F476408
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 705 | 329 | 695 | 281 |
Family's Representative Sequence
| Representative Sequence | 3300029957|Ga0265324_10009208|Ga0265324_100092083 |
| Length | 316 |
| Sequence | MVGWPVPCLPQLTMQPTVINPTLPTVPRRSTSESAAVRWLLIGTALAFMGLFLVLPLVSVFIQAFGKGLGFYLHMLADPLTLSALKLTVIAAAFAVPLNCVFGVAAAWAITKFDFRGKQLLLTLIDLPFSVSPVISGLIYVLVFGLQGWLGQYENADHPWFPWFQNWLNNHDIKIIFAVPGIVLATIFVTFPFVARELIPLMEAQGKSEEEAARVLGASGWQIFWRVTMPNIKWGLLYGVILCNARAMGEFGAVSVVSGHIRGVTDTLPLHIEVLYNEYNFTGAFAVASLLSLLGLVTLVVKSWVEYKNAAESPEA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 2 | 2593339198 | Paenibacillus sp. UNCCL117 | Isolate | Unclassified |
| 3 | 2671180694 | Paenibacillus sp. A3 | Isolate | Unclassified |
| 4 | 2718218334 | Luteibacter rhizovicinus LJ96 | Isolate | Rhizosphere |
| 5 | 2734482264 | Dyella sp. AD052 | Isolate | Unclassified |
| 6 | 2738543009 | Luteibacter sp. OK325 | Isolate | Unclassified |
| 7 | 2884338543 | Luteibacter pinisoli MAH-14 | Isolate | Rhizosphere |
| 8 | 2939611941 | Rhodanobacter soli 1757 | Isolate | Rhizosphere |
| 9 | 2956897341 | Ectobacillus funiculus W18-2 | Isolate | Rhizosphere |
| 10 | 2980125574 | Paenibacillus sp. tmac-D7 | Isolate | Unclassified |
| 11 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 12 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 13 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 14 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 15 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 16 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 17 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 18 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 20 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 30 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 53 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 59 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 65 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 67 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 68 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 70 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 71 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 72 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 73 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 74 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 75 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 76 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 77 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 78 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 79 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 80 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 81 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 82 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 84 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 85 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 86 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 87 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 88 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 90 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 115 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 118 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 119 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 120 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 123 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 125 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 126 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 127 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 128 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 129 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 135 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 198 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 199 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 200 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 201 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 202 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 203 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 204 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 205 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 206 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 207 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 208 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 209 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 210 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 211 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 212 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 213 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 214 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 215 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 216 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 217 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 218 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 219 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 220 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 221 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 222 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 223 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 224 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 225 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 226 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 227 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 228 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 229 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 230 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 231 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 232 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 233 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 234 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 235 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 236 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 237 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 238 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 239 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 240 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 241 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 242 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 279 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 280 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 281 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 282 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 283 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 284 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 285 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 286 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 287 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 288 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 289 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 290 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 291 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 316 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 323 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 324 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 325 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 326 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 327 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 328 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 329 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.73 |
| Metatranscriptomes | 0.85 |
| Isolates | 1.42 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.11 |
| Nodule | 0.14 |
| Rhizoplane | 2.41 |
| Rhizosphere | 90.92 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.41 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1002176 | 3300001915 | Bacteria | 5206 |
| 2 | JGI24741J21665_1003052 | 3300001915 | Bacteria | 4130 |
| 3 | JGI24741J21665_1004654 | 3300001915 | Bacteria | 2998 |
| 4 | JGI24740J21852_10000633 | 3300001979 | Bacteria | 15172 |
| 5 | JGI24740J21852_10000975 | 3300001979 | Bacteria | 12770 |
| 6 | JGI25162J39368_1000871 | 3300002737 | Bacteria | 19773 |
| 7 | JGI25164J39214_1000476 | 3300002772 | Bacteria | 19773 |
| 8 | JGI25165J46597_1000080 | 3300003214 | Bacteria | 176649 |
| 9 | JGI25165J46597_1000591 | 3300003214 | Bacteria | 31247 |
| 10 | rootH1_10003874 | 3300003316 | Bacteria | 1617 |
| 11 | Ga0055533_1000043 | 3300003756 | Bacteria | 229262 |
| 12 | Ga0055533_1000667 | 3300003756 | Bacteria | 11379 |
| 13 | Ga0055525_1001369 | 3300003759 | Bacteria | 4668 |
| 14 | Ga0058861_11977762 | 3300004800 | Bacteria | 1022 |
| 15 | Ga0070658_10046904 | 3300005327 | Bacteria | 3496 |
| 16 | Ga0070658_10087981 | 3300005327 | Bacteria | 2557 |
| 17 | Ga0070658_10151442 | 3300005327 | Bacteria | 1942 |
| 18 | Ga0070676_10067770 | 3300005328 | Bacteria | 2135 |
| 19 | Ga0070683_100016971 | 3300005329 | Bacteria | 6426 |
| 20 | Ga0070683_100302830 | 3300005329 | Bacteria | 1521 |
| 21 | Ga0070690_100021725 | 3300005330 | Bacteria | 3921 |
| 22 | Ga0070690_100205882 | 3300005330 | Bacteria | 1371 |
| 23 | Ga0070670_100000010 | 3300005331 | Bacteria | 277365 |
| 24 | Ga0070670_100011884 | 3300005331 | Bacteria | 7445 |
| 25 | Ga0070670_100099465 | 3300005331 | Bacteria | 2503 |
| 26 | Ga0070670_100136041 | 3300005331 | Bacteria | 2123 |
| 27 | Ga0070677_10028238 | 3300005333 | Bacteria | 2118 |
| 28 | Ga0070666_10001402 | 3300005335 | Bacteria | 14566 |
| 29 | Ga0070666_10070951 | 3300005335 | Bacteria | 2370 |
| 30 | Ga0070680_100004255 | 3300005336 | Bacteria | 10748 |
| 31 | Ga0070680_100005902 | 3300005336 | Bacteria | 9301 |
| 32 | Ga0070680_100218960 | 3300005336 | Bacteria | 1606 |
| 33 | Ga0070682_100005201 | 3300005337 | Bacteria | 7239 |
| 34 | Ga0070682_100038340 | 3300005337 | Bacteria | 2939 |
| 35 | Ga0070682_100056911 | 3300005337 | Bacteria | 2461 |
| 36 | Ga0070682_100339492 | 3300005337 | Bacteria | 1116 |
| 37 | Ga0068868_100009112 | 3300005338 | Bacteria | 7126 |
| 38 | Ga0070660_100004136 | 3300005339 | Bacteria | 10017 |
| 39 | Ga0070660_100165700 | 3300005339 | Bacteria | 1783 |
| 40 | Ga0070660_100182697 | 3300005339 | Bacteria | 1697 |
| 41 | Ga0070689_100004487 | 3300005340 | Bacteria | 9440 |
| 42 | Ga0070691_10006919 | 3300005341 | Bacteria | 5190 |
| 43 | Ga0070691_10214288 | 3300005341 | Bacteria | 1017 |
| 44 | Ga0070687_100003573 | 3300005343 | Bacteria | 6059 |
| 45 | Ga0070661_100261996 | 3300005344 | Bacteria | 1337 |
| 46 | Ga0070692_10005282 | 3300005345 | Bacteria | 5485 |
| 47 | Ga0070692_10083577 | 3300005345 | Bacteria | 1724 |
| 48 | Ga0070668_100008773 | 3300005347 | Bacteria | 7508 |
| 49 | Ga0070669_100004868 | 3300005353 | Bacteria | 9689 |
| 50 | Ga0070675_100002590 | 3300005354 | Bacteria | 13558 |
| 51 | Ga0070675_100020130 | 3300005354 | Bacteria | 5324 |
| 52 | Ga0070675_100220854 | 3300005354 | Bacteria | 1650 |
| 53 | Ga0070671_100011411 | 3300005355 | Bacteria | 7144 |
| 54 | Ga0070673_100005879 | 3300005364 | Bacteria | 7913 |
| 55 | Ga0070659_100089929 | 3300005366 | Bacteria | 2460 |
| 56 | Ga0070659_100540755 | 3300005366 | Bacteria | 996 |
| 57 | Ga0070667_100003252 | 3300005367 | Bacteria | 13886 |
| 58 | Ga0070667_100039804 | 3300005367 | Bacteria | 3940 |
| 59 | Ga0070714_100000020 | 3300005435 | Bacteria | 169262 |
| 60 | Ga0070714_100025366 | 3300005435 | Bacteria | 4892 |
| 61 | Ga0070711_100007824 | 3300005439 | Bacteria | 6513 |
| 62 | Ga0070705_100011094 | 3300005440 | Bacteria | 4533 |
| 63 | Ga0070700_100021791 | 3300005441 | Bacteria | 3728 |
| 64 | Ga0070700_100083151 | 3300005441 | Bacteria | 2072 |
| 65 | Ga0070694_100034546 | 3300005444 | Bacteria | 3335 |
| 66 | Ga0070663_100002230 | 3300005455 | Bacteria | 10844 |
| 67 | Ga0070663_100011142 | 3300005455 | Bacteria | 5630 |
| 68 | Ga0070663_100235751 | 3300005455 | Bacteria | 1442 |
| 69 | Ga0070678_100022994 | 3300005456 | Bacteria | 4145 |
| 70 | Ga0070678_100028588 | 3300005456 | Bacteria | 3805 |
| 71 | Ga0070662_100004570 | 3300005457 | Bacteria | 8764 |
| 72 | Ga0070662_100178547 | 3300005457 | Bacteria | 1672 |
| 73 | Ga0070681_10004454 | 3300005458 | Bacteria | 13341 |
| 74 | Ga0070681_10030948 | 3300005458 | Bacteria | 5372 |
| 75 | Ga0070681_10078792 | 3300005458 | Bacteria | 3252 |
| 76 | Ga0070681_10120607 | 3300005458 | Bacteria | 2557 |
| 77 | Ga0070681_10123174 | 3300005458 | Bacteria | 2525 |
| 78 | Ga0070681_10142810 | 3300005458 | Bacteria | 2323 |
| 79 | Ga0068867_100006452 | 3300005459 | Bacteria | 8283 |
| 80 | Ga0068867_100015082 | 3300005459 | Bacteria | 5479 |
| 81 | Ga0070685_10008770 | 3300005466 | Bacteria | 5207 |
| 82 | Ga0070698_100166169 | 3300005471 | Bacteria | 2150 |
