Ga0207660_10008400 Ga0207660_100084008 268
464 3300025918 Ga0207662_10111956 Ga0207662_101119562 268
465 3300025921 Ga0207652_10289390 Ga0207652_102893901 268
466 3300025923 Ga0207681_10004364 Ga0207681_100043647 268
467 3300025925 Ga0207650_10001175 Ga0207650_100011759 268
468 3300025926 Ga0207659_10001653 Ga0207659_100016539 268
469 3300025926 Ga0207659_10010409 Ga0207659_100104095 268
470 3300025931 Ga0207644_10022651 Ga0207644_100226514 268
471 3300025937 Ga0207669_10068361 Ga0207669_100683612 268
472 3300025937 Ga0207669_10121610 Ga0207669_101216102 268
473 3300025940 Ga0207691_10285957 Ga0207691_102859572 268
474 3300025941 Ga0207711_10000001 Ga0207711_10000001868 268
475 3300025941 Ga0207711_10028527 Ga0207711_100285274 268
476 3300025941 Ga0207711_10070914 Ga0207711_100709143 268
477 3300025942 Ga0207689_10018156 Ga0207689_100181565 268
478 3300025960 Ga0207651_10250262 Ga0207651_102502622 268
479 3300025961 Ga0207712_10003405 Ga0207712_100034052 268
480 3300025972 Ga0207668_10017174 Ga0207668_100171742 268
481 3300025986 Ga0207658_10000458 Ga0207658_1000045818 268
482 3300026041 Ga0207639_10000591 Ga0207639_1000059122 268
483 3300026067 Ga0207678_10270576 Ga0207678_102705762 268
484 3300026078 Ga0207702_10403312 Ga0207702_104033122 268
485 3300026088 Ga0207641_10064300 Ga0207641_100643004 268
486 3300026095 Ga0207676_10066079 Ga0207676_100660793 268
487 3300028379 Ga0268266_10187533 Ga0268266_101875332 268
488 3300028381 Ga0268264_10000963 Ga0268264_1000096313 268
489 3300029957 Ga0265324_10009208 Ga0265324_100092083 268
490 3300031901 Ga0307406_10180862 Ga0307406_101808622 268
491 3300032002 Ga0307416_100024582 Ga0307416_1000245824 268
492 3300049571 Ga0501034_0076554 Ga0501034_0076554_1336_2220 268
493 3300049574 Ga0501038_0087246 Ga0501038_0087246_561_1445 268
494 3300049583 Ga0501067_0054764 Ga0501067_0054764_988_1881 268
495 3300049742 Ga0501080_0005029 Ga0501080_0005029_10068_10925 268
496 3300005564 Ga0070664_100178543 Ga0070664_1001785432 269
497 3300005617 Ga0068859_100028230 Ga0068859_1000282303 269
498 3300005981 Ga0081538_10003893 Ga0081538_100038939 269
499 3300006237 Ga0097621_100166980 Ga0097621_1001669802 269
500 3300006931 Ga0097620_100028228 Ga0097620_1000282283 269
501 3300014969 Ga0157376_10479691 Ga0157376_104796912 269
502 3300021384 Ga0213876_10000498 Ga0213876_1000049811 269
503 3300025944 Ga0207661_10138017 Ga0207661_101380172 269
504 3300026078 Ga0207702_10088165 Ga0207702_100881653 269
505 3300031456 Ga0307513_10002839 Ga0307513_100028394 269
506 3300035088 Ga0373940_0042610 Ga0373940_0042610_17_877 269
507 3300035695 Ga0373927_0000253 Ga0373927_0000253_33089_33982 269
508 3300035725 Ga0373947_0126801 Ga0373947_0126801_480_1373 269
509 3300037068 Ga0373925_0076400 Ga0373925_0076400_535_1395 269
510 3300037068 Ga0373925_0090657 Ga0373925_0090657_1374_2267 269
511 3300039437 Ga0436365_1234622 Ga0436365_1234622_110315_111217 269
512 3300042876 Ga0451577_0008808 Ga0451577_0008808_2244_3137 269
513 3300046455 Ga0495603_0014873 Ga0495603_0014873_3273_4133 269
514 3300046530 Ga0495654_0038759 Ga0495654_0038759_348_1208 269
515 3300046557 Ga0495622_0029916 Ga0495622_0029916_1004_1864 269
516 3300046648 Ga0495611_0070221 Ga0495611_0070221_695_1555 269