| 83 | Ga0070679_100004157 | 3300005530 | Bacteria | 13341 |
| 84 | Ga0070679_100017484 | 3300005530 | Bacteria | 6941 |
| 85 | Ga0070679_100043671 | 3300005530 | Bacteria | 4463 |
| 86 | Ga0070679_100055385 | 3300005530 | Bacteria | 3949 |
| 87 | Ga0070679_100132245 | 3300005530 | Bacteria | 2476 |
| 88 | Ga0070684_100014623 | 3300005535 | Bacteria | 6365 |
| 89 | Ga0070684_100112339 | 3300005535 | Bacteria | 2444 |
| 90 | Ga0070697_100069906 | 3300005536 | Bacteria | 2877 |
| 91 | Ga0068853_100005744 | 3300005539 | Bacteria | 9766 |
| 92 | Ga0068853_100063692 | 3300005539 | Bacteria | 3194 |
| 93 | Ga0068853_100074261 | 3300005539 | Bacteria | 2967 |
| 94 | Ga0070672_100001996 | 3300005543 | Bacteria | 12809 |
| 95 | Ga0070672_100005492 | 3300005543 | Bacteria | 8407 |
| 96 | Ga0070672_100120122 | 3300005543 | Bacteria | 2150 |
| 97 | Ga0070672_100205301 | 3300005543 | Bacteria | 1649 |
| 98 | Ga0070672_100540562 | 3300005543 | Bacteria | 1011 |
| 99 | Ga0070696_100013276 | 3300005546 | Bacteria | 5525 |
| 100 | Ga0070696_100054776 | 3300005546 | Bacteria | 2780 |
| 101 | Ga0070693_100000948 | 3300005547 | Bacteria | 12879 |
| 102 | Ga0070693_100013748 | 3300005547 | Bacteria | 4131 |
| 103 | Ga0070665_100696753 | 3300005548 | Bacteria | 1029 |
| 104 | Ga0070704_100102446 | 3300005549 | Bacteria | 2160 |
| 105 | Ga0068855_100004225 | 3300005563 | Bacteria | 17534 |
| 106 | Ga0068855_100019435 | 3300005563 | Bacteria | 8162 |
| 107 | Ga0068855_100126419 | 3300005563 | Bacteria | 2923 |
| 108 | Ga0068855_100347814 | 3300005563 | Bacteria | 1633 |
| 109 | Ga0070664_100146368 | 3300005564 | Bacteria | 2084 |
| 110 | Ga0070664_100178543 | 3300005564 | Bacteria | 1886 |
| 111 | Ga0070664_100298477 | 3300005564 | Bacteria | 1455 |
| 112 | Ga0070664_100425598 | 3300005564 | Bacteria | 1217 |
| 113 | Ga0070664_100575969 | 3300005564 | Bacteria | 1043 |
| 114 | Ga0068857_100004590 | 3300005577 | Bacteria | 11694 |
| 115 | Ga0068857_100019781 | 3300005577 | Bacteria | 5915 |
| 116 | Ga0068857_100160240 | 3300005577 | Bacteria | 2041 |
| 117 | Ga0068856_100000400 | 3300005614 | Bacteria | 47424 |
| 118 | Ga0068856_100087084 | 3300005614 | Bacteria | 3104 |
| 119 | Ga0068856_100131680 | 3300005614 | Bacteria | 2506 |
| 120 | Ga0070702_100052808 | 3300005615 | Bacteria | 2332 |
| 121 | Ga0068852_100002597 | 3300005616 | Bacteria | 12479 |
| 122 | Ga0068852_100404522 | 3300005616 | Bacteria | 1343 |
| 123 | Ga0068859_100028230 | 3300005617 | Bacteria | 5625 |
| 124 | Ga0068864_100104976 | 3300005618 | Bacteria | 2511 |
| 125 | Ga0068864_100166800 | 3300005618 | Bacteria | 2005 |
| 126 | Ga0068864_100214588 | 3300005618 | Bacteria | 1773 |
| 127 | Ga0068864_100632456 | 3300005618 | Bacteria | 1041 |
| 128 | Ga0068866_10053389 | 3300005718 | Bacteria | 2066 |
| 129 | Ga0068866_10093540 | 3300005718 | Bacteria | 1642 |
| 130 | Ga0068861_100097724 | 3300005719 | Bacteria | 2330 |
| 131 | Ga0068861_100258396 | 3300005719 | Bacteria | 1490 |
| 132 | Ga0068861_100508312 | 3300005719 | Bacteria | 1090 |
| 133 | Ga0068851_10052235 | 3300005834 | Bacteria | 2078 |
| 134 | Ga0068851_10149980 | 3300005834 | Bacteria | 1274 |
| 135 | Ga0068870_10135326 | 3300005840 | Bacteria | 1436 |
| 136 | Ga0068863_100015935 | 3300005841 | Bacteria | 7209 |
| 137 | Ga0068863_100267206 | 3300005841 | Bacteria | 1655 |
| 138 | Ga0068858_100014648 | 3300005842 | Bacteria | 7385 |
| 139 | Ga0068860_100001260 | 3300005843 | Bacteria | 27630 |
| 140 | Ga0068860_100015154 | 3300005843 | Bacteria | 7531 |
| 141 | Ga0068860_100112190 | 3300005843 | Bacteria | 2607 |
| 142 | Ga0068860_100667781 | 3300005843 | Bacteria | 1048 |
| 143 | Ga0068862_100020918 | 3300005844 | Bacteria | 5466 |
| 144 | Ga0068862_100580744 | 3300005844 | Bacteria | 1074 |
| 145 | Ga0081538_10003893 | 3300005981 | Bacteria | 13942 |
| 146 | Ga0075364_10059375 | 3300006051 | Bacteria | 2507 |
| 147 | Ga0097621_100007337 | 3300006237 | Bacteria | 7881 |
| 148 | Ga0097621_100053668 | 3300006237 | Bacteria | 3285 |
| 149 | Ga0097621_100111291 | 3300006237 | Bacteria | 2314 |
| 150 | Ga0097621_100166980 | 3300006237 | Bacteria | 1895 |
| 151 | Ga0097621_100236125 | 3300006237 | Bacteria | 1597 |
| 152 | Ga0068871_100025405 | 3300006358 | Bacteria | 4609 |
| 153 | Ga0068871_100084481 | 3300006358 | Bacteria | 2634 |
| 154 | Ga0068871_100113169 | 3300006358 | Bacteria | 2285 |
| 155 | Ga0075433_10017300 | 3300006852 | Bacteria | 5968 |
| 156 | Ga0075434_100001633 | 3300006871 | Bacteria | 19087 |
| 157 | Ga0068865_100003521 | 3300006881 | Bacteria | 9386 |
| 158 | Ga0068865_100039024 | 3300006881 | Bacteria | 3219 |
| 159 | Ga0068865_100062498 | 3300006881 | Bacteria | 2614 |
| 160 | Ga0068865_100082760 | 3300006881 | Bacteria | 2308 |
| 161 | Ga0075436_100156370 | 3300006914 | Bacteria | 1606 |
| 162 | Ga0075436_100353419 | 3300006914 | Bacteria | 1059 |
| 163 | Ga0097620_100028228 | 3300006931 | Bacteria | 5625 |
| 164 | Ga0075435_100035677 | 3300007076 | Bacteria | 3947 |
| 165 | Ga0105240_10001676 | 3300009093 | Bacteria | 37586 |
| 166 | Ga0105240_10073822 | 3300009093 | Bacteria | 4212 |
| 167 | Ga0105240_10100373 | 3300009093 | Bacteria | 3522 |
| 168 | Ga0105240_10251256 | 3300009093 | Bacteria | 2045 |
| 169 | Ga0105240_10336732 | 3300009093 | Bacteria | 1715 |
| 170 | Ga0111539_10012876 | 3300009094 | Bacteria | 10468 |
| 171 | Ga0111539_10111025 | 3300009094 | Bacteria | 3217 |
| 172 | Ga0111539_10142886 | 3300009094 | Bacteria | 2802 |
| 173 | Ga0105245_10160243 | 3300009098 | Bacteria | 2134 |
| 174 | Ga0105245_10411442 | 3300009098 | Bacteria | 1354 |
| 175 | Ga0105247_10061763 | 3300009101 | Bacteria | 2323 |
| 176 | Ga0105247_10095814 | 3300009101 | Bacteria | 1890 |
| 177 | Ga0105243_10008704 | 3300009148 | Bacteria | 7781 |
| 178 | Ga0105243_10081167 | 3300009148 | Bacteria | 2647 |
| 179 | Ga0105241_10001696 | 3300009174 | Bacteria | 16746 |
| 180 | Ga0105241_10012353 | 3300009174 | Bacteria | 6263 |
| 181 | Ga0105241_10097829 | 3300009174 | Bacteria | 2327 |
| 182 | Ga0105241_10127040 | 3300009174 | Bacteria | 2060 |
| 183 | Ga0105241_10186925 | 3300009174 | Bacteria | 1722 |
| 184 | Ga0105241_10259485 | 3300009174 | Bacteria | 1476 |
| 185 | Ga0105242_10008496 | 3300009176 | Bacteria | 7886 |
| 186 | Ga0105242_10023556 | 3300009176 | Bacteria | 4851 |
| 187 | Ga0105242_10123992 | 3300009176 | Bacteria | 2221 |
| 188 | Ga0105242_10280733 | 3300009176 | Bacteria | 1512 |
| 189 | Ga0105242_10284951 | 3300009176 | Bacteria | 1502 |
| 190 | Ga0105242_10291619 | 3300009176 | Bacteria | 1486 |
| 191 | Ga0105248_10000001 | 3300009177 | Bacteria | 1881304 |
| 192 | Ga0105248_10207268 | 3300009177 | Bacteria | 2209 |
| 193 | Ga0105248_10276378 | 3300009177 | Bacteria | 1891 |
| 194 | Ga0105248_10679427 | 3300009177 | Bacteria | 1162 |
| 195 | Ga0105248_10806235 | 3300009177 | Bacteria | 1060 |
| 196 | Ga0105237_10046750 | 3300009545 | Bacteria | 4353 |
| 197 | Ga0105237_10114647 | 3300009545 | Bacteria | 2688 |
| 198 | Ga0105238_10009736 | 3300009551 | Bacteria | 9624 |
| 199 | Ga0105238_10017135 | 3300009551 | Bacteria | 7354 |
| 200 | Ga0105238_10043434 | 3300009551 | Bacteria | 4548 |
| 201 | Ga0105238_10044626 | 3300009551 | Bacteria | 4481 |
| 202 | Ga0105238_10089051 | 3300009551 | Bacteria | 3073 |
| 203 | Ga0105238_10139765 | 3300009551 | Bacteria | 2399 |
| 204 | Ga0105249_10065053 | 3300009553 | Bacteria | 3353 |
| 205 | Ga0105239_10026373 | 3300010375 | Bacteria | 6395 |
| 206 | Ga0105239_10047517 | 3300010375 | Bacteria | 4704 |
| 207 | Ga0105239_10048947 | 3300010375 | Bacteria | 4634 |
| 208 | Ga0105239_10211780 | 3300010375 | Bacteria | 2172 |
| 209 | Ga0105239_10377856 | 3300010375 | Bacteria | 1602 |
| 210 | Ga0105246_10041703 | 3300011119 | Bacteria | 3104 |
| 211 | Ga0105246_10108142 | 3300011119 | Bacteria | 2038 |
| 212 | Ga0157373_10064238 | 3300013100 | Bacteria | 2599 |
| 213 | Ga0157373_10199881 | 3300013100 | Bacteria | 1409 |
| 214 | Ga0157373_10318311 | 3300013100 | Bacteria | 1106 |
| 215 | Ga0157371_10046698 | 3300013102 | Bacteria | 3080 |
| 216 | Ga0157371_10165609 | 3300013102 | Bacteria | 1579 |
| 217 | Ga0157370_10000778 | 3300013104 | Bacteria | 39997 |
| 218 | Ga0157370_10001994 | 3300013104 | Bacteria | 25102 |
| 219 | Ga0157370_10005673 | 3300013104 | Bacteria | 13953 |
| 220 | Ga0157370_10179040 | 3300013104 | Bacteria | 1970 |
| 221 | Ga0157369_10003370 | 3300013105 | Bacteria | 18981 |
| 222 | Ga0157369_10077733 | 3300013105 | Bacteria | 3557 |
| 223 | Ga0157369_10183991 | 3300013105 | Bacteria | 2197 |
| 224 | Ga0157369_10204052 | 3300013105 | Bacteria | 2074 |
| 225 | Ga0157369_10552465 | 3300013105 | Bacteria | 1190 |
| 226 | Ga0157374_10232846 | 3300013296 | Bacteria | 1810 |
| 227 | Ga0157374_10360700 | 3300013296 | Bacteria | 1445 |
| 228 | Ga0157378_10020487 | 3300013297 | Bacteria | 5814 |
| 229 | Ga0157378_10629721 | 3300013297 | Bacteria | 1087 |
| 230 | Ga0163162_10007061 | 3300013306 | Bacteria | 10891 |
| 231 | Ga0163162_10178908 | 3300013306 | Bacteria | 2247 |
| 232 | Ga0163162_10789966 | 3300013306 | Bacteria | 1067 |
| 233 | Ga0157372_10009410 | 3300013307 | Bacteria | 10393 |
| 234 | Ga0157372_10142858 | 3300013307 | Bacteria | 2759 |
| 235 | Ga0157375_10046761 | 3300013308 | Bacteria | 4222 |
| 236 | Ga0157375_10129431 | 3300013308 | Bacteria | 2642 |
| 237 | Ga0157375_10289717 | 3300013308 | Bacteria | 1800 |
| 238 | Ga0163163_10181302 | 3300014325 | Bacteria | 2153 |
| 239 | Ga0157380_10051605 | 3300014326 | Bacteria | 3254 |
| 240 | Ga0157380_10062408 | 3300014326 | Bacteria | 2985 |
| 241 | Ga0157380_10062721 | 3300014326 | Bacteria | 2978 |
| 242 | Ga0182008_10035653 | 3300014497 | Bacteria | 2490 |
| 243 | Ga0157379_10008941 | 3300014968 | Bacteria | 8731 |
| 244 | Ga0157379_10372529 | 3300014968 | Bacteria | 1309 |
| 245 | Ga0157376_10033093 | 3300014969 | Bacteria | 4158 |
| 246 | Ga0157376_10122498 | 3300014969 | Bacteria | 2307 |
| 247 | Ga0157376_10479691 | 3300014969 | Bacteria | 1218 |
| 248 | Ga0182006_1000005 | 3300015261 | Bacteria | 621201 |
| 249 | Ga0182005_1010468 | 3300015265 | Bacteria | 2667 |
| 250 | Ga0183368_1004 | 3300015687 | Bacteria | 1211761 |
| 251 | Ga0163161_10001704 | 3300017792 | Bacteria | 16131 |
| 252 | Ga0163161_10019256 | 3300017792 | Bacteria | 4786 |
| 253 | Ga0163161_10037506 | 3300017792 | Bacteria | 3475 |
| 254 | Ga0206356_10310333 | 3300020070 | Bacteria | 5473 |
| 255 | Ga0206352_10691678 | 3300020078 | Bacteria | 1975 |
| 256 | Ga0206354_10374811 | 3300020081 | Bacteria | 3062 |
| 257 | Ga0206353_10342466 | 3300020082 | Bacteria | 2013 |
| 258 | Ga0154015_1173610 | 3300020610 | Bacteria | 3811 |
| 259 | Ga0213872_10000011 | 3300021361 | Bacteria | 194139 |
| 260 | Ga0213872_10000525 | 3300021361 | Bacteria | 29968 |
| 261 | Ga0213872_10001049 | 3300021361 | Bacteria | 19233 |
| 262 | Ga0213872_10006595 | 3300021361 | Bacteria | 5791 |
| 263 | Ga0213872_10011915 | 3300021361 | Bacteria | 4105 |
| 264 | Ga0213876_10000498 | 3300021384 | Bacteria | 30587 |
| 265 | Ga0209435_103741 | 3300025206 | Bacteria | 1727 |
| 266 | Ga0209674_100016 | 3300025226 | Bacteria | 696756 |
| 267 | Ga0209674_100067 | 3300025226 | Bacteria | 253824 |
| 268 | Ga0209563_100068 | 3300025230 | Bacteria | 254802 |
| 269 | Ga0207427_100111 | 3300025231 | Bacteria | 112775 |
| 270 | Ga0207427_104279 | 3300025231 | Bacteria | 2478 |
| 271 | Ga0207427_106258 | 3300025231 | Bacteria | 1534 |
| 272 | Ga0209437_100223 | 3300025233 | Bacteria | 102763 |
| 273 | Ga0209258_101024 | 3300025242 | Bacteria | 12600 |
| 274 | Ga0209646_1010093 | 3300025246 | Bacteria | 1487 |
| 275 | Ga0209677_100049 | 3300025253 | Bacteria | 180721 |
| 276 | Ga0209677_101153 | 3300025253 | Bacteria | 12284 |
| 277 | Ga0209233_1000006 | 3300025261 | Bacteria | 1473685 |
| 278 | Ga0209233_1000272 | 3300025261 | Bacteria | 73393 |
| 279 | Ga0207666_1008580 | 3300025271 | Bacteria | 1368 |
| 280 | Ga0209025_1080404 | 3300025294 | Bacteria | 1109 |
| 281 | Ga0207697_10051159 | 3300025315 | Bacteria | 1707 |
| 282 | Ga0207656_10016237 | 3300025321 | Bacteria | 2896 |
| 283 | Ga0207682_10000873 | 3300025893 | Bacteria | 13976 |
| 284 | Ga0207642_10003560 | 3300025899 | Bacteria | 4936 |
| 285 | Ga0207642_10080270 | 3300025899 | Bacteria | 1582 |
| 286 | Ga0207680_10000525 | 3300025903 | Bacteria | 18250 |
| 287 | Ga0207680_10037775 | 3300025903 | Bacteria | 2790 |
| 288 | Ga0207647_10001393 | 3300025904 | Bacteria | 18564 |
| 289 | Ga0207647_10005236 | 3300025904 | Bacteria | 9547 |
| 290 | Ga0207647_10009247 | 3300025904 | Bacteria | 7008 |
| 291 | Ga0207647_10011267 | 3300025904 | Bacteria | 6276 |
| 292 | Ga0207647_10027938 | 3300025904 | Bacteria | 3673 |
| 293 | Ga0207645_10003406 | 3300025907 | Bacteria | 12090 |
| 294 | Ga0207645_10006705 | 3300025907 | Bacteria | 8229 |
| 295 | Ga0207645_10012060 | 3300025907 | Bacteria | 5877 |
| 296 | Ga0207643_10096926 | 3300025908 | Bacteria | 1725 |
| 297 | Ga0207643_10123898 | 3300025908 | Bacteria | 1533 |
| 298 | Ga0207705_10000089 | 3300025909 | Bacteria | 113394 |
| 299 | Ga0207705_10002720 | 3300025909 | Bacteria | 13549 |
| 300 | Ga0207705_10061090 | 3300025909 | Bacteria | 2722 |
| 301 | Ga0207654_10036699 | 3300025911 | Bacteria | 2740 |
| 302 | Ga0207654_10050298 | 3300025911 | Bacteria | 2394 |
| 303 | Ga0207707_10001152 | 3300025912 | Bacteria | 25079 |
| 304 | Ga0207707_10003824 | 3300025912 | Bacteria | 13336 |
| 305 | Ga0207707_10008190 | 3300025912 | Bacteria | 9072 |
| 306 | Ga0207707_10014155 | 3300025912 | Bacteria | 6951 |
| 307 | Ga0207707_10026761 | 3300025912 | Bacteria | 5041 |
| 308 | Ga0207707_10095721 | 3300025912 | Bacteria | 2595 |
| 309 | Ga0207707_10114643 | 3300025912 | Bacteria | 2355 |
| 310 | Ga0207707_10327333 | 3300025912 | Bacteria | 1322 |
| 311 | Ga0207695_10002354 | 3300025913 | Bacteria | 28096 |
| 312 | Ga0207695_10065151 | 3300025913 | Bacteria | 3746 |
| 313 | Ga0207695_10110997 | 3300025913 | Bacteria | 2722 |
| 314 | Ga0207695_10112260 | 3300025913 | Bacteria | 2704 |
| 315 | Ga0207671_10098074 | 3300025914 | Bacteria | 2216 |
| 316 | Ga0207671_10143383 | 3300025914 | Bacteria | 1842 |
| 317 | Ga0207663_10025052 | 3300025916 | Bacteria | 3443 |
| 318 | Ga0207660_10000311 | 3300025917 | Bacteria | 31934 |
| 319 | Ga0207660_10008400 | 3300025917 | Bacteria | 6680 |
| 320 | Ga0207660_10008420 | 3300025917 | Bacteria | 6672 |
| 321 | Ga0207660_10012966 | 3300025917 | Bacteria | 5461 |
| 322 | Ga0207660_10018270 | 3300025917 | Bacteria | 4671 |
| 323 | Ga0207660_10107715 | 3300025917 | Bacteria | 2092 |
| 324 | Ga0207662_10111956 | 3300025918 | Bacteria | 1703 |
| 325 | Ga0207657_10000654 | 3300025919 | Bacteria | 36849 |
| 326 | Ga0207657_10013655 | 3300025919 | Bacteria | 7960 |
| 327 | Ga0207657_10014891 | 3300025919 | Bacteria | 7566 |
| 328 | Ga0207657_10060782 | 3300025919 | Bacteria | 3242 |
| 329 | Ga0207649_10022015 | 3300025920 | Bacteria | 3679 |
| 330 | Ga0207649_10083812 | 3300025920 | Bacteria | 2070 |
| 331 | Ga0207649_10308604 | 3300025920 | Bacteria | 1159 |
| 332 | Ga0207652_10000117 | 3300025921 | Bacteria | 87807 |
| 333 | Ga0207652_10005226 | 3300025921 | Bacteria | 10548 |
| 334 | Ga0207652_10007462 | 3300025921 | Bacteria | 8817 |
| 335 | Ga0207652_10062375 | 3300025921 | Bacteria | 3221 |
| 336 | Ga0207652_10066093 | 3300025921 | Bacteria | 3133 |
| 337 | Ga0207652_10066575 | 3300025921 | Bacteria | 3122 |
| 338 | Ga0207652_10096273 | 3300025921 | Bacteria | 2608 |
| 339 | Ga0207652_10289390 | 3300025921 | Bacteria | 1478 |
| 340 | Ga0207652_10398028 | 3300025921 | Bacteria | 1243 |
| 341 | Ga0207681_10004364 | 3300025923 | Bacteria | 8718 |
| 342 | Ga0207681_10007115 | 3300025923 | Bacteria | 6859 |
| 343 | Ga0207694_10014090 | 3300025924 | Bacteria | 6027 |
| 344 | Ga0207694_10018692 | 3300025924 | Bacteria | 5238 |
| 345 | Ga0207694_10036656 | 3300025924 | Bacteria | 3764 |
| 346 | Ga0207694_10049082 | 3300025924 | Bacteria | 3267 |
| 347 | Ga0207694_10084206 | 3300025924 | Bacteria | 2501 |
| 348 | Ga0207650_10001175 | 3300025925 | Bacteria | 19267 |
| 349 | Ga0207650_10020978 | 3300025925 | Bacteria | 4615 |
| 350 | Ga0207659_10001653 | 3300025926 | Bacteria | 13245 |
| 351 | Ga0207659_10002446 | 3300025926 | Bacteria | 11075 |
| 352 | Ga0207659_10010409 | 3300025926 | Bacteria | 5846 |
| 353 | Ga0207659_10227087 | 3300025926 | Bacteria | 1504 |
| 354 | Ga0207687_10013262 | 3300025927 | Bacteria | 5380 |
| 355 | Ga0207664_10000023 | 3300025929 | Bacteria | 204730 |
| 356 | Ga0207664_10104343 | 3300025929 | Bacteria | 2347 |
| 357 | Ga0207644_10004577 | 3300025931 | Bacteria | 8994 |
| 358 | Ga0207644_10022651 | 3300025931 | Bacteria | 4293 |
| 359 | Ga0207690_10001386 | 3300025932 | Bacteria | 15230 |
| 360 | Ga0207690_10007323 | 3300025932 | Bacteria | 6551 |
| 361 | Ga0207690_10023064 | 3300025932 | Bacteria | 3880 |
| 362 | Ga0207690_10024720 | 3300025932 | Bacteria | 3764 |
| 363 | Ga0207690_10089298 | 3300025932 | Bacteria | 2173 |
| 364 | Ga0207706_10006952 | 3300025933 | Bacteria | 10458 |
| 365 | Ga0207706_10026518 | 3300025933 | Bacteria | 5186 |
| 366 | Ga0207706_10250431 | 3300025933 | Bacteria | 1547 |
| 367 | Ga0207686_10084115 | 3300025934 | Bacteria | 2084 |
| 368 | Ga0207686_10136582 | 3300025934 | Bacteria | 1689 |
| 369 | Ga0207686_10178503 | 3300025934 | Bacteria | 1504 |
| 370 | Ga0207709_10007930 | 3300025935 | Bacteria | 5884 |
| 371 | Ga0207670_10011987 | 3300025936 | Bacteria | 5053 |
| 372 | Ga0207669_10068361 | 3300025937 | Bacteria | 2218 |
| 373 | Ga0207669_10121610 | 3300025937 | Bacteria | 1773 |
| 374 | Ga0207704_10033169 | 3300025938 | Bacteria | 2933 |
| 375 | Ga0207704_10043983 | 3300025938 | Bacteria | 2642 |
| 376 | Ga0207704_10088623 | 3300025938 | Bacteria | 2025 |
| 377 | Ga0207704_10115295 | 3300025938 | Bacteria | 1826 |
| 378 | Ga0207691_10021975 | 3300025940 | Bacteria | 6020 |
| 379 | Ga0207691_10285957 | 3300025940 | Bacteria | 1418 |
| 380 | Ga0207711_10000001 | 3300025941 | Bacteria | 1325674 |
| 381 | Ga0207711_10028527 | 3300025941 | Bacteria | 4697 |
| 382 | Ga0207711_10070914 | 3300025941 | Bacteria | 3022 |
| 383 | Ga0207711_10321613 | 3300025941 | Bacteria | 1430 |
| 384 | Ga0207689_10018156 | 3300025942 | Bacteria | 5939 |
| 385 | Ga0207661_10037401 | 3300025944 | Bacteria | 3796 |
| 386 | Ga0207661_10135201 | 3300025944 | Bacteria | 2116 |
| 387 | Ga0207661_10138017 | 3300025944 | Bacteria | 2096 |
| 388 | Ga0207661_10317248 | 3300025944 | Bacteria | 1400 |
| 389 | Ga0207679_10118291 | 3300025945 | Bacteria | 2104 |
| 390 | Ga0207679_10169266 | 3300025945 | Bacteria | 1797 |
| 391 | Ga0207679_10428295 | 3300025945 | Bacteria | 1169 |
| 392 | Ga0207667_10005736 | 3300025949 | Bacteria | 15149 |
| 393 | Ga0207667_10008462 | 3300025949 | Bacteria | 12220 |
| 394 | Ga0207667_10017214 | 3300025949 | Bacteria | 8143 |
| 395 | Ga0207667_10029251 | 3300025949 | Bacteria | 5976 |
| 396 | Ga0207667_10037782 | 3300025949 | Bacteria | 5160 |
| 397 | Ga0207667_10051115 | 3300025949 | Bacteria | 4358 |
| 398 | Ga0207651_10001133 | 3300025960 | Bacteria | 11888 |
| 399 | Ga0207651_10250262 | 3300025960 | Bacteria | 1449 |
| 400 | Ga0207712_10003405 | 3300025961 | Bacteria | 10053 |
| 401 | Ga0207668_10017174 | 3300025972 | Bacteria | 4529 |
| 402 | Ga0207668_10146968 | 3300025972 | Bacteria | 1820 |
| 403 | Ga0207640_10050390 | 3300025981 | Bacteria | 2701 |
| 404 | Ga0207658_10000458 | 3300025986 | Bacteria | 38200 |
| 405 | Ga0207658_10072107 | 3300025986 | Bacteria | 2617 |
| 406 | Ga0207677_10016438 | 3300026023 | Bacteria | 4384 |
| 407 | Ga0207677_10032068 | 3300026023 | Bacteria | 3374 |
| 408 | Ga0207703_10266840 | 3300026035 | Bacteria | 1549 |
| 409 | Ga0207639_10000591 | 3300026041 | Bacteria | 24978 |
| 410 | Ga0207639_10004906 | 3300026041 | Bacteria | 9015 |
| 411 | Ga0207639_10015738 | 3300026041 | Bacteria | 5337 |
| 412 | Ga0207639_10024341 | 3300026041 | Bacteria | 4380 |
| 413 | Ga0207639_10082227 | 3300026041 | Bacteria | 2552 |
| 414 | Ga0207678_10004292 | 3300026067 | Bacteria | 12790 |
| 415 | Ga0207678_10010644 | 3300026067 | Bacteria | 8081 |
| 416 | Ga0207678_10216851 | 3300026067 | Bacteria | 1638 |
| 417 | Ga0207678_10270576 | 3300026067 | Bacteria | 1457 |
| 418 | Ga0207702_10000125 | 3300026078 | Bacteria | 90604 |
| 419 | Ga0207702_10029705 | 3300026078 | Bacteria | 4549 |
| 420 | Ga0207702_10073135 | 3300026078 | Bacteria | 2955 |
| 421 | Ga0207702_10088165 | 3300026078 | Bacteria | 2710 |
| 422 | Ga0207702_10403312 | 3300026078 | Bacteria | 1319 |
| 423 | Ga0207641_10064300 | 3300026088 | Bacteria | 3135 |
| 424 | Ga0207641_10200187 | 3300026088 | Bacteria | 1841 |
| 425 | Ga0207641_10372325 | 3300026088 | Bacteria | 1366 |
| 426 | Ga0207648_10002148 | 3300026089 | Bacteria | 21431 |
| 427 | Ga0207648_10006679 | 3300026089 | Bacteria | 11445 |
| 428 | Ga0207648_10074013 | 3300026089 | Bacteria | 2968 |
| 429 | Ga0207676_10066079 | 3300026095 | Bacteria | 2882 |
| 430 | Ga0207676_10115865 | 3300026095 | Bacteria | 2251 |
| 431 | Ga0207674_10015601 | 3300026116 | Bacteria | 8341 |
| 432 | Ga0207674_10016923 | 3300026116 | Bacteria | 7963 |
| 433 | Ga0207674_10024871 | 3300026116 | Bacteria | 6391 |
| 434 | Ga0207674_10039752 | 3300026116 | Bacteria | 4875 |
| 435 | Ga0207674_10088007 | 3300026116 | Bacteria | 3099 |
| 436 | Ga0207674_10102952 | 3300026116 | Bacteria | 2835 |
| 437 | Ga0207675_100170853 | 3300026118 | Bacteria | 2078 |
| 438 | Ga0207683_10001702 | 3300026121 | Bacteria | 19675 |
| 439 | Ga0207683_10032821 | 3300026121 | Bacteria | 4510 |
| 440 | Ga0207698_10004762 | 3300026142 | Bacteria | 8304 |
| 441 | Ga0207698_10009095 | 3300026142 | Bacteria | 6312 |
| 442 | Ga0207698_10011035 | 3300026142 | Bacteria | 5841 |
| 443 | Ga0268266_10187533 | 3300028379 | Bacteria | 1887 |
| 444 | Ga0268266_10495193 | 3300028379 | Bacteria | 1166 |
| 445 | Ga0268264_10000963 | 3300028381 | Bacteria | 29539 |
| 446 | Ga0268264_10044671 | 3300028381 | Bacteria | 3675 |
| 447 | Ga0268264_10066388 | 3300028381 | Bacteria | 3042 |
| 448 | Ga0268264_10104322 | 3300028381 | Bacteria | 2471 |
| 449 | Ga0265323_10000793 | 3300028653 | Bacteria | 16923 |
| 450 | Ga0265338_10279597 | 3300028800 | Bacteria | 1220 |
| 451 | Ga0265324_10009208 | 3300029957 | Bacteria | 3867 |
| 452 | Ga0265320_10000539 | 3300031240 | Bacteria | 29285 |
| 453 | Ga0265320_10033584 | 3300031240 | Bacteria | 2617 |
| 454 | Ga0265325_10011915 | 3300031241 | Bacteria | 4986 |
| 455 | Ga0265325_10136992 | 3300031241 | Bacteria | 1167 |
| 456 | Ga0265340_10036132 | 3300031247 | Bacteria | 2450 |
| 457 | Ga0265339_10059428 | 3300031249 | Bacteria | 2062 |
| 458 | Ga0265331_10000003 | 3300031250 | Bacteria | 499358 |
| 459 | Ga0265331_10000638 | 3300031250 | Bacteria | 30301 |
| 460 | Ga0265331_10081825 | 3300031250 | Bacteria | 1499 |
| 461 | Ga0265316_10133322 | 3300031344 | Bacteria | 1870 |
| 462 | Ga0265316_10220006 | 3300031344 | Bacteria | 1402 |
| 463 | Ga0307513_10002839 | 3300031456 | Bacteria | 23740 |
| 464 | Ga0307408_100054768 | 3300031548 | Bacteria | 2885 |
| 465 | Ga0265313_10006022 | 3300031595 | Bacteria | 8751 |
| 466 | Ga0265314_10000675 | 3300031711 | Bacteria | 41616 |
| 467 | Ga0265314_10002520 | 3300031711 | Bacteria | 18664 |
| 468 | Ga0265314_10058297 | 3300031711 | Bacteria | 2646 |
| 469 | Ga0265314_10192471 | 3300031711 | Bacteria | 1212 |
| 470 | Ga0265342_10075227 | 3300031712 | Bacteria | 1960 |
| 471 | Ga0265342_10096308 | 3300031712 | Bacteria | 1691 |
| 472 | Ga0307413_10027655 | 3300031824 | Bacteria | 3146 |
| 473 | Ga0307410_10003413 | 3300031852 | Bacteria | 7968 |
| 474 | Ga0307406_10180862 | 3300031901 | Bacteria | 1535 |
| 475 | Ga0307407_10043257 | 3300031903 | Bacteria | 2531 |
| 476 | Ga0307412_10024686 | 3300031911 | Bacteria | 3713 |
| 477 | Ga0307409_100021169 | 3300031995 | Bacteria | 4452 |
| 478 | Ga0307416_100024582 | 3300032002 | Bacteria | 4401 |
| 479 | Ga0307411_10019771 | 3300032005 | Bacteria | 3898 |
| 480 | Ga0307415_100060869 | 3300032126 | Bacteria | 2611 |
| 481 | Ga0373940_0042610 | 3300035088 | Bacteria | 1252 |
| 482 | Ga0373927_0000253 | 3300035695 | Bacteria | 42014 |
| 483 | Ga0373947_0126801 | 3300035725 | Bacteria | 1626 |
| 484 | Ga0373937_0000389 | 3300036401 | Bacteria | 40860 |
| 485 | Ga0373937_0060710 | 3300036401 | Bacteria | 3474 |
| 486 | Ga0373925_0076400 | 3300037068 | Bacteria | 2540 |
| 487 | Ga0373925_0090657 | 3300037068 | Bacteria | 2337 |
| 488 | Ga0373925_0402810 | 3300037068 | Bacteria | 1116 |
| 489 | Ga0373925_0537194 | 3300037068 | Bacteria | 961 |
| 490 | Ga0395899_0022054 | 3300037312 | Bacteria | 4829 |
| 491 | Ga0395899_0023376 | 3300037312 | Bacteria | 4682 |
| 492 | Ga0395900_0019258 | 3300037418 | Bacteria | 6958 |
| 493 | Ga0395898_0035060 | 3300037466 | Bacteria | 4994 |
| 494 | Ga0395905_0010620 | 3300037471 | Bacteria | 8937 |
| 495 | Ga0395905_0012063 | 3300037471 | Bacteria | 8328 |
| 496 | Ga0395905_0053882 | 3300037471 | Bacteria | 3764 |
| 497 | Ga0395905_0106981 | 3300037471 | Bacteria | 2626 |
| 498 | Ga0395901_0001910 | 3300038443 | Bacteria | 21454 |
| 499 | Ga0395901_0092957 | 3300038443 | Bacteria | 3157 |
| 500 | Ga0436365_1194130 | 3300039437 | Bacteria | 2743 |
| 501 | Ga0436365_1234622 | 3300039437 | Bacteria | 117941 |
| 502 | Ga0436361_0001464 | 3300039447 | Bacteria | 13289 |
| 503 | Ga0436361_0028109 | 3300039447 | Bacteria | 9820 |
| 504 | Ga0436361_0076715 | 3300039447 | Bacteria | 40178 |
| 505 | Ga0436361_0270082 | 3300039447 | Bacteria | 7438 |
| 506 | Ga0436361_0296121 | 3300039447 | Bacteria | 160237 |
| 507 | Ga0436361_0365808 | 3300039447 | Bacteria | 1686 |
| 508 | Ga0436361_0614937 | 3300039447 | Bacteria | 8160 |