517 3300046683 Ga0495658_0001841 Ga0495658_0001841_5759_6631 269
518 3300046694 Ga0495649_0004336 Ga0495649_0004336_2958_3818 269
519 3300047320 Ga0495672_0005079 Ga0495672_0005079_6036_6896 269
520 3300053178 Ga0500637_0001230 Ga0500637_0001230_1532_2392 269
521 3300059421 Ga0590071_003216 Ga0590071_003216_2662_3570 269
522 iso_pu_bacteria 2734482264 2735837308 269
523 3300009174 Ga0105241_10186925 Ga0105241_101869252 270
524 3300017792 Ga0163161_10019256 Ga0163161_100192562 270
525 3300025253 Ga0209677_101153 Ga0209677_1011536 270
526 3300046506 Ga0495583_0000090 Ga0495583_0000090_31402_32337 270
527 3300046507 Ga0495606_0002085 Ga0495606_0002085_5921_6862 270
528 3300046512 Ga0495610_0016504 Ga0495610_0016504_1947_2852 270
529 3300046616 Ga0495668_0031488 Ga0495668_0031488_1151_2104 270
530 3300046660 Ga0495625_0004921 Ga0495625_0004921_7940_8872 270
531 3300046684 Ga0495669_0009832 Ga0495669_0009832_2288_3247 270
532 3300046694 Ga0495649_0000203 Ga0495649_0000203_32017_32952 270
533 3300046794 Ga0495589_0059301 Ga0495589_0059301_364_1311 270
534 3300048903 Ga0496100_0126992 Ga0496100_0126992_577_1440 270
535 3300048904 Ga0496101_0004321 Ga0496101_0004321_539_1402 270
536 iso_pu_bacteria 2718218334 2721027090 270
537 iso_pu_bacteria 2738543009 2739226781 270
538 3300003756 Ga0055533_1000043 Ga0055533_10000437 271
539 3300003759 Ga0055525_1001369 Ga0055525_10013692 271
540 3300025226 Ga0209674_100067 Ga0209674_1000677 271
541 3300025230 Ga0209563_100068 Ga0209563_1000687 271
542 3300025253 Ga0209677_100049 Ga0209677_100049154 271
543 iso_pu_bacteria 2884338543 2884341632 271
544 iso_pu_bacteria 2939611941 2939612839 271
545 3300006051 Ga0075364_10059375 Ga0075364_100593753 272
546 3300005441 Ga0070700_100083151 Ga0070700_1000831513 273
547 3300005459 Ga0068867_100015082 Ga0068867_1000150822 273
548 3300005471 Ga0070698_100166169 Ga0070698_1001661692 273
549 3300005840 Ga0068870_10135326 Ga0068870_101353262 273
550 3300009148 Ga0105243_10008704 Ga0105243_100087046 273
551 3300009174 Ga0105241_10259485 Ga0105241_102594852 273
552 3300009176 Ga0105242_10284951 Ga0105242_102849512 273
553 3300010375 Ga0105239_10047517 Ga0105239_100475172 273
554 3300013297 Ga0157378_10629721 Ga0157378_106297212 273
555 3300025907 Ga0207645_10003406 Ga0207645_100034065 273
556 3300025908 Ga0207643_10123898 Ga0207643_101238982 273
557 3300025934 Ga0207686_10084115 Ga0207686_100841152 273
558 3300025935 Ga0207709_10007930 Ga0207709_100079305 273
559 3300025938 Ga0207704_10115295 Ga0207704_101152952 273
560 3300026089 Ga0207648_10002148 Ga0207648_100021486 273
561 3300005331 Ga0070670_100011884 Ga0070670_1000118847 274
562 3300005333 Ga0070677_10028238 Ga0070677_100282381 274
563 3300005353 Ga0070669_100004868 Ga0070669_1000048682 274
564 3300005354 Ga0070675_100002590 Ga0070675_1000025902 274
565 3300005355 Ga0070671_100011411 Ga0070671_1000114115 274
566 3300005364 Ga0070673_100005879 Ga0070673_1000058792 274
567 3300005367 Ga0070667_100039804 Ga0070667_1000398043 274
568 3300005456 Ga0070678_100028588 Ga0070678_1000285884 274
569 3300005543 Ga0070672_100005492 Ga0070672_1000054922 274
570 3300005564 Ga0070664_100146368 Ga0070664_1001463682 274
571 3300005841 Ga0068863_100267206 Ga0068863_1002672062 274