| 509 | Ga0436361_0621527 | 3300039447 | Bacteria | 17412 |
| 510 | Ga0439433_0034573 | 3300041999 | Bacteria | 1164 |
| 511 | Ga0451577_0000009 | 3300042876 | Bacteria | 646744 |
| 512 | Ga0451577_0008808 | 3300042876 | Bacteria | 9773 |
| 513 | Ga0466972_0010618 | 3300044658 | Bacteria | 4618 |
| 514 | Ga0453683_0000847 | 3300044673 | Bacteria | 29561 |
| 515 | Ga0453683_0003255 | 3300044673 | Bacteria | 12071 |
| 516 | Ga0453683_0008771 | 3300044673 | Bacteria | 6778 |
| 517 | Ga0453683_0062762 | 3300044673 | Bacteria | 2323 |
| 518 | Ga0453683_0080245 | 3300044673 | Bacteria | 2044 |
| 519 | Ga0466966_0035094 | 3300044684 | Bacteria | 3242 |
| 520 | Ga0453684_0000358 | 3300044712 | Bacteria | 188931 |
| 521 | Ga0453684_0009048 | 3300044712 | Bacteria | 17577 |
| 522 | Ga0453684_0012200 | 3300044712 | Bacteria | 14241 |
| 523 | Ga0453684_0054005 | 3300044712 | Bacteria | 5238 |
| 524 | Ga0466957_0194816 | 3300044842 | Bacteria | 1329 |
| 525 | Ga0451576_0003725 | 3300045051 | Bacteria | 20614 |
| 526 | Ga0451576_0403746 | 3300045051 | Bacteria | 1433 |
| 527 | Ga0451576_0524834 | 3300045051 | Bacteria | 1244 |
| 528 | Ga0466958_0005292 | 3300045836 | Bacteria | 6922 |
| 529 | Ga0466967_0693530 | 3300045976 | Bacteria | 1008 |
| 530 | Ga0495617_000016 | 3300046452 | Bacteria | 253600 |
| 531 | Ga0495617_001385 | 3300046452 | Bacteria | 10677 |
| 532 | Ga0495603_0014873 | 3300046455 | Bacteria | 4708 |
| 533 | Ga0495590_0003984 | 3300046457 | Bacteria | 5998 |
| 534 | Ga0495638_0000044 | 3300046460 | Bacteria | 221595 |
| 535 | Ga0495638_0000916 | 3300046460 | Bacteria | 30114 |
| 536 | Ga0495650_0000536 | 3300046471 | Bacteria | 54546 |
| 537 | Ga0495650_0001214 | 3300046471 | Bacteria | 27066 |
| 538 | Ga0495605_0105323 | 3300046474 | Bacteria | 1292 |
| 539 | Ga0495584_0003894 | 3300046491 | Bacteria | 8073 |
| 540 | Ga0495585_0000007 | 3300046492 | Bacteria | 288113 |
| 541 | Ga0495585_0027100 | 3300046492 | Bacteria | 3271 |
| 542 | Ga0495607_0000030 | 3300046501 | Bacteria | 154557 |
| 543 | Ga0495607_0169378 | 3300046501 | Bacteria | 1104 |
| 544 | Ga0495583_0000090 | 3300046506 | Bacteria | 158988 |
| 545 | Ga0495583_0014996 | 3300046506 | Bacteria | 4240 |
| 546 | Ga0495606_0000073 | 3300046507 | Bacteria | 171657 |
| 547 | Ga0495606_0000260 | 3300046507 | Bacteria | 93381 |
| 548 | Ga0495606_0002085 | 3300046507 | Bacteria | 24403 |
| 549 | Ga0495606_0039963 | 3300046507 | Bacteria | 3155 |
| 550 | Ga0495610_0016504 | 3300046512 | Bacteria | 4246 |
| 551 | Ga0495616_0000001 | 3300046513 | Bacteria | 780061 |
| 552 | Ga0495620_0000078 | 3300046515 | Bacteria | 80641 |
| 553 | Ga0495620_0000732 | 3300046515 | Bacteria | 20244 |
| 554 | Ga0495631_0000051 | 3300046518 | Bacteria | 71756 |
| 555 | Ga0495631_0000077 | 3300046518 | Bacteria | 63179 |
| 556 | Ga0495632_0001645 | 3300046519 | Bacteria | 18316 |
| 557 | Ga0495648_0000584 | 3300046524 | Bacteria | 39055 |
| 558 | Ga0495648_0003567 | 3300046524 | Bacteria | 13616 |
| 559 | Ga0495654_0038759 | 3300046530 | Bacteria | 2381 |
| 560 | Ga0495609_0018043 | 3300046538 | Bacteria | 3273 |
| 561 | Ga0495622_0029916 | 3300046557 | Bacteria | 2544 |
| 562 | Ga0495668_0009414 | 3300046616 | Bacteria | 6001 |
| 563 | Ga0495668_0031488 | 3300046616 | Bacteria | 2989 |
| 564 | Ga0495668_0034110 | 3300046616 | Bacteria | 2857 |
| 565 | Ga0495611_0000001 | 3300046648 | Bacteria | 2628469 |
| 566 | Ga0495611_0000006 | 3300046648 | Bacteria | 249842 |
| 567 | Ga0495611_0070221 | 3300046648 | Bacteria | 1601 |
| 568 | Ga0495625_0000001 | 3300046660 | Bacteria | 1641829 |
| 569 | Ga0495625_0004921 | 3300046660 | Bacteria | 12434 |
| 570 | Ga0495661_0002549 | 3300046665 | Bacteria | 13974 |
| 571 | Ga0495647_0071872 | 3300046681 | Bacteria | 1387 |
| 572 | Ga0495658_0001841 | 3300046683 | Bacteria | 10840 |
| 573 | Ga0495669_0009832 | 3300046684 | Bacteria | 4040 |
| 574 | Ga0495670_0017804 | 3300046691 | Bacteria | 3499 |
| 575 | Ga0495649_0000203 | 3300046694 | Bacteria | 52758 |
| 576 | Ga0495649_0004336 | 3300046694 | Bacteria | 9298 |
| 577 | Ga0495589_0000172 | 3300046794 | Bacteria | 58738 |
| 578 | Ga0495589_0059301 | 3300046794 | Bacteria | 1881 |
| 579 | Ga0495660_0000018 | 3300046810 | Bacteria | 317061 |
| 580 | Ga0495660_0000025 | 3300046810 | Bacteria | 260275 |
| 581 | Ga0495660_0058530 | 3300046810 | Bacteria | 2075 |
| 582 | Ga0495672_0005079 | 3300047320 | Bacteria | 10517 |
| 583 | Ga0495683_0004279 | 3300047323 | Bacteria | 8138 |
| 584 | Ga0495679_000001 | 3300047446 | Bacteria | 1607568 |
| 585 | Ga0495673_0000001 | 3300047469 | Bacteria | 1630730 |
| 586 | Ga0495673_0000018 | 3300047469 | Bacteria | 569190 |
| 587 | Ga0495673_0000129 | 3300047469 | Bacteria | 139549 |
| 588 | Ga0495686_0000017 | 3300047472 | Bacteria | 435554 |
| 589 | Ga0495686_0000037 | 3300047472 | Bacteria | 307937 |
| 590 | Ga0495686_0019170 | 3300047472 | Bacteria | 4575 |
| 591 | Ga0495686_0029670 | 3300047472 | Bacteria | 3557 |
| 592 | Ga0496100_0008675 | 3300048903 | Bacteria | 5677 |
| 593 | Ga0496100_0126992 | 3300048903 | Bacteria | 1791 |
| 594 | Ga0496101_0004321 | 3300048904 | Bacteria | 8920 |
| 595 | Ga0496101_0028900 | 3300048904 | Bacteria | 3875 |
| 596 | Ga0496102_0050437 | 3300048905 | Bacteria | 3789 |
| 597 | Ga0496103_0008641 | 3300048906 | Bacteria | 6050 |
| 598 | Ga0496104_0010035 | 3300048907 | Bacteria | 8454 |
| 599 | Ga0496104_0244525 | 3300048907 | Bacteria | 1707 |
| 600 | Ga0496105_0067510 | 3300048908 | Bacteria | 2953 |
| 601 | Ga0496105_0137711 | 3300048908 | Bacteria | 2010 |
| 602 | Ga0496106_0008180 | 3300048909 | Bacteria | 7727 |
| 603 | Ga0496106_0240135 | 3300048909 | Bacteria | 1448 |
| 604 | Ga0496107_0010495 | 3300048910 | Bacteria | 6438 |
| 605 | Ga0496114_0202854 | 3300048917 | Bacteria | 1737 |
| 606 | Ga0496114_0425883 | 3300048917 | Bacteria | 1176 |
| 607 | Ga0496115_0000024 | 3300048918 | Bacteria | 154488 |
| 608 | Ga0496115_0001590 | 3300048918 | Bacteria | 16293 |
| 609 | Ga0496117_0223707 | 3300048920 | Bacteria | 1045 |
| 610 | Ga0496118_0002826 | 3300048921 | Bacteria | 22723 |
| 611 | Ga0496121_0000666 | 3300048924 | Bacteria | 64148 |
| 612 | Ga0496121_0011440 | 3300048924 | Bacteria | 9852 |
| 613 | Ga0496121_0052630 | 3300048924 | Bacteria | 3417 |
| 614 | Ga0495678_000209 | 3300049459 | Bacteria | 68248 |
| 615 | Ga0495682_0003698 | 3300049460 | Bacteria | 6739 |
| 616 | Ga0495682_0023440 | 3300049460 | Bacteria | 2303 |
| 617 | Ga0501032_0005754 | 3300049569 | Bacteria | 9170 |
| 618 | Ga0501032_0074237 | 3300049569 | Bacteria | 2266 |
| 619 | Ga0501032_0076263 | 3300049569 | Bacteria | 2232 |
| 620 | Ga0501032_0214110 | 3300049569 | Bacteria | 1255 |
| 621 | Ga0501033_0002380 | 3300049570 | Bacteria | 16017 |
| 622 | Ga0501033_0019956 | 3300049570 | Bacteria | 5065 |
| 623 | Ga0501033_0134863 | 3300049570 | Bacteria | 1786 |
| 624 | Ga0501034_0013490 | 3300049571 | Bacteria | 8412 |
| 625 | Ga0501034_0076554 | 3300049571 | Bacteria | 3352 |
| 626 | Ga0501034_0461379 | 3300049571 | Bacteria | 1187 |
| 627 | Ga0501036_0030936 | 3300049572 | Bacteria | 4523 |
| 628 | Ga0501036_0174659 | 3300049572 | Bacteria | 1809 |
| 629 | Ga0501037_0080203 | 3300049573 | Bacteria | 2368 |
| 630 | Ga0501037_0226307 | 3300049573 | Bacteria | 1314 |
| 631 | Ga0501038_0017190 | 3300049574 | Bacteria | 6539 |
| 632 | Ga0501038_0047113 | 3300049574 | Bacteria | 3735 |
| 633 | Ga0501038_0087246 | 3300049574 | Bacteria | 2620 |
| 634 | Ga0501038_0094148 | 3300049574 | Bacteria | 2504 |
| 635 | Ga0501038_0143175 | 3300049574 | Bacteria | 1954 |
| 636 | Ga0501038_0251668 | 3300049574 | Bacteria | 1399 |
| 637 | Ga0501039_0120120 | 3300049575 | Bacteria | 2059 |
| 638 | Ga0501040_0281081 | 3300049576 | Bacteria | 1189 |
| 639 | Ga0501043_0062949 | 3300049579 | Bacteria | 2913 |
| 640 | Ga0501043_0140754 | 3300049579 | Bacteria | 1889 |
| 641 | Ga0501046_0068564 | 3300049580 | Bacteria | 2760 |
| 642 | Ga0501046_0396461 | 3300049580 | Bacteria | 997 |
| 643 | Ga0501047_0003456 | 3300049581 | Bacteria | 14926 |
| 644 | Ga0501047_0009987 | 3300049581 | Bacteria | 8972 |
| 645 | Ga0501047_0028409 | 3300049581 | Bacteria | 5392 |
| 646 | Ga0501047_0375555 | 3300049581 | Bacteria | 1256 |
| 647 | Ga0501067_0054764 | 3300049583 | Bacteria | 2210 |
| 648 | Ga0501068_0077004 | 3300049584 | Bacteria | 2042 |
| 649 | Ga0501069_0041850 | 3300049585 | Bacteria | 2533 |
| 650 | Ga0501070_0035616 | 3300049586 | Bacteria | 4158 |
| 651 | Ga0501070_0053798 | 3300049586 | Bacteria | 3338 |
| 652 | Ga0501070_0113972 | 3300049586 | Bacteria | 2233 |
| 653 | Ga0501072_0002100 | 3300049588 | Bacteria | 14838 |
| 654 | Ga0501073_0001773 | 3300049589 | Bacteria | 16050 |
| 655 | Ga0501073_0020612 | 3300049589 | Bacteria | 4754 |
| 656 | Ga0501074_0004341 | 3300049590 | Bacteria | 10126 |
| 657 | Ga0501074_0035709 | 3300049590 | Bacteria | 3601 |
| 658 | Ga0501074_0106227 | 3300049590 | Bacteria | 2010 |
| 659 | Ga0501079_0021809 | 3300049741 | Bacteria | 4903 |
| 660 | Ga0501080_0005029 | 3300049742 | Bacteria | 11781 |
| 661 | Ga0501080_0010940 | 3300049742 | Bacteria | 8302 |
| 662 | Ga0501080_0024247 | 3300049742 | Bacteria | 5624 |
| 663 | Ga0501080_0052659 | 3300049742 | Bacteria | 3788 |
| 664 | Ga0501080_0097119 | 3300049742 | Bacteria | 2735 |
| 665 | Ga0501080_0240181 | 3300049742 | Bacteria | 1654 |
| 666 | Ga0501080_0603315 | 3300049742 | Bacteria | 974 |
| 667 | Ga0501035_0001650 | 3300049822 | Bacteria | 22551 |
| 668 | Ga0501035_0002475 | 3300049822 | Bacteria | 18046 |
| 669 | Ga0501035_0003494 | 3300049822 | Bacteria | 15025 |
| 670 | Ga0501035_0009642 | 3300049822 | Bacteria | 8980 |
| 671 | Ga0501035_0063469 | 3300049822 | Bacteria | 3285 |
| 672 | Ga0501035_0111966 | 3300049822 | Bacteria | 2391 |
| 673 | Ga0501035_0189936 | 3300049822 | Bacteria | 1766 |
| 674 | Ga0501035_0467117 | 3300049822 | Bacteria | 1042 |
| 675 | Ga0501044_0015835 | 3300049823 | Bacteria | 8114 |
| 676 | Ga0501044_0019468 | 3300049823 | Bacteria | 7259 |
| 677 | Ga0501044_0128019 | 3300049823 | Bacteria | 2535 |
| 678 | nmdc:mga00v17_79865_c1 | 3300050491 | Bacteria | 2040 |
| 679 | nmdc:mga0qj67_323760_c1 | 3300050509 | Bacteria | 1248 |
| 680 | nmdc:mga08y16_129183_c1 | 3300050511 | Bacteria | 2628 |
| 681 | nmdc:mga08y16_25798_c1 | 3300050511 | Bacteria | 6202 |
| 682 | nmdc:mga08y16_519984_c1 | 3300050511 | Bacteria | 1207 |
| 683 | nmdc:mga0n895_25655_c1 | 3300050512 | Bacteria | 5572 |
| 684 | nmdc:mga0rr50_94778_c1 | 3300050513 | Bacteria | 2332 |
| 685 | nmdc:mga08x19_270916_c1 | 3300050514 | Bacteria | 1175 |
| 686 | nmdc:mga0a205_232460_c1 | 3300050515 | Bacteria | 1726 |
| 687 | nmdc:mga0a205_2343_c1 | 3300050515 | Bacteria | 16709 |
| 688 | Ga0500643_000002 | 3300053087 | Bacteria | 1277657 |
| 689 | Ga0500555_011022 | 3300053103 | Bacteria | 2595 |
| 690 | Ga0500604_0040923 | 3300053151 | Bacteria | 1399 |
| 691 | Ga0500616_0036706 | 3300053153 | Bacteria | 2658 |
| 692 | Ga0500633_0001679 | 3300053160 | Bacteria | 4291 |
| 693 | Ga0500637_0001230 | 3300053178 | Bacteria | 10710 |
| 694 | Ga0500645_002013 | 3300053730 | Bacteria | 9517 |
| 695 | Ga0590071_003216 | 3300059421 | Bacteria | 4035 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013296 | Ga0157374_10232846 | Ga0157374_102328462 | 235 |
| 2 | 3300005327 | Ga0070658_10087981 | Ga0070658_100879812 | 242 |
| 3 | 3300005339 | Ga0070660_100004136 | Ga0070660_1000041363 | 242 |
| 4 | 3300005341 | Ga0070691_10006919 | Ga0070691_100069192 | 242 |
| 5 | 3300005455 | Ga0070663_100011142 | Ga0070663_1000111422 | 242 |
| 6 | 3300005458 | Ga0070681_10120607 | Ga0070681_101206072 | 242 |
| 7 | 3300005530 | Ga0070679_100055385 | Ga0070679_1000553852 | 242 |
| 8 | 3300009551 | Ga0105238_10009736 | Ga0105238_100097366 | 242 |
| 9 | 3300013100 | Ga0157373_10199881 | Ga0157373_101998812 | 242 |
| 10 | 3300013102 | Ga0157371_10046698 | Ga0157371_100466982 | 242 |
| 11 | 3300013104 | Ga0157370_10001994 | Ga0157370_1000199414 | 242 |
| 12 | 3300013307 | Ga0157372_10009410 | Ga0157372_100094104 | 242 |
| 13 | 3300025909 | Ga0207705_10000089 | Ga0207705_1000008957 | 242 |
| 14 | 3300025912 | Ga0207707_10001152 | Ga0207707_100011523 | 242 |
| 15 | 3300025917 | Ga0207660_10000311 | Ga0207660_1000031113 | 242 |
| 16 | 3300025919 | Ga0207657_10000654 | Ga0207657_1000065414 | 242 |
| 17 | 3300025921 | Ga0207652_10005226 | Ga0207652_100052266 | 242 |
| 18 | 3300025949 | Ga0207667_10017214 | Ga0207667_100172142 | 242 |
| 19 | 3300003756 | Ga0055533_1000667 | Ga0055533_10006672 | 243 |
| 20 | 3300025226 | Ga0209674_100016 | Ga0209674_100016389 | 243 |
| 21 | 3300025231 | Ga0207427_106258 | Ga0207427_1062582 | 243 |
| 22 | 3300025294 | Ga0209025_1080404 | Ga0209025_10804041 | 244 |
| 23 | 3300046681 | Ga0495647_0071872 | Ga0495647_0071872_467_1372 | 244 |
| 24 | 3300046519 | Ga0495632_0001645 | Ga0495632_0001645_14257_15105 | 245 |
| 25 | 3300046524 | Ga0495648_0003567 | Ga0495648_0003567_12426_13274 | 245 |
| 26 | 3300025933 | Ga0207706_10250431 | Ga0207706_102504312 | 247 |
| 27 | 3300047469 | Ga0495673_0000018 | Ga0495673_0000018_181306_182154 | 247 |
| 28 | 3300005331 | Ga0070670_100136041 | Ga0070670_1001360412 | 248 |
| 29 | 3300025271 | Ga0207666_1008580 | Ga0207666_10085802 | 248 |
| 30 | 3300046471 | Ga0495650_0000536 | Ga0495650_0000536_32322_33170 | 248 |
| 31 | 3300046507 | Ga0495606_0039963 | Ga0495606_0039963_968_1816 | 248 |
| 32 | 3300046515 | Ga0495620_0000732 | Ga0495620_0000732_12590_13438 | 248 |
| 33 | 3300046518 | Ga0495631_0000077 | Ga0495631_0000077_17616_18464 | 248 |
| 34 | 3300046648 | Ga0495611_0000006 | Ga0495611_0000006_141175_142023 | 248 |
| 35 | 3300049589 | Ga0501073_0020612 | Ga0501073_0020612_1245_2138 | 248 |
| 36 | 3300053160 | Ga0500633_0001679 | Ga0500633_0001679_604_1452 | 248 |
| 37 | 3300039447 | Ga0436361_0365808 | Ga0436361_0365808_226_1140 | 249 |
| 38 | 3300025206 | Ga0209435_103741 | Ga0209435_1037412 | 250 |
| 39 | 3300025242 | Ga0209258_101024 | Ga0209258_1010244 | 250 |
| 40 | 3300025246 | Ga0209646_1010093 | Ga0209646_10100932 | 250 |
| 41 | 3300036401 | Ga0373937_0060710 | Ga0373937_0060710_460_1386 | 250 |
| 42 | 3300046474 | Ga0495605_0105323 | Ga0495605_0105323_228_1094 | 250 |
| 43 | 3300046491 | Ga0495584_0003894 | Ga0495584_0003894_2538_3386 | 250 |
| 44 | 3300046492 | Ga0495585_0027100 | Ga0495585_0027100_1357_2205 | 250 |
| 45 | 3300046507 | Ga0495606_0000073 | Ga0495606_0000073_111338_112216 | 250 |
| 46 | 3300046691 | Ga0495670_0017804 | Ga0495670_0017804_1124_1972 | 250 |
| 47 | 3300047323 | Ga0495683_0004279 | Ga0495683_0004279_191_1039 | 250 |
| 48 | 3300047472 | Ga0495686_0000017 | Ga0495686_0000017_368442_369293 | 250 |
| 49 | 3300048905 | Ga0496102_0050437 | Ga0496102_0050437_2067_2891 | 250 |
| 50 | 3300048920 | Ga0496117_0223707 | Ga0496117_0223707_37_888 | 250 |
| 51 | 3300048921 | Ga0496118_0002826 | Ga0496118_0002826_8892_9743 | 250 |
| 52 | 3300048924 | Ga0496121_0011440 | Ga0496121_0011440_7051_7899 | 250 |
| 53 | 3300053153 | Ga0500616_0036706 | Ga0500616_0036706_537_1436 | 252 |
| 54 | 3300031240 | Ga0265320_10033584 | Ga0265320_100335842 | 253 |
| 55 | 3300031250 | Ga0265331_10000638 | Ga0265331_1000063816 | 253 |
| 56 | 3300031711 | Ga0265314_10000675 | Ga0265314_1000067513 | 253 |
| 57 | 3300009174 | Ga0105241_10097829 | Ga0105241_100978293 | 254 |
| 58 | 3300049588 | Ga0501072_0002100 | Ga0501072_0002100_8172_9029 | 254 |
| 59 | 3300049589 | Ga0501073_0001773 | Ga0501073_0001773_5668_6525 | 254 |
| 60 | 3300049741 | Ga0501079_0021809 | Ga0501079_0021809_1545_2402 | 254 |
| 61 | 3300049742 | Ga0501080_0010940 | Ga0501080_0010940_5860_6717 | 254 |
| 62 | 3300025907 | Ga0207645_10012060 | Ga0207645_100120602 | 255 |
| 63 | 3300026023 | Ga0207677_10032068 | Ga0207677_100320682 | 255 |
| 64 | 3300026089 | Ga0207648_10006679 | Ga0207648_1000667913 | 255 |
| 65 | 3300031247 | Ga0265340_10036132 | Ga0265340_100361322 | 255 |
| 66 | 3300039437 | Ga0436365_1194130 | Ga0436365_1194130_1791_2582 | 255 |
| 67 | 3300053151 | Ga0500604_0040923 | Ga0500604_0040923_360_1172 | 255 |
| 68 | 3300044712 | Ga0453684_0009048 | Ga0453684_0009048_15112_15972 | 256 |
| 69 | 3300049569 | Ga0501032_0076263 | Ga0501032_0076263_11_826 | 256 |
| 70 | 3300049572 | Ga0501036_0030936 | Ga0501036_0030936_1510_2325 | 256 |
| 71 | 3300049574 | Ga0501038_0094148 | Ga0501038_0094148_1510_2325 | 256 |
| 72 | 3300049822 | Ga0501035_0001650 | Ga0501035_0001650_20227_21042 | 256 |
| 73 | 3300005843 | Ga0068860_100015154 | Ga0068860_1000151546 | 257 |
| 74 | 3300005843 | Ga0068860_100667781 | Ga0068860_1006677811 | 257 |
| 75 | 3300009093 | Ga0105240_10251256 | Ga0105240_102512563 | 257 |
| 76 | 3300009101 | Ga0105247_10061763 | Ga0105247_100617632 | 257 |
| 77 | 3300009176 | Ga0105242_10023556 | Ga0105242_100235565 | 257 |
| 78 | 3300010375 | Ga0105239_10026373 | Ga0105239_100263732 | 257 |
| 79 | 3300013105 | Ga0157369_10003370 | Ga0157369_100033709 | 257 |
| 80 | 3300013306 | Ga0163162_10178908 | Ga0163162_101789082 | 257 |
| 81 | 3300014968 | Ga0157379_10372529 | Ga0157379_103725292 | 257 |
| 82 | 3300014969 | Ga0157376_10033093 | Ga0157376_100330934 | 257 |
| 83 | 3300025899 | Ga0207642_10080270 | Ga0207642_100802701 | 257 |
| 84 | 3300025903 | Ga0207680_10037775 | Ga0207680_100377753 | 257 |
| 85 | 3300026089 | Ga0207648_10074013 | Ga0207648_100740133 | 257 |
| 86 | 3300028381 | Ga0268264_10044671 | Ga0268264_100446712 | 257 |
| 87 | 3300028381 | Ga0268264_10066388 | Ga0268264_100663884 | 257 |
| 88 | 3300037068 | Ga0373925_0537194 | Ga0373925_0537194_136_951 | 257 |
| 89 | 3300005344 | Ga0070661_100261996 | Ga0070661_1002619962 | 258 |
| 90 | 3300005543 | Ga0070672_100540562 | Ga0070672_1005405621 | 258 |
| 91 | 3300005614 | Ga0068856_100000400 | Ga0068856_10000040011 | 258 |
| 92 | 3300005719 | Ga0068861_100258396 | Ga0068861_1002583962 | 258 |
| 93 | 3300005844 | Ga0068862_100580744 | Ga0068862_1005807442 | 258 |
| 94 | 3300026078 | Ga0207702_10000125 | Ga0207702_1000012511 | 258 |
| 95 | 3300046460 | Ga0495638_0000916 | Ga0495638_0000916_14944_15807 | 258 |
| 96 | 3300046471 | Ga0495650_0001214 | Ga0495650_0001214_14333_15196 | 258 |
| 97 | 3300046507 | Ga0495606_0000260 | Ga0495606_0000260_45932_46753 | 258 |
| 98 | 3300049570 | Ga0501033_0002380 | Ga0501033_0002380_627_1442 | 258 |
| 99 | 3300049579 | Ga0501043_0140754 | Ga0501043_0140754_463_1278 | 258 |
| 100 | 3300049580 | Ga0501046_0068564 | Ga0501046_0068564_536_1351 | 258 |
| 101 | 3300049581 | Ga0501047_0375555 | Ga0501047_0375555_182_997 | 258 |
| 102 | 3300005327 | Ga0070658_10046904 | Ga0070658_100469043 | 259 |
| 103 | 3300005329 | Ga0070683_100016971 | Ga0070683_1000169712 | 259 |
| 104 | 3300005338 | Ga0068868_100009112 | Ga0068868_1000091124 | 259 |
| 105 | 3300005458 | Ga0070681_10123174 | Ga0070681_101231742 | 259 |
| 106 | 3300005458 | Ga0070681_10142810 | Ga0070681_101428103 | 259 |
| 107 | 3300005530 | Ga0070679_100043671 | Ga0070679_1000436714 | 259 |
| 108 | 3300005563 | Ga0068855_100004225 | Ga0068855_1000042257 | 259 |
| 109 | 3300005564 | Ga0070664_100575969 | Ga0070664_1005759692 | 259 |
| 110 | 3300005577 | Ga0068857_100004590 | Ga0068857_1000045902 | 259 |
| 111 | 3300005577 | Ga0068857_100019781 | Ga0068857_1000197815 | 259 |
| 112 | 3300005614 | Ga0068856_100131680 | Ga0068856_1001316802 | 259 |
| 113 | 3300005718 | Ga0068866_10053389 | Ga0068866_100533893 | 259 |
| 114 | 3300006237 | Ga0097621_100007337 | Ga0097621_1000073374 | 259 |
| 115 | 3300006237 | Ga0097621_100111291 | Ga0097621_1001112912 | 259 |
| 116 | 3300006358 | Ga0068871_100113169 | Ga0068871_1001131692 | 259 |
| 117 | 3300006881 | Ga0068865_100062498 | Ga0068865_1000624983 | 259 |
| 118 | 3300006914 | Ga0075436_100353419 | Ga0075436_1003534192 | 259 |
| 119 | 3300009093 | Ga0105240_10001676 | Ga0105240_1000167617 | 259 |
| 120 | 3300009174 | Ga0105241_10127040 | Ga0105241_101270402 | 259 |
| 121 | 3300009176 | Ga0105242_10291619 | Ga0105242_102916192 | 259 |
| 122 | 3300009177 | Ga0105248_10806235 | Ga0105248_108062352 | 259 |
| 123 | 3300009551 | Ga0105238_10043434 | Ga0105238_100434342 | 259 |
| 124 | 3300010375 | Ga0105239_10048947 | Ga0105239_100489474 | 259 |
| 125 | 3300011119 | Ga0105246_10108142 | Ga0105246_101081422 | 259 |
| 126 | 3300013297 | Ga0157378_10020487 | Ga0157378_100204876 | 259 |
| 127 | 3300013308 | Ga0157375_10289717 | Ga0157375_102897172 | 259 |
| 128 | 3300014325 | Ga0163163_10181302 | Ga0163163_101813023 | 259 |
| 129 | 3300025911 | Ga0207654_10050298 | Ga0207654_100502983 | 259 |
| 130 | 3300025912 | Ga0207707_10026761 | Ga0207707_100267616 | 259 |
| 131 | 3300025912 | Ga0207707_10114643 | Ga0207707_101146432 | 259 |
| 132 | 3300025913 | Ga0207695_10002354 | Ga0207695_1000235410 | 259 |
| 133 | 3300025921 | Ga0207652_10096273 | Ga0207652_100962734 | 259 |
| 134 | 3300025921 | Ga0207652_10398028 | Ga0207652_103980282 | 259 |
| 135 | 3300025924 | Ga0207694_10014090 | Ga0207694_100140908 | 259 |
| 136 | 3300025927 | Ga0207687_10013262 | Ga0207687_100132622 | 259 |
| 137 | 3300025934 | Ga0207686_10136582 | Ga0207686_101365822 | 259 |
| 138 | 3300025938 | Ga0207704_10043983 | Ga0207704_100439832 | 259 |
| 139 | 3300025944 | Ga0207661_10037401 | Ga0207661_100374012 | 259 |
| 140 | 3300025945 | Ga0207679_10169266 | Ga0207679_101692662 | 259 |
| 141 | 3300025949 | Ga0207667_10005736 | Ga0207667_100057362 | 259 |
| 142 | 3300026023 | Ga0207677_10016438 | Ga0207677_100164382 | 259 |
| 143 | 3300026035 | Ga0207703_10266840 | Ga0207703_102668402 | 259 |
| 144 | 3300026116 | Ga0207674_10024871 | Ga0207674_100248715 | 259 |
| 145 | 3300026116 | Ga0207674_10039752 | Ga0207674_100397522 | 259 |
| 146 | 3300031249 | Ga0265339_10059428 | Ga0265339_100594282 | 259 |
| 147 | 3300031250 | Ga0265331_10081825 | Ga0265331_100818252 | 259 |
| 148 | 3300031344 | Ga0265316_10220006 | Ga0265316_102200062 | 259 |
| 149 | 3300031711 | Ga0265314_10002520 | Ga0265314_1000252011 | 259 |
| 150 | 3300045051 | Ga0451576_0403746 | Ga0451576_0403746_209_1117 | 259 |
| 151 | 3300001915 | JGI24741J21665_1004654 | JGI24741J21665_10046542 | 260 |
| 152 | 3300005340 | Ga0070689_100004487 | Ga0070689_10000448710 | 260 |
| 153 | 3300005842 | Ga0068858_100014648 | Ga0068858_1000146487 | 260 |
| 154 | 3300013306 | Ga0163162_10789966 | Ga0163162_107899662 | 260 |
| 155 | 3300025936 | Ga0207670_10011987 | Ga0207670_100119873 | 260 |
| 156 | 3300026067 | Ga0207678_10216851 | Ga0207678_102168512 | 260 |
| 157 | 3300048924 | Ga0496121_0052630 | Ga0496121_0052630_2088_2951 | 260 |
| 158 | 3300005331 | Ga0070670_100099465 | Ga0070670_1000994652 | 261 |
| 159 | 3300005335 | Ga0070666_10001402 | Ga0070666_1000140216 | 261 |
| 160 | 3300005466 | Ga0070685_10008770 | Ga0070685_100087703 | 261 |
| 161 | 3300005548 | Ga0070665_100696753 | Ga0070665_1006967531 | 261 |
| 162 | 3300005563 | Ga0068855_100019435 | Ga0068855_1000194358 | 261 |
| 163 | 3300009177 | Ga0105248_10679427 | Ga0105248_106794271 | 261 |
| 164 | 3300021361 | Ga0213872_10000525 | Ga0213872_1000052515 | 261 |
| 165 | 3300021361 | Ga0213872_10006595 | Ga0213872_100065955 | 261 |
| 166 | 3300021361 | Ga0213872_10011915 | Ga0213872_100119153 | 261 |
| 167 | 3300025903 | Ga0207680_10000525 | Ga0207680_100005255 | 261 |
| 168 | 3300026088 | Ga0207641_10200187 | Ga0207641_102001872 | 261 |
| 169 | 3300028379 | Ga0268266_10495193 | Ga0268266_104951932 | 261 |
| 170 | 3300039447 | Ga0436361_0001464 | Ga0436361_0001464_4372_5184 | 261 |
| 171 | 3300039447 | Ga0436361_0028109 | Ga0436361_0028109_7489_8301 | 261 |
| 172 | 3300049569 | Ga0501032_0005754 | Ga0501032_0005754_7854_8690 | 261 |
| 173 | 3300049569 | Ga0501032_0074237 | Ga0501032_0074237_255_1091 | 261 |
| 174 | 3300049570 | Ga0501033_0134863 | Ga0501033_0134863_390_1244 | 261 |
| 175 | 3300049574 | Ga0501038_0047113 | Ga0501038_0047113_229_1065 | 261 |
| 176 | 3300049576 | Ga0501040_0281081 | Ga0501040_0281081_258_1094 | 261 |
| 177 | 3300049580 | Ga0501046_0396461 | Ga0501046_0396461_107_943 | 261 |
| 178 | 3300049581 | Ga0501047_0003456 | Ga0501047_0003456_484_1320 | 261 |
| 179 | 3300049822 | Ga0501035_0003494 | Ga0501035_0003494_11865_12701 | 261 |
| 180 | 3300049822 | Ga0501035_0467117 | Ga0501035_0467117_74_928 | 261 |
| 181 | 3300049823 | Ga0501044_0128019 | Ga0501044_0128019_1229_2065 | 261 |
| 182 | 3300005336 | Ga0070680_100004255 | Ga0070680_1000042555 | 262 |
| 183 | 3300005339 | Ga0070660_100165700 | Ga0070660_1001657002 | 262 |
| 184 | 3300005366 | Ga0070659_100089929 | Ga0070659_1000899292 | 262 |
| 185 | 3300005458 | Ga0070681_10004454 | Ga0070681_1000445411 | 262 |
| 186 | 3300005530 | Ga0070679_100004157 | Ga0070679_1000041575 | 262 |
| 187 | 3300005543 | Ga0070672_100205301 | Ga0070672_1002053012 | 262 |
| 188 | 3300005563 | Ga0068855_100126419 | Ga0068855_1001264192 | 262 |
| 189 | 3300005618 | Ga0068864_100632456 | Ga0068864_1006324562 | 262 |
| 190 | 3300005719 | Ga0068861_100097724 | Ga0068861_1000977242 | 262 |
| 191 | 3300009093 | Ga0105240_10100373 | Ga0105240_101003735 | 262 |
| 192 | 3300009094 | Ga0111539_10142886 | Ga0111539_101428862 | 262 |
| 193 | 3300013104 | Ga0157370_10005673 | Ga0157370_100056732 | 262 |
| 194 | 3300013296 | Ga0157374_10360700 | Ga0157374_103607002 | 262 |
| 195 | 3300014326 | Ga0157380_10062721 | Ga0157380_100627212 | 262 |
| 196 | 3300025912 | Ga0207707_10003824 | Ga0207707_100038245 | 262 |
| 197 | 3300025912 | Ga0207707_10327333 | Ga0207707_103273332 | 262 |
| 198 | 3300025917 | Ga0207660_10008420 | Ga0207660_100084205 | 262 |
| 199 | 3300025921 | Ga0207652_10000117 | Ga0207652_1000011710 | 262 |
| 200 | 3300025932 | Ga0207690_10089298 | Ga0207690_100892982 | 262 |
| 201 | 3300026095 | Ga0207676_10115865 | Ga0207676_101158652 | 262 |