572 3300006237 Ga0097621_100053668 Ga0097621_1000536682 274
573 3300006358 Ga0068871_100025405 Ga0068871_1000254053 274
574 3300014326 Ga0157380_10062408 Ga0157380_100624083 274
575 3300014969 Ga0157376_10122498 Ga0157376_101224982 274
576 3300015687 Ga0183368_1004 Ga0183368_1004245 274
577 3300025893 Ga0207682_10000873 Ga0207682_1000087315 274
578 3300025923 Ga0207681_10007115 Ga0207681_100071152 274
579 3300025925 Ga0207650_10020978 Ga0207650_100209782 274
580 3300025926 Ga0207659_10002446 Ga0207659_100024465 274
581 3300025931 Ga0207644_10004577 Ga0207644_100045777 274
582 3300025940 Ga0207691_10021975 Ga0207691_100219753 274
583 3300025945 Ga0207679_10118291 Ga0207679_101182912 274
584 3300025960 Ga0207651_10001133 Ga0207651_1000113312 274
585 3300025972 Ga0207668_10146968 Ga0207668_101469681 274
586 3300025986 Ga0207658_10072107 Ga0207658_100721073 274
587 3300026121 Ga0207683_10001702 Ga0207683_100017022 274
588 3300046457 Ga0495590_0003984 Ga0495590_0003984_2492_3466 274
589 3300048918 Ga0496115_0000024 Ga0496115_0000024_118652_119503 274
590 3300050509 nmdc:mga0qj67_323760_c1 nmdc:mga0qj67_323760_c1_145_1035 274
591 3300005331 Ga0070670_100000010 Ga0070670_100000010119 275
592 3300005337 Ga0070682_100339492 Ga0070682_1003394921 275
593 3300005345 Ga0070692_10083577 Ga0070692_100835772 275
594 3300005435 Ga0070714_100000020 Ga0070714_10000002075 275
595 3300005457 Ga0070662_100004570 Ga0070662_1000045703 275
596 3300005539 Ga0068853_100074261 Ga0068853_1000742612 275
597 3300005614 Ga0068856_100087084 Ga0068856_1000870842 275
598 3300009551 Ga0105238_10089051 Ga0105238_100890512 275
599 3300010375 Ga0105239_10211780 Ga0105239_102117802 275
600 3300013100 Ga0157373_10064238 Ga0157373_100642383 275
601 3300025904 Ga0207647_10027938 Ga0207647_100279383 275
602 3300025919 Ga0207657_10014891 Ga0207657_100148917 275
603 3300025924 Ga0207694_10036656 Ga0207694_100366562 275
604 3300025929 Ga0207664_10000023 Ga0207664_10000023109 275
605 3300025932 Ga0207690_10001386 Ga0207690_100013869 275
606 3300025933 Ga0207706_10006952 Ga0207706_100069527 275
607 3300025949 Ga0207667_10029251 Ga0207667_100292513 275
608 3300026041 Ga0207639_10082227 Ga0207639_100822272 275
609 3300026116 Ga0207674_10102952 Ga0207674_101029522 275
610 3300049585 Ga0501069_0041850 Ga0501069_0041850_1243_2124 275
611 3300049586 Ga0501070_0113972 Ga0501070_0113972_746_1627 275
612 3300049590 Ga0501074_0004341 Ga0501074_0004341_2196_3077 275
613 3300049742 Ga0501080_0024247 Ga0501080_0024247_3732_4613 275
614 3300049822 Ga0501035_0063469 Ga0501035_0063469_1747_2628 275
615 3300003316 rootH1_10003874 rootH1_100038742 276
616 3300049742 Ga0501080_0240181 Ga0501080_0240181_539_1402 276
617 3300049572 Ga0501036_0174659 Ga0501036_0174659_786_1649 277
618 3300049573 Ga0501037_0080203 Ga0501037_0080203_1305_2168 277
619 3300049822 Ga0501035_0111966 Ga0501035_0111966_1044_1907 277
620 3300049571 Ga0501034_0461379 Ga0501034_0461379_270_1133 278
621 3300001915 JGI24741J21665_1002176 JGI24741J21665_10021765 279
622 3300001915 JGI24741J21665_1003052 JGI24741J21665_10030522 279
623 3300001979 JGI24740J21852_10000633 JGI24740J21852_100006332 279
624 3300001979 JGI24740J21852_10000975 JGI24740J21852_1000097511 279