| 202 | 3300026118 | Ga0207675_100170853 | Ga0207675_1001708532 | 262 |
| 203 | 3300039447 | Ga0436361_0614937 | Ga0436361_0614937_6090_6905 | 262 |
| 204 | 3300049574 | Ga0501038_0143175 | Ga0501038_0143175_347_1228 | 262 |
| 205 | 3300049822 | Ga0501035_0189936 | Ga0501035_0189936_228_1106 | 262 |
| 206 | 3300050511 | nmdc:mga08y16_129183_c1 | nmdc:mga08y16_129183_c1_271_1197 | 262 |
| 207 | 3300050511 | nmdc:mga08y16_519984_c1 | nmdc:mga08y16_519984_c1_104_928 | 262 |
| 208 | 3300005535 | Ga0070684_100014623 | Ga0070684_1000146236 | 263 |
| 209 | 3300009094 | Ga0111539_10111025 | Ga0111539_101110254 | 263 |
| 210 | 3300009176 | Ga0105242_10123992 | Ga0105242_101239922 | 263 |
| 211 | 3300010375 | Ga0105239_10377856 | Ga0105239_103778562 | 263 |
| 212 | 3300028653 | Ga0265323_10000793 | Ga0265323_1000079311 | 263 |
| 213 | 3300028800 | Ga0265338_10279597 | Ga0265338_102795971 | 263 |
| 214 | 3300031711 | Ga0265314_10192471 | Ga0265314_101924711 | 263 |
| 215 | 3300039447 | Ga0436361_0076715 | Ga0436361_0076715_1723_2559 | 263 |
| 216 | 3300042876 | Ga0451577_0000009 | Ga0451577_0000009_139742_140617 | 263 |
| 217 | 3300044673 | Ga0453683_0000847 | Ga0453683_0000847_8241_9119 | 263 |
| 218 | 3300044673 | Ga0453683_0003255 | Ga0453683_0003255_5927_6802 | 263 |
| 219 | 3300044673 | Ga0453683_0062762 | Ga0453683_0062762_238_1113 | 263 |
| 220 | 3300044673 | Ga0453683_0080245 | Ga0453683_0080245_845_1723 | 263 |
| 221 | 3300044712 | Ga0453684_0000358 | Ga0453684_0000358_6170_7045 | 263 |
| 222 | 3300044712 | Ga0453684_0012200 | Ga0453684_0012200_10847_11722 | 263 |
| 223 | 3300044712 | Ga0453684_0054005 | Ga0453684_0054005_2818_3693 | 263 |
| 224 | 3300045051 | Ga0451576_0003725 | Ga0451576_0003725_11341_12216 | 263 |
| 225 | 3300048907 | Ga0496104_0244525 | Ga0496104_0244525_701_1543 | 263 |
| 226 | 3300050511 | nmdc:mga08y16_25798_c1 | nmdc:mga08y16_25798_c1_2135_2968 | 263 |
| 227 | 3300003214 | JGI25165J46597_1000080 | JGI25165J46597_1000080132 | 264 |
| 228 | 3300005439 | Ga0070711_100007824 | Ga0070711_1000078244 | 264 |
| 229 | 3300005458 | Ga0070681_10078792 | Ga0070681_100787922 | 264 |
| 230 | 3300005618 | Ga0068864_100104976 | Ga0068864_1001049761 | 264 |
| 231 | 3300006237 | Ga0097621_100236125 | Ga0097621_1002361252 | 264 |
| 232 | 3300013104 | Ga0157370_10179040 | Ga0157370_101790403 | 264 |
| 233 | 3300025231 | Ga0207427_104279 | Ga0207427_1042791 | 264 |
| 234 | 3300025261 | Ga0209233_1000006 | Ga0209233_1000006927 | 264 |
| 235 | 3300025916 | Ga0207663_10025052 | Ga0207663_100250523 | 264 |
| 236 | 3300026088 | Ga0207641_10372325 | Ga0207641_103723252 | 264 |
| 237 | 3300026116 | Ga0207674_10088007 | Ga0207674_100880073 | 264 |
| 238 | 3300031250 | Ga0265331_10000003 | Ga0265331_10000003279 | 264 |
| 239 | 3300031548 | Ga0307408_100054768 | Ga0307408_1000547682 | 264 |
| 240 | 3300031711 | Ga0265314_10058297 | Ga0265314_100582972 | 264 |
| 241 | 3300031824 | Ga0307413_10027655 | Ga0307413_100276553 | 264 |
| 242 | 3300031852 | Ga0307410_10003413 | Ga0307410_100034136 | 264 |
| 243 | 3300031903 | Ga0307407_10043257 | Ga0307407_100432572 | 264 |
| 244 | 3300031911 | Ga0307412_10024686 | Ga0307412_100246863 | 264 |
| 245 | 3300031995 | Ga0307409_100021169 | Ga0307409_1000211693 | 264 |
| 246 | 3300032005 | Ga0307411_10019771 | Ga0307411_100197713 | 264 |
| 247 | 3300032126 | Ga0307415_100060869 | Ga0307415_1000608692 | 264 |
| 248 | 3300037471 | Ga0395905_0012063 | Ga0395905_0012063_4670_5527 | 264 |
| 249 | 3300044658 | Ga0466972_0010618 | Ga0466972_0010618_133_1038 | 264 |
| 250 | 3300048917 | Ga0496114_0425883 | Ga0496114_0425883_339_1157 | 264 |
| 251 | 3300049569 | Ga0501032_0214110 | Ga0501032_0214110_352_1191 | 264 |
| 252 | 3300049570 | Ga0501033_0019956 | Ga0501033_0019956_552_1391 | 264 |
| 253 | 3300049571 | Ga0501034_0013490 | Ga0501034_0013490_1954_2793 | 264 |
| 254 | 3300049573 | Ga0501037_0226307 | Ga0501037_0226307_119_958 | 264 |
| 255 | 3300049574 | Ga0501038_0017190 | Ga0501038_0017190_4610_5488 | 264 |
| 256 | 3300049574 | Ga0501038_0251668 | Ga0501038_0251668_370_1209 | 264 |
| 257 | 3300049575 | Ga0501039_0120120 | Ga0501039_0120120_34_873 | 264 |
| 258 | 3300049579 | Ga0501043_0062949 | Ga0501043_0062949_311_1150 | 264 |
| 259 | 3300049581 | Ga0501047_0028409 | Ga0501047_0028409_3865_4704 | 264 |
| 260 | 3300049584 | Ga0501068_0077004 | Ga0501068_0077004_906_1745 | 264 |
| 261 | 3300049586 | Ga0501070_0053798 | Ga0501070_0053798_2047_2886 | 264 |
| 262 | 3300049590 | Ga0501074_0106227 | Ga0501074_0106227_903_1742 | 264 |
| 263 | 3300049742 | Ga0501080_0097119 | Ga0501080_0097119_516_1355 | 264 |
| 264 | 3300049742 | Ga0501080_0603315 | Ga0501080_0603315_30_872 | 264 |
| 265 | 3300049822 | Ga0501035_0009642 | Ga0501035_0009642_3387_4226 | 264 |
| 266 | 3300049823 | Ga0501044_0019468 | Ga0501044_0019468_3631_4470 | 264 |
| 267 | 3300005327 | Ga0070658_10151442 | Ga0070658_101514422 | 265 |
| 268 | 3300005330 | Ga0070690_100205882 | Ga0070690_1002058822 | 265 |
| 269 | 3300005336 | Ga0070680_100218960 | Ga0070680_1002189602 | 265 |
| 270 | 3300005337 | Ga0070682_100005201 | Ga0070682_1000052015 | 265 |
| 271 | 3300005354 | Ga0070675_100020130 | Ga0070675_1000201305 | 265 |
| 272 | 3300005354 | Ga0070675_100220854 | Ga0070675_1002208542 | 265 |
| 273 | 3300005440 | Ga0070705_100011094 | Ga0070705_1000110945 | 265 |
| 274 | 3300005444 | Ga0070694_100034546 | Ga0070694_1000345463 | 265 |
| 275 | 3300005455 | Ga0070663_100002230 | Ga0070663_1000022304 | 265 |
| 276 | 3300005456 | Ga0070678_100022994 | Ga0070678_1000229942 | 265 |
| 277 | 3300005458 | Ga0070681_10030948 | Ga0070681_100309484 | 265 |
| 278 | 3300005530 | Ga0070679_100132245 | Ga0070679_1001322452 | 265 |
| 279 | 3300005539 | Ga0068853_100005744 | Ga0068853_1000057445 | 265 |
| 280 | 3300005547 | Ga0070693_100000948 | Ga0070693_1000009485 | 265 |
| 281 | 3300005549 | Ga0070704_100102446 | Ga0070704_1001024462 | 265 |
| 282 | 3300005615 | Ga0070702_100052808 | Ga0070702_1000528081 | 265 |
| 283 | 3300005843 | Ga0068860_100112190 | Ga0068860_1001121903 | 265 |
| 284 | 3300006881 | Ga0068865_100082760 | Ga0068865_1000827602 | 265 |
| 285 | 3300009094 | Ga0111539_10012876 | Ga0111539_100128762 | 265 |
| 286 | 3300009101 | Ga0105247_10095814 | Ga0105247_100958142 | 265 |
| 287 | 3300009174 | Ga0105241_10001696 | Ga0105241_100016962 | 265 |
| 288 | 3300009545 | Ga0105237_10046750 | Ga0105237_100467503 | 265 |
| 289 | 3300009551 | Ga0105238_10044626 | Ga0105238_100446265 | 265 |
| 290 | 3300011119 | Ga0105246_10041703 | Ga0105246_100417034 | 265 |
| 291 | 3300013105 | Ga0157369_10077733 | Ga0157369_100777332 | 265 |
| 292 | 3300013105 | Ga0157369_10552465 | Ga0157369_105524652 | 265 |
| 293 | 3300014326 | Ga0157380_10051605 | Ga0157380_100516053 | 265 |
| 294 | 3300021361 | Ga0213872_10001049 | Ga0213872_100010495 | 265 |
| 295 | 3300025904 | Ga0207647_10005236 | Ga0207647_100052365 | 265 |
| 296 | 3300025904 | Ga0207647_10009247 | Ga0207647_100092477 | 265 |
| 297 | 3300025911 | Ga0207654_10036699 | Ga0207654_100366992 | 265 |
| 298 | 3300025912 | Ga0207707_10014155 | Ga0207707_100141554 | 265 |
| 299 | 3300025914 | Ga0207671_10098074 | Ga0207671_100980742 | 265 |
| 300 | 3300025917 | Ga0207660_10107715 | Ga0207660_101077152 | 265 |
| 301 | 3300025921 | Ga0207652_10066575 | Ga0207652_100665752 | 265 |
| 302 | 3300025924 | Ga0207694_10084206 | Ga0207694_100842063 | 265 |
| 303 | 3300025926 | Ga0207659_10227087 | Ga0207659_102270872 | 265 |
| 304 | 3300025938 | Ga0207704_10033169 | Ga0207704_100331694 | 265 |
| 305 | 3300026041 | Ga0207639_10015738 | Ga0207639_100157385 | 265 |
| 306 | 3300026067 | Ga0207678_10004292 | Ga0207678_1000429210 | 265 |
| 307 | 3300026121 | Ga0207683_10032821 | Ga0207683_100328215 | 265 |
| 308 | 3300028381 | Ga0268264_10104322 | Ga0268264_101043223 | 265 |
| 309 | 3300031240 | Ga0265320_10000539 | Ga0265320_1000053910 | 265 |
| 310 | 3300031241 | Ga0265325_10011915 | Ga0265325_100119156 | 265 |
| 311 | 3300031595 | Ga0265313_10006022 | Ga0265313_100060222 | 265 |
| 312 | 3300031712 | Ga0265342_10096308 | Ga0265342_100963081 | 265 |
| 313 | 3300039447 | Ga0436361_0270082 | Ga0436361_0270082_5795_6640 | 265 |
| 314 | 3300039447 | Ga0436361_0621527 | Ga0436361_0621527_3242_4090 | 265 |
| 315 | 3300044684 | Ga0466966_0035094 | Ga0466966_0035094_545_1393 | 265 |
| 316 | 3300045836 | Ga0466958_0005292 | Ga0466958_0005292_5084_5932 | 265 |
| 317 | 3300048903 | Ga0496100_0008675 | Ga0496100_0008675_4305_5201 | 265 |
| 318 | 3300048904 | Ga0496101_0028900 | Ga0496101_0028900_2417_3313 | 265 |
| 319 | 3300048906 | Ga0496103_0008641 | Ga0496103_0008641_633_1529 | 265 |
| 320 | 3300048907 | Ga0496104_0010035 | Ga0496104_0010035_5271_6167 | 265 |
| 321 | 3300048908 | Ga0496105_0067510 | Ga0496105_0067510_887_1738 | 265 |
| 322 | 3300048908 | Ga0496105_0137711 | Ga0496105_0137711_550_1446 | 265 |
| 323 | 3300048909 | Ga0496106_0008180 | Ga0496106_0008180_5238_6134 | 265 |
| 324 | 3300048909 | Ga0496106_0240135 | Ga0496106_0240135_352_1248 | 265 |
| 325 | 3300048910 | Ga0496107_0010495 | Ga0496107_0010495_1218_2114 | 265 |
| 326 | 3300048917 | Ga0496114_0202854 | Ga0496114_0202854_784_1680 | 265 |
| 327 | 3300048918 | Ga0496115_0001590 | Ga0496115_0001590_6389_7285 | 265 |
| 328 | 3300050491 | nmdc:mga00v17_79865_c1 | nmdc:mga00v17_79865_c1_1027_1875 | 265 |
| 329 | iso_pu_bacteria | 2513237146 | 2513929068 | 265 |
| 330 | 3300005329 | Ga0070683_100302830 | Ga0070683_1003028302 | 266 |
| 331 | 3300005435 | Ga0070714_100025366 | Ga0070714_1000253665 | 266 |
| 332 | 3300005563 | Ga0068855_100347814 | Ga0068855_1003478142 | 266 |
| 333 | 3300005719 | Ga0068861_100508312 | Ga0068861_1005083122 | 266 |
| 334 | 3300006852 | Ga0075433_10017300 | Ga0075433_100173003 | 266 |
| 335 | 3300006871 | Ga0075434_100001633 | Ga0075434_10000163312 | 266 |
| 336 | 3300006914 | Ga0075436_100156370 | Ga0075436_1001563702 | 266 |
| 337 | 3300007076 | Ga0075435_100035677 | Ga0075435_1000356773 | 266 |
| 338 | 3300009093 | Ga0105240_10336732 | Ga0105240_103367322 | 266 |
| 339 | 3300009551 | Ga0105238_10139765 | Ga0105238_101397653 | 266 |
| 340 | 3300013105 | Ga0157369_10204052 | Ga0157369_102040522 | 266 |
| 341 | 3300014497 | Ga0182008_10035653 | Ga0182008_100356532 | 266 |
| 342 | 3300015261 | Ga0182006_1000005 | Ga0182006_1000005421 | 266 |
| 343 | 3300015265 | Ga0182005_1010468 | Ga0182005_10104681 | 266 |
| 344 | 3300025913 | Ga0207695_10112260 | Ga0207695_101122603 | 266 |
| 345 | 3300025920 | Ga0207649_10308604 | Ga0207649_103086041 | 266 |
| 346 | 3300025924 | Ga0207694_10018692 | Ga0207694_100186923 | 266 |
| 347 | 3300025929 | Ga0207664_10104343 | Ga0207664_101043432 | 266 |
| 348 | 3300025944 | Ga0207661_10317248 | Ga0207661_103172482 | 266 |
| 349 | 3300031241 | Ga0265325_10136992 | Ga0265325_101369922 | 266 |
| 350 | 3300031712 | Ga0265342_10075227 | Ga0265342_100752272 | 266 |
| 351 | 3300037312 | Ga0395899_0022054 | Ga0395899_0022054_2117_2968 | 266 |
| 352 | 3300037418 | Ga0395900_0019258 | Ga0395900_0019258_3447_4298 | 266 |
| 353 | 3300037471 | Ga0395905_0010620 | Ga0395905_0010620_6333_7184 | 266 |
| 354 | 3300038443 | Ga0395901_0001910 | Ga0395901_0001910_15505_16356 | 266 |
| 355 | 3300045051 | Ga0451576_0524834 | Ga0451576_0524834_215_1105 | 266 |
| 356 | 3300045976 | Ga0466967_0693530 | Ga0466967_0693530_132_983 | 266 |
| 357 | 3300046452 | Ga0495617_000016 | Ga0495617_000016_90408_91253 | 266 |
| 358 | 3300046492 | Ga0495585_0000007 | Ga0495585_0000007_224927_225772 | 266 |
| 359 | 3300046513 | Ga0495616_0000001 | Ga0495616_0000001_772174_773040 | 266 |
| 360 | 3300046515 | Ga0495620_0000078 | Ga0495620_0000078_46854_47699 | 266 |
| 361 | 3300046518 | Ga0495631_0000051 | Ga0495631_0000051_16893_17738 | 266 |
| 362 | 3300046524 | Ga0495648_0000584 | Ga0495648_0000584_26928_27773 | 266 |
| 363 | 3300046616 | Ga0495668_0009414 | Ga0495668_0009414_3736_4581 | 266 |
| 364 | 3300046665 | Ga0495661_0002549 | Ga0495661_0002549_963_1808 | 266 |
| 365 | 3300046810 | Ga0495660_0000025 | Ga0495660_0000025_111040_111885 | 266 |
| 366 | 3300046810 | Ga0495660_0058530 | Ga0495660_0058530_547_1413 | 266 |
| 367 | 3300047469 | Ga0495673_0000001 | Ga0495673_0000001_352722_353567 | 266 |
| 368 | 3300047472 | Ga0495686_0000037 | Ga0495686_0000037_105884_106729 | 266 |
| 369 | 3300047472 | Ga0495686_0029670 | Ga0495686_0029670_596_1444 | 266 |
| 370 | 3300048924 | Ga0496121_0000666 | Ga0496121_0000666_51767_52612 | 266 |
| 371 | 3300049460 | Ga0495682_0003698 | Ga0495682_0003698_1563_2408 | 266 |
| 372 | 3300050512 | nmdc:mga0n895_25655_c1 | nmdc:mga0n895_25655_c1_3148_4020 | 266 |
| 373 | 3300050513 | nmdc:mga0rr50_94778_c1 | nmdc:mga0rr50_94778_c1_1065_1937 | 266 |
| 374 | 3300050514 | nmdc:mga08x19_270916_c1 | nmdc:mga08x19_270916_c1_128_1000 | 266 |
| 375 | 3300050515 | nmdc:mga0a205_2343_c1 | nmdc:mga0a205_2343_c1_4108_4980 | 266 |
| 376 | 3300053730 | Ga0500645_002013 | Ga0500645_002013_323_1168 | 266 |
| 377 | iso_pu_bacteria | 2593339198 | 2595315230 | 266 |
| 378 | iso_pu_bacteria | 2956897341 | 2956899596 | 266 |
| 379 | iso_pu_bacteria | 2980125574 | 2980126009 | 266 |
| 380 | 3300005328 | Ga0070676_10067770 | Ga0070676_100677701 | 267 |
| 381 | 3300005345 | Ga0070692_10005282 | Ga0070692_100052823 | 267 |
| 382 | 3300005536 | Ga0070697_100069906 | Ga0070697_1000699063 | 267 |
| 383 | 3300005844 | Ga0068862_100020918 | Ga0068862_1000209182 | 267 |
| 384 | 3300006881 | Ga0068865_100039024 | Ga0068865_1000390244 | 267 |
| 385 | 3300017792 | Ga0163161_10001704 | Ga0163161_1000170414 | 267 |
| 386 | 3300021361 | Ga0213872_10000011 | Ga0213872_1000001153 | 267 |
| 387 | 3300025934 | Ga0207686_10178503 | Ga0207686_101785032 | 267 |
| 388 | 3300025938 | Ga0207704_10088623 | Ga0207704_100886232 | 267 |
| 389 | 3300025941 | Ga0207711_10321613 | Ga0207711_103216132 | 267 |
| 390 | 3300031344 | Ga0265316_10133322 | Ga0265316_101333222 | 267 |
| 391 | 3300036401 | Ga0373937_0000389 | Ga0373937_0000389_37436_38311 | 267 |
| 392 | 3300037068 | Ga0373925_0402810 | Ga0373925_0402810_181_1086 | 267 |
| 393 | 3300037471 | Ga0395905_0053882 | Ga0395905_0053882_663_1565 | 267 |
| 394 | 3300037471 | Ga0395905_0106981 | Ga0395905_0106981_1538_2440 | 267 |
| 395 | 3300039447 | Ga0436361_0296121 | Ga0436361_0296121_30563_31414 | 267 |
| 396 | 3300041999 | Ga0439433_0034573 | Ga0439433_0034573_129_1031 | 267 |
| 397 | 3300044673 | Ga0453683_0008771 | Ga0453683_0008771_5484_6362 | 267 |
| 398 | 3300044842 | Ga0466957_0194816 | Ga0466957_0194816_114_965 | 267 |
| 399 | 3300046452 | Ga0495617_001385 | Ga0495617_001385_964_1812 | 267 |
| 400 | 3300046460 | Ga0495638_0000044 | Ga0495638_0000044_70860_71708 | 267 |
| 401 | 3300046501 | Ga0495607_0000030 | Ga0495607_0000030_14459_15307 | 267 |
| 402 | 3300046501 | Ga0495607_0169378 | Ga0495607_0169378_63_911 | 267 |
| 403 | 3300046506 | Ga0495583_0014996 | Ga0495583_0014996_713_1561 | 267 |
| 404 | 3300046538 | Ga0495609_0018043 | Ga0495609_0018043_1552_2400 | 267 |
| 405 | 3300046616 | Ga0495668_0034110 | Ga0495668_0034110_323_1171 | 267 |
| 406 | 3300046648 | Ga0495611_0000001 | Ga0495611_0000001_1550447_1551295 | 267 |
| 407 | 3300046660 | Ga0495625_0000001 | Ga0495625_0000001_364742_365590 | 267 |
| 408 | 3300046794 | Ga0495589_0000172 | Ga0495589_0000172_41130_41978 | 267 |
| 409 | 3300046810 | Ga0495660_0000018 | Ga0495660_0000018_132704_133552 | 267 |
| 410 | 3300047446 | Ga0495679_000001 | Ga0495679_000001_35660_36508 | 267 |
| 411 | 3300047469 | Ga0495673_0000129 | Ga0495673_0000129_2078_2926 | 267 |
| 412 | 3300047472 | Ga0495686_0019170 | Ga0495686_0019170_204_1052 | 267 |
| 413 | 3300049459 | Ga0495678_000209 | Ga0495678_000209_33799_34647 | 267 |
| 414 | 3300049460 | Ga0495682_0023440 | Ga0495682_0023440_183_1031 | 267 |
| 415 | 3300050515 | nmdc:mga0a205_232460_c1 | nmdc:mga0a205_232460_c1_866_1702 | 267 |
| 416 | 3300053087 | Ga0500643_000002 | Ga0500643_000002_270463_271311 | 267 |
| 417 | 3300053103 | Ga0500555_011022 | Ga0500555_011022_116_964 | 267 |
| 418 | iso_pu_bacteria | 2671180694 | 2673822346 | 267 |
| 419 | 3300005330 | Ga0070690_100021725 | Ga0070690_1000217253 | 268 |
| 420 | 3300005335 | Ga0070666_10070951 | Ga0070666_100709512 | 268 |
| 421 | 3300005336 | Ga0070680_100005902 | Ga0070680_1000059028 | 268 |
| 422 | 3300005343 | Ga0070687_100003573 | Ga0070687_1000035736 | 268 |
| 423 | 3300005347 | Ga0070668_100008773 | Ga0070668_1000087737 | 268 |
| 424 | 3300005367 | Ga0070667_100003252 | Ga0070667_10000325212 | 268 |
| 425 | 3300005441 | Ga0070700_100021791 | Ga0070700_1000217914 | 268 |
| 426 | 3300005457 | Ga0070662_100178547 | Ga0070662_1001785471 | 268 |
| 427 | 3300005459 | Ga0068867_100006452 | Ga0068867_1000064522 | 268 |
| 428 | 3300005530 | Ga0070679_100017484 | Ga0070679_1000174846 | 268 |
| 429 | 3300005539 | Ga0068853_100063692 | Ga0068853_1000636923 | 268 |
| 430 | 3300005543 | Ga0070672_100001996 | Ga0070672_1000019968 | 268 |
| 431 | 3300005543 | Ga0070672_100120122 | Ga0070672_1001201222 | 268 |
| 432 | 3300005564 | Ga0070664_100298477 | Ga0070664_1002984772 | 268 |
| 433 | 3300005616 | Ga0068852_100404522 | Ga0068852_1004045222 | 268 |
| 434 | 3300005618 | Ga0068864_100166800 | Ga0068864_1001668002 | 268 |
| 435 | 3300005618 | Ga0068864_100214588 | Ga0068864_1002145882 | 268 |
| 436 | 3300005718 | Ga0068866_10093540 | Ga0068866_100935401 | 268 |
| 437 | 3300005841 | Ga0068863_100015935 | Ga0068863_1000159358 | 268 |
| 438 | 3300005843 | Ga0068860_100001260 | Ga0068860_10000126019 | 268 |
| 439 | 3300006358 | Ga0068871_100084481 | Ga0068871_1000844813 | 268 |
| 440 | 3300006881 | Ga0068865_100003521 | Ga0068865_1000035213 | 268 |
| 441 | 3300009093 | Ga0105240_10073822 | Ga0105240_100738224 | 268 |
| 442 | 3300009098 | Ga0105245_10160243 | Ga0105245_101602431 | 268 |
| 443 | 3300009098 | Ga0105245_10411442 | Ga0105245_104114422 | 268 |
| 444 | 3300009148 | Ga0105243_10081167 | Ga0105243_100811672 | 268 |
| 445 | 3300009174 | Ga0105241_10012353 | Ga0105241_100123532 | 268 |
| 446 | 3300009176 | Ga0105242_10008496 | Ga0105242_100084969 | 268 |
| 447 | 3300009176 | Ga0105242_10280733 | Ga0105242_102807332 | 268 |
| 448 | 3300009177 | Ga0105248_10000001 | Ga0105248_100000011003 | 268 |
| 449 | 3300009177 | Ga0105248_10207268 | Ga0105248_102072682 | 268 |
| 450 | 3300009177 | Ga0105248_10276378 | Ga0105248_102763782 | 268 |
| 451 | 3300009553 | Ga0105249_10065053 | Ga0105249_100650533 | 268 |
| 452 | 3300013102 | Ga0157371_10165609 | Ga0157371_101656092 | 268 |
| 453 | 3300013306 | Ga0163162_10007061 | Ga0163162_100070619 | 268 |
| 454 | 3300013308 | Ga0157375_10046761 | Ga0157375_100467612 | 268 |
| 455 | 3300013308 | Ga0157375_10129431 | Ga0157375_101294312 | 268 |
| 456 | 3300014968 | Ga0157379_10008941 | Ga0157379_100089413 | 268 |
| 457 | 3300017792 | Ga0163161_10037506 | Ga0163161_100375063 | 268 |
| 458 | 3300025315 | Ga0207697_10051159 | Ga0207697_100511592 | 268 |
| 459 | 3300025899 | Ga0207642_10003560 | Ga0207642_100035605 | 268 |
| 460 | 3300025907 | Ga0207645_10006705 | Ga0207645_100067052 | 268 |
| 461 | 3300025908 | Ga0207643_10096926 | Ga0207643_100969262 | 268 |
| 462 | 3300025913 | Ga0207695_10065151 | Ga0207695_100651513 | 268 |
| 463 | 3300025917 | Ga0207660_10008400 | Ga0207660_100084008 | 268 |
| 464 | 3300025918 | Ga0207662_10111956 | Ga0207662_101119562 | 268 |
| 465 | 3300025921 | Ga0207652_10289390 | Ga0207652_102893901 | 268 |
| 466 | 3300025923 | Ga0207681_10004364 | Ga0207681_100043647 | 268 |
| 467 | 3300025925 | Ga0207650_10001175 | Ga0207650_100011759 | 268 |
| 468 | 3300025926 | Ga0207659_10001653 | Ga0207659_100016539 | 268 |
| 469 | 3300025926 | Ga0207659_10010409 | Ga0207659_100104095 | 268 |
| 470 | 3300025931 | Ga0207644_10022651 | Ga0207644_100226514 | 268 |
| 471 | 3300025937 | Ga0207669_10068361 | Ga0207669_100683612 | 268 |
| 472 | 3300025937 | Ga0207669_10121610 | Ga0207669_101216102 | 268 |
| 473 | 3300025940 | Ga0207691_10285957 | Ga0207691_102859572 | 268 |
| 474 | 3300025941 | Ga0207711_10000001 | Ga0207711_10000001868 | 268 |
| 475 | 3300025941 | Ga0207711_10028527 | Ga0207711_100285274 | 268 |
| 476 | 3300025941 | Ga0207711_10070914 | Ga0207711_100709143 | 268 |
| 477 | 3300025942 | Ga0207689_10018156 | Ga0207689_100181565 | 268 |
| 478 | 3300025960 | Ga0207651_10250262 | Ga0207651_102502622 | 268 |
| 479 | 3300025961 | Ga0207712_10003405 | Ga0207712_100034052 | 268 |
| 480 | 3300025972 | Ga0207668_10017174 | Ga0207668_100171742 | 268 |
| 481 | 3300025986 | Ga0207658_10000458 | Ga0207658_1000045818 | 268 |
| 482 | 3300026041 | Ga0207639_10000591 | Ga0207639_1000059122 | 268 |
| 483 | 3300026067 | Ga0207678_10270576 | Ga0207678_102705762 | 268 |
| 484 | 3300026078 | Ga0207702_10403312 | Ga0207702_104033122 | 268 |
| 485 | 3300026088 | Ga0207641_10064300 | Ga0207641_100643004 | 268 |
| 486 | 3300026095 | Ga0207676_10066079 | Ga0207676_100660793 | 268 |
| 487 | 3300028379 | Ga0268266_10187533 | Ga0268266_101875332 | 268 |
| 488 | 3300028381 | Ga0268264_10000963 | Ga0268264_1000096313 | 268 |
| 489 | 3300029957 | Ga0265324_10009208 | Ga0265324_100092083 | 268 |
| 490 | 3300031901 | Ga0307406_10180862 | Ga0307406_101808622 | 268 |
| 491 | 3300032002 | Ga0307416_100024582 | Ga0307416_1000245824 | 268 |
| 492 | 3300049571 | Ga0501034_0076554 | Ga0501034_0076554_1336_2220 | 268 |
| 493 | 3300049574 | Ga0501038_0087246 | Ga0501038_0087246_561_1445 | 268 |
| 494 | 3300049583 | Ga0501067_0054764 | Ga0501067_0054764_988_1881 | 268 |
| 495 | 3300049742 | Ga0501080_0005029 | Ga0501080_0005029_10068_10925 | 268 |
| 496 | 3300005564 | Ga0070664_100178543 | Ga0070664_1001785432 | 269 |
| 497 | 3300005617 | Ga0068859_100028230 | Ga0068859_1000282303 | 269 |
| 498 | 3300005981 | Ga0081538_10003893 | Ga0081538_100038939 | 269 |
| 499 | 3300006237 | Ga0097621_100166980 | Ga0097621_1001669802 | 269 |
| 500 | 3300006931 | Ga0097620_100028228 | Ga0097620_1000282283 | 269 |
| 501 | 3300014969 | Ga0157376_10479691 | Ga0157376_104796912 | 269 |
| 502 | 3300021384 | Ga0213876_10000498 | Ga0213876_1000049811 | 269 |
| 503 | 3300025944 | Ga0207661_10138017 | Ga0207661_101380172 | 269 |
| 504 | 3300026078 | Ga0207702_10088165 | Ga0207702_100881653 | 269 |
| 505 | 3300031456 | Ga0307513_10002839 | Ga0307513_100028394 | 269 |
| 506 | 3300035088 | Ga0373940_0042610 | Ga0373940_0042610_17_877 | 269 |
| 507 | 3300035695 | Ga0373927_0000253 | Ga0373927_0000253_33089_33982 | 269 |
| 508 | 3300035725 | Ga0373947_0126801 | Ga0373947_0126801_480_1373 | 269 |
| 509 | 3300037068 | Ga0373925_0076400 | Ga0373925_0076400_535_1395 | 269 |
| 510 | 3300037068 | Ga0373925_0090657 | Ga0373925_0090657_1374_2267 | 269 |
| 511 | 3300039437 | Ga0436365_1234622 | Ga0436365_1234622_110315_111217 | 269 |
| 512 | 3300042876 | Ga0451577_0008808 | Ga0451577_0008808_2244_3137 | 269 |
| 513 | 3300046455 | Ga0495603_0014873 | Ga0495603_0014873_3273_4133 | 269 |
| 514 | 3300046530 | Ga0495654_0038759 | Ga0495654_0038759_348_1208 | 269 |
| 515 | 3300046557 | Ga0495622_0029916 | Ga0495622_0029916_1004_1864 | 269 |
| 516 | 3300046648 | Ga0495611_0070221 | Ga0495611_0070221_695_1555 | 269 |
| 517 | 3300046683 | Ga0495658_0001841 | Ga0495658_0001841_5759_6631 | 269 |
| 518 | 3300046694 | Ga0495649_0004336 | Ga0495649_0004336_2958_3818 | 269 |
| 519 | 3300047320 | Ga0495672_0005079 | Ga0495672_0005079_6036_6896 | 269 |
| 520 | 3300053178 | Ga0500637_0001230 | Ga0500637_0001230_1532_2392 | 269 |
| 521 | 3300059421 | Ga0590071_003216 | Ga0590071_003216_2662_3570 | 269 |
| 522 | iso_pu_bacteria | 2734482264 | 2735837308 | 269 |
| 523 | 3300009174 | Ga0105241_10186925 | Ga0105241_101869252 | 270 |
| 524 | 3300017792 | Ga0163161_10019256 | Ga0163161_100192562 | 270 |
| 525 | 3300025253 | Ga0209677_101153 | Ga0209677_1011536 | 270 |
| 526 | 3300046506 | Ga0495583_0000090 | Ga0495583_0000090_31402_32337 | 270 |
| 527 | 3300046507 | Ga0495606_0002085 | Ga0495606_0002085_5921_6862 | 270 |
| 528 | 3300046512 | Ga0495610_0016504 | Ga0495610_0016504_1947_2852 | 270 |
| 529 | 3300046616 | Ga0495668_0031488 | Ga0495668_0031488_1151_2104 | 270 |
| 530 | 3300046660 | Ga0495625_0004921 | Ga0495625_0004921_7940_8872 | 270 |
| 531 | 3300046684 | Ga0495669_0009832 | Ga0495669_0009832_2288_3247 | 270 |
| 532 | 3300046694 | Ga0495649_0000203 | Ga0495649_0000203_32017_32952 | 270 |
| 533 | 3300046794 | Ga0495589_0059301 | Ga0495589_0059301_364_1311 | 270 |
| 534 | 3300048903 | Ga0496100_0126992 | Ga0496100_0126992_577_1440 | 270 |
| 535 | 3300048904 | Ga0496101_0004321 | Ga0496101_0004321_539_1402 | 270 |
| 536 | iso_pu_bacteria | 2718218334 | 2721027090 | 270 |
| 537 | iso_pu_bacteria | 2738543009 | 2739226781 | 270 |
| 538 | 3300003756 | Ga0055533_1000043 | Ga0055533_10000437 | 271 |
| 539 | 3300003759 | Ga0055525_1001369 | Ga0055525_10013692 | 271 |
| 540 | 3300025226 | Ga0209674_100067 | Ga0209674_1000677 | 271 |
| 541 | 3300025230 | Ga0209563_100068 | Ga0209563_1000687 | 271 |
| 542 | 3300025253 | Ga0209677_100049 | Ga0209677_100049154 | 271 |
| 543 | iso_pu_bacteria | 2884338543 | 2884341632 | 271 |
| 544 | iso_pu_bacteria | 2939611941 | 2939612839 | 271 |
| 545 | 3300006051 | Ga0075364_10059375 | Ga0075364_100593753 | 272 |
| 546 | 3300005441 | Ga0070700_100083151 | Ga0070700_1000831513 | 273 |
| 547 | 3300005459 | Ga0068867_100015082 | Ga0068867_1000150822 | 273 |
| 548 | 3300005471 | Ga0070698_100166169 | Ga0070698_1001661692 | 273 |
| 549 | 3300005840 | Ga0068870_10135326 | Ga0068870_101353262 | 273 |
| 550 | 3300009148 | Ga0105243_10008704 | Ga0105243_100087046 | 273 |
| 551 | 3300009174 | Ga0105241_10259485 | Ga0105241_102594852 | 273 |
| 552 | 3300009176 | Ga0105242_10284951 | Ga0105242_102849512 | 273 |