625 3300002737 JGI25162J39368_1000871 JGI25162J39368_10008717 279
626 3300002772 JGI25164J39214_1000476 JGI25164J39214_10004767 279
627 3300003214 JGI25165J46597_1000591 JGI25165J46597_100059123 279
628 3300004800 Ga0058861_11977762 Ga0058861_119777621 279
629 3300005337 Ga0070682_100038340 Ga0070682_1000383403 279
630 3300005337 Ga0070682_100056911 Ga0070682_1000569112 279
631 3300005339 Ga0070660_100182697 Ga0070660_1001826971 279
632 3300005341 Ga0070691_10214288 Ga0070691_102142881 279
633 3300005366 Ga0070659_100540755 Ga0070659_1005407551 279
634 3300005455 Ga0070663_100235751 Ga0070663_1002357512 279
635 3300005535 Ga0070684_100112339 Ga0070684_1001123392 279
636 3300005546 Ga0070696_100013276 Ga0070696_1000132764 279
637 3300005546 Ga0070696_100054776 Ga0070696_1000547762 279
638 3300005547 Ga0070693_100013748 Ga0070693_1000137483 279
639 3300005564 Ga0070664_100425598 Ga0070664_1004255982 279
640 3300005577 Ga0068857_100160240 Ga0068857_1001602402 279
641 3300005616 Ga0068852_100002597 Ga0068852_10000259711 279
642 3300005834 Ga0068851_10052235 Ga0068851_100522352 279
643 3300005834 Ga0068851_10149980 Ga0068851_101499802 279
644 3300009545 Ga0105237_10114647 Ga0105237_101146472 279
645 3300009551 Ga0105238_10017135 Ga0105238_100171355 279
646 3300013100 Ga0157373_10318311 Ga0157373_103183112 279
647 3300013104 Ga0157370_10000778 Ga0157370_1000077831 279
648 3300013105 Ga0157369_10183991 Ga0157369_101839913 279
649 3300013307 Ga0157372_10142858 Ga0157372_101428582 279
650 3300020070 Ga0206356_10310333 Ga0206356_103103333 279
651 3300020078 Ga0206352_10691678 Ga0206352_106916782 279
652 3300020081 Ga0206354_10374811 Ga0206354_103748112 279
653 3300020082 Ga0206353_10342466 Ga0206353_103424663 279
654 3300020610 Ga0154015_1173610 Ga0154015_11736104 279
655 3300025231 Ga0207427_100111 Ga0207427_10011114 279
656 3300025233 Ga0209437_100223 Ga0209437_10022335 279
657 3300025261 Ga0209233_1000272 Ga0209233_100027210 279
658 3300025321 Ga0207656_10016237 Ga0207656_100162373 279
659 3300025904 Ga0207647_10001393 Ga0207647_1000139312 279
660 3300025904 Ga0207647_10011267 Ga0207647_100112674 279
661 3300025909 Ga0207705_10002720 Ga0207705_100027208 279
662 3300025909 Ga0207705_10061090 Ga0207705_100610903 279
663 3300025912 Ga0207707_10008190 Ga0207707_100081903 279
664 3300025912 Ga0207707_10095721 Ga0207707_100957212 279
665 3300025913 Ga0207695_10110997 Ga0207695_101109973 279
666 3300025914 Ga0207671_10143383 Ga0207671_101433832 279
667 3300025917 Ga0207660_10012966 Ga0207660_100129664 279
668 3300025917 Ga0207660_10018270 Ga0207660_100182702 279
669 3300025919 Ga0207657_10013655 Ga0207657_100136558 279
670 3300025919 Ga0207657_10060782 Ga0207657_100607822 279
671 3300025920 Ga0207649_10022015 Ga0207649_100220153 279
672 3300025920 Ga0207649_10083812 Ga0207649_100838122 279
673 3300025921 Ga0207652_10007462 Ga0207652_100074623 279
674 3300025921 Ga0207652_10062375 Ga0207652_100623753 279
675 3300025921 Ga0207652_10066093 Ga0207652_100660933 279
676 3300025924 Ga0207694_10049082 Ga0207694_100490822 279
677 3300025932 Ga0207690_10007323 Ga0207690_100073234 279
678 3300025932 Ga0207690_10023064 Ga0207690_100230643 279
679 3300025932 Ga0207690_10024720 Ga0207690_100247203 279
680 3300025933 Ga0207706_10026518 Ga0207706_100265183 279
681 3300025944 Ga0207661_10135201 Ga0207661_101352012 279
682 3300025945 Ga0207679_10428295 Ga0207679_104282952 279
683 3300025949 Ga0207667_10008462 Ga0207667_100084629 279
684 3300025949 Ga0207667_10037782 Ga0207667_100377824 279
685 3300025949 Ga0207667_10051115 Ga0207667_100511153 279
686 3300025981 Ga0207640_10050390 Ga0207640_100503903 279
687 3300026041 Ga0207639_10004906 Ga0207639_100049066 279
688 3300026041 Ga0207639_10024341 Ga0207639_100243413 279
689 3300026067 Ga0207678_10010644 Ga0207678_100106448 279
690 3300026078 Ga0207702_10029705 Ga0207702_100297056 279
691 3300026078 Ga0207702_10073135 Ga0207702_100731353 279
692 3300026116 Ga0207674_10015601 Ga0207674_100156018 279
693 3300026116 Ga0207674_10016923 Ga0207674_100169238 279
694 3300026142 Ga0207698_10004762 Ga0207698_100047627 279
695 3300026142 Ga0207698_10009095 Ga0207698_100090953 279
696 3300026142 Ga0207698_10011035 Ga0207698_100110354 279
697 3300037312 Ga0395899_0023376 Ga0395899_0023376_400_1263 279
698 3300037466 Ga0395898_0035060 Ga0395898_0035060_765_1628 279
699 3300038443 Ga0395901_0092957 Ga0395901_0092957_753_1616 279
700 3300049581 Ga0501047_0009987 Ga0501047_0009987_6825_7688 279
701 3300049586 Ga0501070_0035616 Ga0501070_0035616_1559_2422 279
702 3300049590 Ga0501074_0035709 Ga0501074_0035709_786_1649 279
703 3300049742 Ga0501080_0052659 Ga0501080_0052659_2027_2890 279
704 3300049822 Ga0501035_0002475 Ga0501035_0002475_14237_15100 279
705 3300049823 Ga0501044_0015835 Ga0501044_0015835_2224_3087 279

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

99

309

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cad-assembly1.cif.gz_A mycobacterium smegmatis sugabc complex 0.8557 13 271
2onk-assembly2.cif.gz_I abc transporter modbc in complex with its binding protein moda 0.8394 15 267
4tqv-assembly4.cif.gz_M crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate 0.8258 13 274
2onk-assembly2.cif.gz_I abc transporter modbc in complex with its binding protein moda 0.8245 15 267
3d31-assembly1.cif.gz_C modbc from methanosarcina acetivorans 0.8244 16 267
ID Description Score Start End Superfamily
af_P71746_10_267_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8787 24 277 1.10.3720.10
af_P0AEB0_20_277_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8744 20 274 1.10.3720.10
af_P71746_10_267_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8632 24 277 1.10.3720.10
af_P0AEB0_20_277_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8621 20 274 1.10.3720.10
af_P71745_27_277_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8613 22 277 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A257X9A8-F1-model_v4 Sulfate ABC transporter permease subunit CysW 0.9104 8 215 GO:0005886
GO:0015419
AF-A0A844GTP6-F1-model_v4 Sulfate ABC transporter permease subunit CysW 0.9043 13 279 GO:0005886
GO:0015419
AF-A0A532B2R8-F1-model_v4 Sulfate ABC transporter permease subunit CysW 0.9043 15 227 GO:0005886
GO:0015419
AF-A0A7X7RG91-F1-model_v4 Sulfate ABC transporter permease subunit CysW 0.9031 15 274 GO:0005886
GO:0015419
AF-A0A0H4W0X4-F1-model_v4 deleted 0.8996 15 274

Feature Viewer

pLDDT pTM Quality
78.92 0.68 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map