| 553 | 3300010375 | Ga0105239_10047517 | Ga0105239_100475172 | 273 |
| 554 | 3300013297 | Ga0157378_10629721 | Ga0157378_106297212 | 273 |
| 555 | 3300025907 | Ga0207645_10003406 | Ga0207645_100034065 | 273 |
| 556 | 3300025908 | Ga0207643_10123898 | Ga0207643_101238982 | 273 |
| 557 | 3300025934 | Ga0207686_10084115 | Ga0207686_100841152 | 273 |
| 558 | 3300025935 | Ga0207709_10007930 | Ga0207709_100079305 | 273 |
| 559 | 3300025938 | Ga0207704_10115295 | Ga0207704_101152952 | 273 |
| 560 | 3300026089 | Ga0207648_10002148 | Ga0207648_100021486 | 273 |
| 561 | 3300005331 | Ga0070670_100011884 | Ga0070670_1000118847 | 274 |
| 562 | 3300005333 | Ga0070677_10028238 | Ga0070677_100282381 | 274 |
| 563 | 3300005353 | Ga0070669_100004868 | Ga0070669_1000048682 | 274 |
| 564 | 3300005354 | Ga0070675_100002590 | Ga0070675_1000025902 | 274 |
| 565 | 3300005355 | Ga0070671_100011411 | Ga0070671_1000114115 | 274 |
| 566 | 3300005364 | Ga0070673_100005879 | Ga0070673_1000058792 | 274 |
| 567 | 3300005367 | Ga0070667_100039804 | Ga0070667_1000398043 | 274 |
| 568 | 3300005456 | Ga0070678_100028588 | Ga0070678_1000285884 | 274 |
| 569 | 3300005543 | Ga0070672_100005492 | Ga0070672_1000054922 | 274 |
| 570 | 3300005564 | Ga0070664_100146368 | Ga0070664_1001463682 | 274 |
| 571 | 3300005841 | Ga0068863_100267206 | Ga0068863_1002672062 | 274 |
| 572 | 3300006237 | Ga0097621_100053668 | Ga0097621_1000536682 | 274 |
| 573 | 3300006358 | Ga0068871_100025405 | Ga0068871_1000254053 | 274 |
| 574 | 3300014326 | Ga0157380_10062408 | Ga0157380_100624083 | 274 |
| 575 | 3300014969 | Ga0157376_10122498 | Ga0157376_101224982 | 274 |
| 576 | 3300015687 | Ga0183368_1004 | Ga0183368_1004245 | 274 |
| 577 | 3300025893 | Ga0207682_10000873 | Ga0207682_1000087315 | 274 |
| 578 | 3300025923 | Ga0207681_10007115 | Ga0207681_100071152 | 274 |
| 579 | 3300025925 | Ga0207650_10020978 | Ga0207650_100209782 | 274 |
| 580 | 3300025926 | Ga0207659_10002446 | Ga0207659_100024465 | 274 |
| 581 | 3300025931 | Ga0207644_10004577 | Ga0207644_100045777 | 274 |
| 582 | 3300025940 | Ga0207691_10021975 | Ga0207691_100219753 | 274 |
| 583 | 3300025945 | Ga0207679_10118291 | Ga0207679_101182912 | 274 |
| 584 | 3300025960 | Ga0207651_10001133 | Ga0207651_1000113312 | 274 |
| 585 | 3300025972 | Ga0207668_10146968 | Ga0207668_101469681 | 274 |
| 586 | 3300025986 | Ga0207658_10072107 | Ga0207658_100721073 | 274 |
| 587 | 3300026121 | Ga0207683_10001702 | Ga0207683_100017022 | 274 |
| 588 | 3300046457 | Ga0495590_0003984 | Ga0495590_0003984_2492_3466 | 274 |
| 589 | 3300048918 | Ga0496115_0000024 | Ga0496115_0000024_118652_119503 | 274 |
| 590 | 3300050509 | nmdc:mga0qj67_323760_c1 | nmdc:mga0qj67_323760_c1_145_1035 | 274 |
| 591 | 3300005331 | Ga0070670_100000010 | Ga0070670_100000010119 | 275 |
| 592 | 3300005337 | Ga0070682_100339492 | Ga0070682_1003394921 | 275 |
| 593 | 3300005345 | Ga0070692_10083577 | Ga0070692_100835772 | 275 |
| 594 | 3300005435 | Ga0070714_100000020 | Ga0070714_10000002075 | 275 |
| 595 | 3300005457 | Ga0070662_100004570 | Ga0070662_1000045703 | 275 |
| 596 | 3300005539 | Ga0068853_100074261 | Ga0068853_1000742612 | 275 |
| 597 | 3300005614 | Ga0068856_100087084 | Ga0068856_1000870842 | 275 |
| 598 | 3300009551 | Ga0105238_10089051 | Ga0105238_100890512 | 275 |
| 599 | 3300010375 | Ga0105239_10211780 | Ga0105239_102117802 | 275 |
| 600 | 3300013100 | Ga0157373_10064238 | Ga0157373_100642383 | 275 |
| 601 | 3300025904 | Ga0207647_10027938 | Ga0207647_100279383 | 275 |
| 602 | 3300025919 | Ga0207657_10014891 | Ga0207657_100148917 | 275 |
| 603 | 3300025924 | Ga0207694_10036656 | Ga0207694_100366562 | 275 |
| 604 | 3300025929 | Ga0207664_10000023 | Ga0207664_10000023109 | 275 |
| 605 | 3300025932 | Ga0207690_10001386 | Ga0207690_100013869 | 275 |
| 606 | 3300025933 | Ga0207706_10006952 | Ga0207706_100069527 | 275 |
| 607 | 3300025949 | Ga0207667_10029251 | Ga0207667_100292513 | 275 |
| 608 | 3300026041 | Ga0207639_10082227 | Ga0207639_100822272 | 275 |
| 609 | 3300026116 | Ga0207674_10102952 | Ga0207674_101029522 | 275 |
| 610 | 3300049585 | Ga0501069_0041850 | Ga0501069_0041850_1243_2124 | 275 |
| 611 | 3300049586 | Ga0501070_0113972 | Ga0501070_0113972_746_1627 | 275 |
| 612 | 3300049590 | Ga0501074_0004341 | Ga0501074_0004341_2196_3077 | 275 |
| 613 | 3300049742 | Ga0501080_0024247 | Ga0501080_0024247_3732_4613 | 275 |
| 614 | 3300049822 | Ga0501035_0063469 | Ga0501035_0063469_1747_2628 | 275 |
| 615 | 3300003316 | rootH1_10003874 | rootH1_100038742 | 276 |
| 616 | 3300049742 | Ga0501080_0240181 | Ga0501080_0240181_539_1402 | 276 |
| 617 | 3300049572 | Ga0501036_0174659 | Ga0501036_0174659_786_1649 | 277 |
| 618 | 3300049573 | Ga0501037_0080203 | Ga0501037_0080203_1305_2168 | 277 |
| 619 | 3300049822 | Ga0501035_0111966 | Ga0501035_0111966_1044_1907 | 277 |
| 620 | 3300049571 | Ga0501034_0461379 | Ga0501034_0461379_270_1133 | 278 |
| 621 | 3300001915 | JGI24741J21665_1002176 | JGI24741J21665_10021765 | 279 |
| 622 | 3300001915 | JGI24741J21665_1003052 | JGI24741J21665_10030522 | 279 |
| 623 | 3300001979 | JGI24740J21852_10000633 | JGI24740J21852_100006332 | 279 |
| 624 | 3300001979 | JGI24740J21852_10000975 | JGI24740J21852_1000097511 | 279 |
| 625 | 3300002737 | JGI25162J39368_1000871 | JGI25162J39368_10008717 | 279 |
| 626 | 3300002772 | JGI25164J39214_1000476 | JGI25164J39214_10004767 | 279 |
| 627 | 3300003214 | JGI25165J46597_1000591 | JGI25165J46597_100059123 | 279 |
| 628 | 3300004800 | Ga0058861_11977762 | Ga0058861_119777621 | 279 |
| 629 | 3300005337 | Ga0070682_100038340 | Ga0070682_1000383403 | 279 |
| 630 | 3300005337 | Ga0070682_100056911 | Ga0070682_1000569112 | 279 |
| 631 | 3300005339 | Ga0070660_100182697 | Ga0070660_1001826971 | 279 |
| 632 | 3300005341 | Ga0070691_10214288 | Ga0070691_102142881 | 279 |
| 633 | 3300005366 | Ga0070659_100540755 | Ga0070659_1005407551 | 279 |
| 634 | 3300005455 | Ga0070663_100235751 | Ga0070663_1002357512 | 279 |
| 635 | 3300005535 | Ga0070684_100112339 | Ga0070684_1001123392 | 279 |
| 636 | 3300005546 | Ga0070696_100013276 | Ga0070696_1000132764 | 279 |
| 637 | 3300005546 | Ga0070696_100054776 | Ga0070696_1000547762 | 279 |
| 638 | 3300005547 | Ga0070693_100013748 | Ga0070693_1000137483 | 279 |
| 639 | 3300005564 | Ga0070664_100425598 | Ga0070664_1004255982 | 279 |
| 640 | 3300005577 | Ga0068857_100160240 | Ga0068857_1001602402 | 279 |
| 641 | 3300005616 | Ga0068852_100002597 | Ga0068852_10000259711 | 279 |
| 642 | 3300005834 | Ga0068851_10052235 | Ga0068851_100522352 | 279 |
| 643 | 3300005834 | Ga0068851_10149980 | Ga0068851_101499802 | 279 |
| 644 | 3300009545 | Ga0105237_10114647 | Ga0105237_101146472 | 279 |
| 645 | 3300009551 | Ga0105238_10017135 | Ga0105238_100171355 | 279 |
| 646 | 3300013100 | Ga0157373_10318311 | Ga0157373_103183112 | 279 |
| 647 | 3300013104 | Ga0157370_10000778 | Ga0157370_1000077831 | 279 |
| 648 | 3300013105 | Ga0157369_10183991 | Ga0157369_101839913 | 279 |
| 649 | 3300013307 | Ga0157372_10142858 | Ga0157372_101428582 | 279 |
| 650 | 3300020070 | Ga0206356_10310333 | Ga0206356_103103333 | 279 |
| 651 | 3300020078 | Ga0206352_10691678 | Ga0206352_106916782 | 279 |
| 652 | 3300020081 | Ga0206354_10374811 | Ga0206354_103748112 | 279 |
| 653 | 3300020082 | Ga0206353_10342466 | Ga0206353_103424663 | 279 |
| 654 | 3300020610 | Ga0154015_1173610 | Ga0154015_11736104 | 279 |
| 655 | 3300025231 | Ga0207427_100111 | Ga0207427_10011114 | 279 |
| 656 | 3300025233 | Ga0209437_100223 | Ga0209437_10022335 | 279 |
| 657 | 3300025261 | Ga0209233_1000272 | Ga0209233_100027210 | 279 |
| 658 | 3300025321 | Ga0207656_10016237 | Ga0207656_100162373 | 279 |
| 659 | 3300025904 | Ga0207647_10001393 | Ga0207647_1000139312 | 279 |
| 660 | 3300025904 | Ga0207647_10011267 | Ga0207647_100112674 | 279 |
| 661 | 3300025909 | Ga0207705_10002720 | Ga0207705_100027208 | 279 |
| 662 | 3300025909 | Ga0207705_10061090 | Ga0207705_100610903 | 279 |
| 663 | 3300025912 | Ga0207707_10008190 | Ga0207707_100081903 | 279 |
| 664 | 3300025912 | Ga0207707_10095721 | Ga0207707_100957212 | 279 |
| 665 | 3300025913 | Ga0207695_10110997 | Ga0207695_101109973 | 279 |
| 666 | 3300025914 | Ga0207671_10143383 | Ga0207671_101433832 | 279 |
| 667 | 3300025917 | Ga0207660_10012966 | Ga0207660_100129664 | 279 |
| 668 | 3300025917 | Ga0207660_10018270 | Ga0207660_100182702 | 279 |
| 669 | 3300025919 | Ga0207657_10013655 | Ga0207657_100136558 | 279 |
| 670 | 3300025919 | Ga0207657_10060782 | Ga0207657_100607822 | 279 |
| 671 | 3300025920 | Ga0207649_10022015 | Ga0207649_100220153 | 279 |
| 672 | 3300025920 | Ga0207649_10083812 | Ga0207649_100838122 | 279 |
| 673 | 3300025921 | Ga0207652_10007462 | Ga0207652_100074623 | 279 |
| 674 | 3300025921 | Ga0207652_10062375 | Ga0207652_100623753 | 279 |
| 675 | 3300025921 | Ga0207652_10066093 | Ga0207652_100660933 | 279 |
| 676 | 3300025924 | Ga0207694_10049082 | Ga0207694_100490822 | 279 |
| 677 | 3300025932 | Ga0207690_10007323 | Ga0207690_100073234 | 279 |
| 678 | 3300025932 | Ga0207690_10023064 | Ga0207690_100230643 | 279 |
| 679 | 3300025932 | Ga0207690_10024720 | Ga0207690_100247203 | 279 |
| 680 | 3300025933 | Ga0207706_10026518 | Ga0207706_100265183 | 279 |
| 681 | 3300025944 | Ga0207661_10135201 | Ga0207661_101352012 | 279 |
| 682 | 3300025945 | Ga0207679_10428295 | Ga0207679_104282952 | 279 |
| 683 | 3300025949 | Ga0207667_10008462 | Ga0207667_100084629 | 279 |
| 684 | 3300025949 | Ga0207667_10037782 | Ga0207667_100377824 | 279 |
| 685 | 3300025949 | Ga0207667_10051115 | Ga0207667_100511153 | 279 |
| 686 | 3300025981 | Ga0207640_10050390 | Ga0207640_100503903 | 279 |
| 687 | 3300026041 | Ga0207639_10004906 | Ga0207639_100049066 | 279 |
| 688 | 3300026041 | Ga0207639_10024341 | Ga0207639_100243413 | 279 |
| 689 | 3300026067 | Ga0207678_10010644 | Ga0207678_100106448 | 279 |
| 690 | 3300026078 | Ga0207702_10029705 | Ga0207702_100297056 | 279 |
| 691 | 3300026078 | Ga0207702_10073135 | Ga0207702_100731353 | 279 |
| 692 | 3300026116 | Ga0207674_10015601 | Ga0207674_100156018 | 279 |
| 693 | 3300026116 | Ga0207674_10016923 | Ga0207674_100169238 | 279 |
| 694 | 3300026142 | Ga0207698_10004762 | Ga0207698_100047627 | 279 |
| 695 | 3300026142 | Ga0207698_10009095 | Ga0207698_100090953 | 279 |
| 696 | 3300026142 | Ga0207698_10011035 | Ga0207698_100110354 | 279 |
| 697 | 3300037312 | Ga0395899_0023376 | Ga0395899_0023376_400_1263 | 279 |
| 698 | 3300037466 | Ga0395898_0035060 | Ga0395898_0035060_765_1628 | 279 |
| 699 | 3300038443 | Ga0395901_0092957 | Ga0395901_0092957_753_1616 | 279 |
| 700 | 3300049581 | Ga0501047_0009987 | Ga0501047_0009987_6825_7688 | 279 |
| 701 | 3300049586 | Ga0501070_0035616 | Ga0501070_0035616_1559_2422 | 279 |
| 702 | 3300049590 | Ga0501074_0035709 | Ga0501074_0035709_786_1649 | 279 |
| 703 | 3300049742 | Ga0501080_0052659 | Ga0501080_0052659_2027_2890 | 279 |
| 704 | 3300049822 | Ga0501035_0002475 | Ga0501035_0002475_14237_15100 | 279 |
| 705 | 3300049823 | Ga0501044_0015835 | Ga0501044_0015835_2224_3087 | 279 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
99
309
0.89
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7cad-assembly1.cif.gz_A | mycobacterium smegmatis sugabc complex | 0.8557 | 13 | 271 |
| 2onk-assembly2.cif.gz_I | abc transporter modbc in complex with its binding protein moda | 0.8394 | 15 | 267 |
| 4tqv-assembly4.cif.gz_M | crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate | 0.8258 | 13 | 274 |
| 2onk-assembly2.cif.gz_I | abc transporter modbc in complex with its binding protein moda | 0.8245 | 15 | 267 |
| 3d31-assembly1.cif.gz_C | modbc from methanosarcina acetivorans | 0.8244 | 16 | 267 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P71746_10_267_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8787 | 24 | 277 | 1.10.3720.10 |
| af_P0AEB0_20_277_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8744 | 20 | 274 | 1.10.3720.10 |
| af_P71746_10_267_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8632 | 24 | 277 | 1.10.3720.10 |
| af_P0AEB0_20_277_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8621 | 20 | 274 | 1.10.3720.10 |
| af_P71745_27_277_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8613 | 22 | 277 | 1.10.3720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A257X9A8-F1-model_v4 | Sulfate ABC transporter permease subunit CysW | 0.9104 | 8 | 215 |
GO:0005886
GO:0015419 |
| AF-A0A844GTP6-F1-model_v4 | Sulfate ABC transporter permease subunit CysW | 0.9043 | 13 | 279 |
GO:0005886
GO:0015419 |
| AF-A0A532B2R8-F1-model_v4 | Sulfate ABC transporter permease subunit CysW | 0.9043 | 15 | 227 |
GO:0005886
GO:0015419 |
| AF-A0A7X7RG91-F1-model_v4 | Sulfate ABC transporter permease subunit CysW | 0.9031 | 15 | 274 |
GO:0005886
GO:0015419 |
| AF-A0A0H4W0X4-F1-model_v4 | deleted | 0.8996 | 15 | 274 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar