F476385

General Info

Members Datasets Scaffolds Average Seq Length
704 258 1408 243

Family's Representative Sequence

Representative Sequence 3300061734|Ga0530510_0523958|Ga0530510_0523958_62_853
Length 263
Sequence MTPPGRRRVDGKVALISGGARGQGASHGRLLAEHGARVVLGDILDGPGADTAGWLRQEGLEVRYVHLDVTRPEDWDAAVAVAEQSYGKLDVLVNNAGITGSASIVDCPLEEWQSVVAVNQTGVFLGIQRAVPALRRAGGGSIINVASVVATLGTESMIAYQASKAAVHQLTRAAAVTLAPDIRVNTVTPGIVTGTAMAAGLDPAWLEARLAVYPMGRGARVEEVSHAVLFLASDESSFTTGADLRVDGGALAGVKRRRFRADP

Samples

Sample ID Description Type Environment
1 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300003503 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
66 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
100 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
165 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
166 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
167 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
168 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
169 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
170 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
171 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
172 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
173 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
174 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
175 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
176 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
177 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
178 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
179 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
180 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
181 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
182 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
183 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
184 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
185 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
186 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
187 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
188 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
189 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
190 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
191 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
192 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
193 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
194 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
195 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
196 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
197 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
198 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
199 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
200 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
201 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
202 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
203 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
204 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
205 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
206 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
207 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
208 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
209 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
210 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
211 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
212 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
213 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
214 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
215 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
216 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
217 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
218 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
219 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
233 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
234 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
235 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
236 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
237 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
238 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
239 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
240 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
241 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
242 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
243 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
244 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
245 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
247 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
248 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
249 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
250 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
251 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
252 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
253 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
254 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
255 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
256 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
257 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
258 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.41
Rhizosphere 97.59
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0530510_0523958 3300061734 Bacteria 899
2 JGI24735J21928_10012005 3300002067 Bacteria 2741
3 JGI26129J50193_1003564 3300003349 Bacteria 1094
4 JGI25407J50210_10033392 3300003373 Bacteria 1328
5 JGI26141J51220_1001422 3300003503 Bacteria 1447
6 Ga0065704_10314564 3300005289 Bacteria 863
7 Ga0065715_10369058 3300005293 Bacteria 924
8 Ga0070676_10001508 3300005328 Bacteria 11783
9 Ga0070683_100040464 3300005329 Bacteria 4286
10 Ga0070690_100118531 3300005330 Bacteria 1774
11 Ga0070690_100227937 3300005330 Bacteria 1309
12 Ga0070690_100516391 3300005330 Bacteria 896
13 Ga0070670_100005711 3300005331 Bacteria 10515
14 Ga0068869_100001826 3300005334 Bacteria 12787
15 Ga0068869_100002053 3300005334 Bacteria 12100
16 Ga0070680_100011525 3300005336 Bacteria 6841
17 Ga0070680_100029669 3300005336 Bacteria 4392
18 Ga0070680_100034957 3300005336 Bacteria 4055
19 Ga0070680_100346515 3300005336 Bacteria 1263
20 Ga0070682_100010168 3300005337 Bacteria 5335
21 Ga0068868_100186906 3300005338 Bacteria 1722
22 Ga0070660_100006407 3300005339 Bacteria 8158
23 Ga0070689_100086275 3300005340 Bacteria 2469
24 Ga0070691_10001908 3300005341 Bacteria 9140
25 Ga0070691_10004132 3300005341 Bacteria 6593
26 Ga0070691_10023591 3300005341 Bacteria 2857
27 Ga0070661_100004542 3300005344 Bacteria 9551
28 Ga0070692_10096760 3300005345 Bacteria 1613
29 Ga0070668_100158679 3300005347 Bacteria 1834
30 Ga0070669_100009553 3300005353 Bacteria 6906
31 Ga0070669_100383192 3300005353 Bacteria 1147
32 Ga0070675_100096848 3300005354 Bacteria 2479
33 Ga0070659_100000322 3300005366 Bacteria 36690
34 Ga0070703_10000793 3300005406 Bacteria 10349
35 Ga0070703_10005280 3300005406 Bacteria 3610
36 Ga0070709_10045578 3300005434 Bacteria 2722
37 Ga0070701_10055062 3300005438 Bacteria 2076
38 Ga0070711_100462505 3300005439 Bacteria 1040
39 Ga0070705_100002220 3300005440 Bacteria 9870
40 Ga0070705_100019189 3300005440 Bacteria 3596
41 Ga0070705_100048811 3300005440 Bacteria 2454
42 Ga0070705_100068779 3300005440 Bacteria 2133
43 Ga0070700_100019386 3300005441 Bacteria 3925
44 Ga0070700_100054686 3300005441 Bacteria 2495
45 Ga0070694_100000296 3300005444 Bacteria 26721
46 Ga0070694_100000326 3300005444 Bacteria 25614
47 Ga0070694_100020927 3300005444 Bacteria 4175
48 Ga0070694_100054799 3300005444 Bacteria 2702
49 Ga0070694_100145888 3300005444 Bacteria 1723
50 Ga0070694_100468245 3300005444 Bacteria 998
51 Ga0070708_100011197 3300005445 Bacteria 7295
52 Ga0070708_100015611 3300005445 Bacteria 6276
53 Ga0070708_100028675 3300005445 Bacteria 4793
54 Ga0070708_100032014 3300005445 Bacteria 4557
55 Ga0070708_100069682 3300005445 Bacteria 3163
56 Ga0070708_100129176 3300005445 Bacteria 2338
57 Ga0070708_100132915 3300005445 Bacteria 2304
58 Ga0070708_100385405 3300005445 Bacteria 1322
59 Ga0070663_100011713 3300005455 Bacteria 5518
60 Ga0070662_100002852 3300005457 Bacteria 10713
61 Ga0070662_100125151 3300005457 Bacteria 1975
62 Ga0070662_100411032 3300005457 Bacteria 1118
63 Ga0070662_100510981 3300005457 Bacteria 1003
64 Ga0070681_10003875 3300005458 Bacteria 14078
65 Ga0068867_100028261 3300005459 Bacteria 4037
66 Ga0070706_100023384 3300005467 Bacteria 5691
67 Ga0070706_100037683 3300005467 Bacteria 4464
68 Ga0070706_100048189 3300005467 Bacteria 3933
69 Ga0070706_100389021 3300005467 Bacteria 1298
70 Ga0070706_100574269 3300005467 Bacteria 1048
71 Ga0070707_100001990 3300005468 Bacteria 19558
72 Ga0070707_100015361 3300005468 Bacteria 7184
73 Ga0070707_100061601 3300005468 Bacteria 3599
74 Ga0070707_100114959 3300005468 Bacteria 2611
75 Ga0070707_100141390 3300005468 Bacteria 2342
76 Ga0070707_100264879 3300005468 Bacteria 1672
77 Ga0070707_100302553 3300005468 Bacteria 1554
78 Ga0070707_100401665 3300005468 Bacteria 1330
79 Ga0070707_100519354 3300005468 Bacteria 1153
80 Ga0070698_100011688 3300005471 Bacteria 9312
81 Ga0070698_100039746 3300005471 Bacteria 4839
82 Ga0070698_100060267 3300005471 Bacteria 3829
83 Ga0070698_100158187 3300005471 Bacteria 2211
84 Ga0070698_100322269 3300005471 Bacteria 1476
85 Ga0070698_100335321 3300005471 Bacteria 1444
86 Ga0070699_100003494 3300005518 Bacteria 13891
87 Ga0070699_100007127 3300005518 Bacteria 9714
88 Ga0070699_100150214 3300005518 Bacteria 2060
89 Ga0070699_100191765 3300005518 Bacteria 1816
90 Ga0070699_100248325 3300005518 Bacteria 1589
91 Ga0070699_100285229 3300005518 Bacteria 1479
92 Ga0070679_100011577 3300005530 Bacteria 8405
93 Ga0070684_100033110 3300005535 Bacteria 4410
94 Ga0070697_100006412 3300005536 Bacteria 9108
95 Ga0070697_100027540 3300005536 Bacteria 4548
96 Ga0070697_100044734 3300005536 Bacteria 3586
97 Ga0070697_100048855 3300005536 Bacteria 3431
98 Ga0070697_100050530 3300005536 Bacteria 3375
99 Ga0070697_100056999 3300005536 Bacteria 3179
100 Ga0070697_100276740 3300005536 Bacteria 1439
101 Ga0070697_100351576 3300005536 Bacteria 1273
102 Ga0068853_100000518 3300005539 Bacteria 26167
103 Ga0070672_100014519 3300005543 Bacteria 5585
104 Ga0070672_100027044 3300005543 Bacteria 4276
105 Ga0070695_100002363 3300005545 Bacteria 10833
106 Ga0070695_100005039 3300005545 Bacteria 7784
107 Ga0070695_100010470 3300005545 Bacteria 5537
108 Ga0070695_100017187 3300005545 Bacteria 4386
109 Ga0070696_100023696 3300005546 Bacteria 4173
110 Ga0070696_100081933 3300005546 Bacteria 2287
111 Ga0070696_100083494 3300005546 Bacteria 2266
112 Ga0070696_100108877 3300005546 Bacteria 1993
113 Ga0070696_100109916 3300005546 Bacteria 1984
114 Ga0070696_100284506 3300005546 Bacteria 1262
115 Ga0070693_100001092 3300005547 Bacteria 12169
116 Ga0070693_100053471 3300005547 Bacteria 2319
117 Ga0070704_100013935 3300005549 Bacteria 5008
118 Ga0070704_100035814 3300005549 Bacteria 3377
119 Ga0070704_100047033 3300005549 Bacteria 3013
120 Ga0070704_100117534 3300005549 Bacteria 2035
121 Ga0070704_100169678 3300005549 Bacteria 1734
122 Ga0068855_100008473 3300005563 Bacteria 12431
123 Ga0068855_100262322 3300005563 Bacteria 1924
124 Ga0070664_100023335 3300005564 Bacteria 5109
125 Ga0068857_100005198 3300005577 Bacteria 11076
126 Ga0068857_100094490 3300005577 Bacteria 2678
127 Ga0068857_100307625 3300005577 Bacteria 1462
128 Ga0068854_100002526 3300005578 Bacteria 11320
129 Ga0068856_100019528 3300005614 Bacteria 6578
130 Ga0070702_100065431 3300005615 Bacteria 2129
131 Ga0068852_100024867 3300005616 Bacteria 4845
132 Ga0068859_100000976 3300005617 Bacteria 29307
133 Ga0068859_100211864 3300005617 Bacteria 2024
134 Ga0068864_100001266 3300005618 Bacteria 20986
135 Ga0068870_10000987 3300005840 Bacteria 11236
136 Ga0068863_100056203 3300005841 Bacteria 3727
137 Ga0068858_100036781 3300005842 Bacteria 4540
138 Ga0068860_100016087 3300005843 Bacteria 7298
139 Ga0068860_100052318 3300005843 Bacteria 3885
140 Ga0068860_100144646 3300005843 Bacteria 2287
141 Ga0068860_100499276 3300005843 Bacteria 1214
142 Ga0068862_100001929 3300005844 Bacteria 18827
143 Ga0068862_100092664 3300005844 Bacteria 2634
144 Ga0068862_100532795 3300005844 Bacteria 1119
145 Ga0081455_10015861 3300005937 Bacteria 7295
146 Ga0081538_10028407 3300005981 Bacteria 3847
147 Ga0081540_1017503 3300005983 Bacteria 4434
148 Ga0081540_1103207 3300005983 Bacteria 1223
149 Ga0081539_10000044 3300005985 Bacteria 284021
150 Ga0070712_100003253 3300006175 Bacteria 10001
151 Ga0075428_100000409 3300006844 Bacteria 42695
152 Ga0075428_100004007 3300006844 Bacteria 16168
153 Ga0075428_100010083 3300006844 Bacteria 10496
154 Ga0075428_100012600 3300006844 Bacteria 9401
155 Ga0075428_100071289 3300006844 Bacteria 3798
156 Ga0075428_100093499 3300006844 Bacteria 3278
157 Ga0075428_100148280 3300006844 Bacteria 2549
158 Ga0075428_100721192 3300006844 Bacteria 1062
159 Ga0075428_100843780 3300006844 Bacteria 973
160 Ga0075430_100000648 3300006846 Bacteria 26549
161 Ga0075430_100002276 3300006846 Bacteria 15900
162 Ga0075430_100006658 3300006846 Bacteria 9745
163 Ga0075430_100041160 3300006846 Bacteria 3909
164 Ga0075430_100059632 3300006846 Bacteria 3208
165 Ga0075430_100420480 3300006846 Bacteria 1103
166 Ga0075431_100000181 3300006847 Bacteria 45325
167 Ga0075431_100001052 3300006847 Bacteria 24662
168 Ga0075431_100003068 3300006847 Bacteria 16176
169 Ga0075431_100003078 3300006847 Bacteria 16159
170 Ga0075431_100009651 3300006847 Bacteria 9695
171 Ga0075431_100080627 3300006847 Bacteria 3360
172 Ga0075431_100093628 3300006847 Bacteria 3101
173 Ga0075431_100203116 3300006847 Bacteria 2027
174 Ga0075431_100311893 3300006847 Bacteria 1588
175 Ga0075431_100473263 3300006847 Bacteria 1246
176 Ga0075433_10001470 3300006852 Bacteria 17385
177 Ga0075433_10002688 3300006852 Bacteria 13580
178 Ga0075433_10017885 3300006852 Bacteria 5880
179 Ga0075433_10025926 3300006852 Bacteria 4958
180 Ga0075433_10067634 3300006852 Bacteria 3136
181 Ga0075433_10073771 3300006852 Bacteria 3002
182 Ga0075433_10100906 3300006852 Bacteria 2555
183 Ga0075433_10221264 3300006852 Bacteria 1681
184 Ga0075433_10229189 3300006852 Bacteria 1650
185 Ga0075434_100006184 3300006871 Bacteria 10962
186 Ga0075434_100010856 3300006871 Bacteria 8561
187 Ga0075434_100037121 3300006871 Bacteria 4823
188 Ga0075434_100045687 3300006871 Bacteria 4345
189 Ga0075434_100078686 3300006871 Bacteria 3293
190 Ga0075434_100122319 3300006871 Bacteria 2618
191 Ga0075434_100125335 3300006871 Bacteria 2586
192 Ga0075434_100134302 3300006871 Bacteria 2494
193 Ga0075434_100213306 3300006871 Bacteria 1951
194 Ga0075434_100640345 3300006871 Bacteria 1081
195 Ga0075429_100000116 3300006880 Bacteria 45959
196 Ga0075429_100006906 3300006880 Bacteria 9860
197 Ga0075429_100009267 3300006880 Bacteria 8546
198 Ga0075429_100010439 3300006880 Bacteria 8035
199 Ga0075429_100010600 3300006880 Bacteria 7975
200 Ga0075429_100011279 3300006880 Bacteria 7736
201 Ga0075429_100042925 3300006880 Bacteria 3934
202 Ga0075429_100100746 3300006880 Bacteria 2522
203 Ga0075429_100141934 3300006880 Bacteria 2103
204 Ga0075429_100430711 3300006880 Bacteria 1155
205 Ga0068865_100098520 3300006881 Bacteria 2136
206 Ga0068865_100100352 3300006881 Bacteria 2118
207 Ga0075436_100027597 3300006914 Bacteria 3907
208 Ga0075436_100035510 3300006914 Bacteria 3438
209 Ga0075436_100179959 3300006914 Bacteria 1494
210 Ga0097620_100000976 3300006931 Bacteria 29307
211 Ga0097620_100211860 3300006931 Bacteria 2024
212 Ga0075435_100005723 3300007076 Bacteria 8716
213 Ga0075435_100006422 3300007076 Bacteria 8311
214 Ga0075435_100010888 3300007076 Bacteria 6663
215 Ga0075435_100042844 3300007076 Bacteria 3622
216 Ga0075435_100160144 3300007076 Bacteria 1895
217 Ga0075435_100400418 3300007076 Bacteria 1180
218 Ga0099794_10045714 3300007265 Bacteria 2095
219 Ga0111539_10001546 3300009094 Bacteria 30637
220 Ga0111539_10016844 3300009094 Bacteria 9052
221 Ga0111539_10029142 3300009094 Bacteria 6729
222 Ga0111539_10059927 3300009094 Bacteria 4512
223 Ga0111539_10086840 3300009094 Bacteria 3675
224 Ga0105245_10061624 3300009098 Bacteria 3382
225 Ga0114129_10001191 3300009147 Bacteria 34529
226 Ga0114129_10012024 3300009147 Bacteria 12313
227 Ga0114129_10012777 3300009147 Bacteria 11952
228 Ga0114129_10016389 3300009147 Bacteria 10548
229 Ga0114129_10017340 3300009147 Bacteria 10251
230 Ga0114129_10022174 3300009147 Bacteria 9015
231 Ga0114129_10036794 3300009147 Bacteria 6911
232 Ga0114129_10073027 3300009147 Bacteria 4780
233 Ga0114129_10082640 3300009147 Bacteria 4463
234 Ga0114129_10127166 3300009147 Bacteria 3503
235 Ga0114129_10152998 3300009147 Bacteria 3156
236 Ga0114129_10244822 3300009147 Bacteria 2409
237 Ga0114129_10285463 3300009147 Bacteria 2204
238 Ga0114129_10294037 3300009147 Bacteria 2167
239 Ga0114129_10321737 3300009147 Bacteria 2056
240 Ga0114129_10363333 3300009147 Bacteria 1915
241 Ga0114129_10831422 3300009147 Bacteria 1176
242 Ga0114129_11337027 3300009147 Bacteria 887
243 Ga0105243_10036440 3300009148 Bacteria 3819
244 Ga0105243_10153032 3300009148 Bacteria 1981
245 Ga0105243_10155987 3300009148 Bacteria 1963
246 Ga0105243_10301713 3300009148 Bacteria 1452
247 Ga0105241_10000602 3300009174 Bacteria 27099
248 Ga0105241_10081082 3300009174 Bacteria 2541
249 Ga0105241_10351278 3300009174 Bacteria 1280
250 Ga0105242_10002560 3300009176 Bacteria 14248
251 Ga0105242_10312952 3300009176 Bacteria 1437
252 Ga0105237_10004996 3300009545 Bacteria 15108
253 Ga0105238_10981169 3300009551 Bacteria 865
254 Ga0105249_10022216 3300009553 Bacteria 5682
255 Ga0105249_10101361 3300009553 Bacteria 2708
256 Ga0105239_10002552 3300010375 Bacteria 23093
257 Ga0105239_10255784 3300010375 Bacteria 1967
258 Ga0105246_10031031 3300011119 Bacteria 3534
259 Ga0157373_10001523 3300013100 Bacteria 17668
260 Ga0157373_10280657 3300013100 Bacteria 1180
261 Ga0157369_10003919 3300013105 Bacteria 17649
262 Ga0157378_10103497 3300013297 Bacteria 2601
263 Ga0157378_10260932 3300013297 Bacteria 1662
264 Ga0157378_10438618 3300013297 Bacteria 1294
265 Ga0163162_10628566 3300013306 Bacteria 1198
266 Ga0163162_10669834 3300013306 Bacteria 1161
267 Ga0157372_10000415 3300013307 Bacteria 46758
268 Ga0157375_10024425 3300013308 Bacteria 5594
269 Ga0157375_10715082 3300013308 Bacteria 1155
270 Ga0157375_10982318 3300013308 Bacteria 985
271 Ga0157375_11082745 3300013308 Bacteria 938
272 Ga0163163_10075053 3300014325 Bacteria 3374
273 Ga0157380_10175728 3300014326 Bacteria 1876
274 Ga0157380_10680290 3300014326 Bacteria 1031
275 Ga0182008_10038272 3300014497 Bacteria 2398
276 Ga0207653_10001986 3300025885 Bacteria 6535
277 Ga0207653_10004275 3300025885 Bacteria 4487
278 Ga0207653_10017569 3300025885 Bacteria 2252
279 Ga0207688_10022050 3300025901 Bacteria 3484
280 Ga0207645_10000389 3300025907 Bacteria 36227
281 Ga0207643_10000290 3300025908 Bacteria 35007
282 Ga0207684_10000673 3300025910 Bacteria 40594
283 Ga0207684_10004725 3300025910 Bacteria 12775
284 Ga0207684_10007696 3300025910 Bacteria 9658
285 Ga0207684_10013914 3300025910 Bacteria 6950
286 Ga0207684_10019842 3300025910 Bacteria 5747
287 Ga0207684_10024244 3300025910 Bacteria 5174
288 Ga0207684_10049409 3300025910 Bacteria 3568
289 Ga0207654_10005545 3300025911 Bacteria 6384
290 Ga0207654_10018200 3300025911 Bacteria 3683
291 Ga0207707_10000158 3300025912 Bacteria 71112
292 Ga0207671_10002849 3300025914 Bacteria 17948
293 Ga0207693_10004038 3300025915 Bacteria 12474
294 Ga0207693_10164148 3300025915 Bacteria 1748
295 Ga0207663_10563445 3300025916 Bacteria 892
296 Ga0207660_10000987 3300025917 Bacteria 18878
297 Ga0207660_10063986 3300025917 Bacteria 2654
298 Ga0207660_10170079 3300025917 Bacteria 1686
299 Ga0207660_10668382 3300025917 Bacteria 847
300 Ga0207657_10000426 3300025919 Bacteria 44789
301 Ga0207649_10002448 3300025920 Bacteria 10393
302 Ga0207652_10000290 3300025921 Bacteria 52056
303 Ga0207646_10003019 3300025922 Bacteria 19387
304 Ga0207646_10004413 3300025922 Bacteria 15300
305 Ga0207646_10094726 3300025922 Bacteria 2674
306 Ga0207646_10116178 3300025922 Bacteria 2403
307 Ga0207646_10194980 3300025922 Bacteria 1829
308 Ga0207646_10202571 3300025922 Bacteria 1793
309 Ga0207646_10422670 3300025922 Bacteria 1203
310 Ga0207646_10476044 3300025922 Bacteria 1126
311 Ga0207646_10484674 3300025922 Bacteria 1115
312 Ga0207681_10016844 3300025923 Bacteria 4582
313 Ga0207681_10351511 3300025923 Bacteria 1180
314 Ga0207650_10256121 3300025925 Bacteria 1418
315 Ga0207659_10025333 3300025926 Bacteria 3985
316 Ga0207687_10035250 3300025927 Bacteria 3402
317 Ga0207690_10002346 3300025932 Bacteria 11492
318 Ga0207706_10003426 3300025933 Bacteria 15142
319 Ga0207686_10015702 3300025934 Bacteria 4239
320 Ga0207709_10014362 3300025935 Bacteria 4372
321 Ga0207709_10032319 3300025935 Bacteria 3063
322 Ga0207709_10059847 3300025935 Bacteria 2372
323 Ga0207709_10072769 3300025935 Bacteria 2187
324 Ga0207709_10184559 3300025935 Bacteria 1476
325 Ga0207670_10111422 3300025936 Bacteria 1973
326 Ga0207670_10118886 3300025936 Bacteria 1917
327 Ga0207704_10106592 3300025938 Bacteria 1883
328 Ga0207704_10178895 3300025938 Bacteria 1531
329 Ga0207665_10003465 3300025939 Bacteria 10536
330 Ga0207691_10076908 3300025940 Bacteria 3008
331 Ga0207691_10086362 3300025940 Bacteria 2815
332 Ga0207691_10356739 3300025940 Bacteria 1250
333 Ga0207689_10000277 3300025942 Bacteria 46512
334 Ga0207689_10002344 3300025942 Bacteria 17708
335 Ga0207689_10052447 3300025942 Bacteria 3361
336 Ga0207679_10000773 3300025945 Bacteria 20945
337 Ga0207667_10003179 3300025949 Bacteria 20318
338 Ga0207667_10724203 3300025949 Bacteria 996
339 Ga0207712_10077000 3300025961 Bacteria 2416
340 Ga0207668_10102555 3300025972 Bacteria 2129
341 Ga0207668_10632273 3300025972 Bacteria 935
342 Ga0207640_10001020 3300025981 Bacteria 15483
343 Ga0207677_10082810 3300026023 Bacteria 2307
344 Ga0207703_10041954 3300026035 Bacteria 3668
345 Ga0207703_10449022 3300026035 Bacteria 1204
346 Ga0207639_10001029 3300026041 Bacteria 18951
347 Ga0207678_10022159 3300026067 Bacteria 5567
348 Ga0207708_10004830 3300026075 Bacteria 9930
349 Ga0207708_10061128 3300026075 Bacteria 2876
350 Ga0207702_10003932 3300026078 Bacteria 13357
351 Ga0207648_10042884 3300026089 Bacteria 3973
352 Ga0207648_10046041 3300026089 Bacteria 3825
353 Ga0207648_10123281 3300026089 Bacteria 2279
354 Ga0207676_10033858 3300026095 Bacteria 3864
355 Ga0207674_10001112 3300026116 Bacteria 34904
356 Ga0207674_10324804 3300026116 Bacteria 1488
357 Ga0207675_100003707 3300026118 Bacteria 14882
358 Ga0207683_10382711 3300026121 Bacteria 1293
359 Ga0207698_10409182 3300026142 Bacteria 1299
360 Ga0209969_1005511 3300027360 Bacteria 1777
361 Ga0209967_1013273 3300027364 Bacteria 1168
362 Ga0209981_1003723 3300027378 Bacteria 1984
363 Ga0209996_1000276 3300027395 Bacteria 6449
364 Ga0210000_1005391 3300027462 Bacteria 1854
365 Ga0209995_1000753 3300027471 Bacteria 4972
366 Ga0209968_1002525 3300027526 Bacteria 2761
367 Ga0209999_1001317 3300027543 Bacteria 4256
368 Ga0209982_1002708 3300027552 Bacteria 2493
369 Ga0209983_1000304 3300027665 Bacteria 10254
370 Ga0209983_1019974 3300027665 Bacteria 1395
371 Ga0209588_1021324 3300027671 Bacteria 2034
372 Ga0209588_1029903 3300027671 Bacteria 1739
373 Ga0209588_1036640 3300027671 Bacteria 1579
374 Ga0209971_1000036 3300027682 Bacteria 46401
375 Ga0209966_1000228 3300027695 Bacteria 21579
376 Ga0209998_10000002 3300027717 Bacteria 126355
377 Ga0209974_10012526 3300027876 Bacteria 2835
378 Ga0207428_10000398 3300027907 Bacteria 54142
379 Ga0207428_10000526 3300027907 Bacteria 45700
380 Ga0207428_10069725 3300027907 Bacteria 2764
381 Ga0268266_10502658 3300028379 Bacteria 1158
382 Ga0268265_10011589 3300028380 Bacteria 5962
383 Ga0268265_10024881 3300028380 Bacteria 4242
384 Ga0268264_10032016 3300028381 Bacteria 4314
385 Ga0268264_10045134 3300028381 Bacteria 3659
386 Ga0268264_10086095 3300028381 Bacteria 2699
387 Ga0268264_10210804 3300028381 Bacteria 1783
388 Ga0307408_100003915 3300031548 Bacteria 10148
389 Ga0307408_100101902 3300031548 Bacteria 2189
390 Ga0307408_100246087 3300031548 Bacteria 1472
391 Ga0307405_10031571 3300031731 Bacteria 3120
392 Ga0307413_10002384 3300031824 Bacteria 7629
393 Ga0307410_10215824 3300031852 Bacteria 1473
394 Ga0307407_10370626 3300031903 Bacteria 1019
395 Ga0307412_10013219 3300031911 Bacteria 4832
396 Ga0307412_10074286 3300031911 Bacteria 2329
397 Ga0307412_10404405 3300031911 Bacteria 1112
398 Ga0307409_100271350 3300031995 Bacteria 1562
399 Ga0307409_100361726 3300031995 Bacteria 1373
400 Ga0307409_100556605 3300031995 Bacteria 1127
401 Ga0307409_101296598 3300031995 Bacteria 753
402 Ga0307416_100014018 3300032002 Bacteria 5471
403 Ga0307411_10120923 3300032005 Bacteria 1894
404 Ga0307415_100239906 3300032126 Bacteria 1466
405 Ga0373950_0009574 3300034818 Bacteria 1550
406 Ga0373928_0017528 3300035084 Bacteria 1475
407 Ga0373940_0003877 3300035088 Bacteria 3106
408 Ga0373949_0012139 3300035090 Bacteria 1902
409 Ga0373949_0020438 3300035090 Bacteria 1515
410 Ga0373949_0044645 3300035090 Bacteria 1100
411 Ga0373951_0009267 3300035091 Bacteria 2218
412 Ga0373952_0002583 3300035092 Bacteria 3261
413 Ga0373932_0032119 3300035112 Bacteria 1467
414 Ga0373939_0011216 3300035114 Bacteria 2257
415 Ga0373939_0022929 3300035114 Bacteria 1725
416 Ga0373931_0017773 3300035691 Bacteria 3523
417 Ga0373931_0028538 3300035691 Bacteria 2858
418 Ga0373931_0044914 3300035691 Bacteria 2331
419 Ga0373931_0130007 3300035691 Bacteria 1448
420 Ga0373931_0505477 3300035691 Bacteria 780
421 Ga0395899_0228129 3300037312 Bacteria 1287
422 Ga0395898_0110168 3300037466 Bacteria 2639
423 Ga0395898_0758660 3300037466 Bacteria 911
424 Ga0395901_0085204 3300038443 Bacteria 3303
425 Ga0395901_0695613 3300038443 Bacteria 1015
426 Ga0439443_021858 3300042003 Bacteria 1013
427 Ga0439448_0007726 3300042005 Bacteria 3123
428 Ga0439448_0034698 3300042005 Bacteria 1613
429 Ga0439450_059040 3300042008 Bacteria 924
430 Ga0439455_0036068 3300042012 Bacteria 1250
431 Ga0439458_0031856 3300042157 Bacteria 1258
432 Ga0439435_0074447 3300042436 Bacteria 1010
433 Ga0439435_0096276 3300042436 Bacteria 905
434 Ga0439464_0003187 3300042439 Bacteria 4116
435 Ga0439460_0002670 3300042461 Bacteria 4304
436 Ga0439460_0088913 3300042461 Bacteria 979
437 Ga0451577_0000793 3300042876 Bacteria 47582
438 Ga0451577_0007730 3300042876 Bacteria 10539
439 Ga0451577_0014349 3300042876 Bacteria 7387
440 Ga0451577_0968603 3300042876 Bacteria 765
441 Ga0453683_0005071 3300044673 Bacteria 9240
442 Ga0453683_0009470 3300044673 Bacteria 6500
443 Ga0453683_0039670 3300044673 Bacteria 2959
444 Ga0453683_0278141 3300044673 Bacteria 1069
445 Ga0453684_0031081 3300044712 Bacteria 7519
446 Ga0453684_0130819 3300044712 Bacteria 3011
447 Ga0453684_0530748 3300044712 Bacteria 1299
448 Ga0453684_0694702 3300044712 Bacteria 1106
449 Ga0451576_0005173 3300045051 Bacteria 16502
450 Ga0451576_0032025 3300045051 Bacteria 5603
451 Ga0451576_0033529 3300045051 Bacteria 5458
452 Ga0451576_0049699 3300045051 Bacteria 4401
453 Ga0451576_0053559 3300045051 Bacteria 4226
454 Ga0451576_0114215 3300045051 Bacteria 2811
455 Ga0451576_0264864 3300045051 Bacteria 1796
456 Ga0495603_0084563 3300046455 Bacteria 1858
457 Ga0495580_0016661 3300046472 Bacteria 5514
458 Ga0495580_0193068 3300046472 Bacteria 1404
459 Ga0495584_0071647 3300046491 Bacteria 1742
460 Ga0495584_0072783 3300046491 Bacteria 1727
461 Ga0495642_0011189 3300046528 Bacteria 3442
462 Ga0495633_0181734 3300046558 Bacteria 968
463 Ga0495656_0053380 3300046615 Bacteria 1736
464 Ga0495659_0037935 3300046664 Bacteria 1709
465 Ga0495669_0027414 3300046684 Bacteria 2492
466 Ga0495669_0038401 3300046684 Bacteria 2120
467 Ga0495636_0058445 3300047318 Bacteria 1626
468 Ga0495636_0098583 3300047318 Bacteria 1276
469 Ga0495636_0188675 3300047318 Bacteria 938
470 Ga0496102_0051899 3300048905 Bacteria 3736
471 Ga0496103_0375382 3300048906 Bacteria 914
472 Ga0496104_0253378 3300048907 Bacteria 1673
473 Ga0496105_0061652 3300048908 Bacteria 3095
474 Ga0496106_0037094 3300048909 Bacteria 3646
475 Ga0496106_0287039 3300048909 Bacteria 1319
476 Ga0496106_0394127 3300048909 Bacteria 1113
477 Ga0496106_0514185 3300048909 Bacteria 962
478 Ga0496108_0022804 3300048911 Bacteria 5150
479 Ga0496108_0649067 3300048911 Bacteria 917
480 Ga0496109_0442920 3300048912 Bacteria 1227
481 Ga0496110_0018494 3300048913 Bacteria 5843
482 Ga0496110_0806316 3300048913 Bacteria 843
483 Ga0496111_0262286 3300048914 Bacteria 1282
484 Ga0496112_0064810 3300048915 Bacteria 3606
485 Ga0496113_0295158 3300048916 Bacteria 1297
486 Ga0496114_0012272 3300048917 Bacteria 6857
487 Ga0501031_0116012 3300049568 Bacteria 1749
488 Ga0501031_0243676 3300049568 Bacteria 1168
489 Ga0501032_0127389 3300049569 Bacteria 1681
490 Ga0501033_0020667 3300049570 Bacteria 4974
491 Ga0501033_0057423 3300049570 Bacteria 2877
492 Ga0501033_0252405 3300049570 Bacteria 1250
493 Ga0501036_0053635 3300049572 Bacteria 3414
494 Ga0501036_0344199 3300049572 Bacteria 1245
495 Ga0501038_0062853 3300049574 Bacteria 3171
496 Ga0501039_0005533 3300049575 Bacteria 9562
497 Ga0501039_0357622 3300049575 Bacteria 1147
498 Ga0501039_0466292 3300049575 Bacteria 992
499 Ga0501039_0636721 3300049575 Bacteria 835
500 Ga0501040_0002756 3300049576 Bacteria 11323
501 Ga0501040_0030056 3300049576 Bacteria 3668
502 Ga0501040_0087287 3300049576 Bacteria 2166
503 Ga0501040_0145261 3300049576 Bacteria 1672
504 Ga0501040_0252876 3300049576 Bacteria 1257
505 Ga0501041_0036477 3300049577 Bacteria 2978
506 Ga0501041_0052173 3300049577 Bacteria 2493
507 Ga0501041_0080929 3300049577 Bacteria 2000
508 Ga0501041_0111594 3300049577 Bacteria 1696
509 Ga0501041_0352247 3300049577 Bacteria 930
510 Ga0501042_0000598 3300049578 Bacteria 19220
511 Ga0501042_0065812 3300049578 Bacteria 2590
512 Ga0501042_0148671 3300049578 Bacteria 1689
513 Ga0501042_0279767 3300049578 Bacteria 1205
514 Ga0501042_0358319 3300049578 Bacteria 1055
515 Ga0501043_0033816 3300049579 Bacteria 4023
516 Ga0501043_0122969 3300049579 Bacteria 2035
517 Ga0501046_0000240 3300049580 Bacteria 56302
518 Ga0501046_0055306 3300049580 Bacteria 3120
519 Ga0501046_0055808 3300049580 Bacteria 3102
520 Ga0501046_0093811 3300049580 Bacteria 2307
521 Ga0501046_0142576 3300049580 Bacteria 1812
522 Ga0501046_0576693 3300049580 Bacteria 800
523 Ga0501047_0193410 3300049581 Bacteria 1897
524 Ga0501048_0014851 3300049582 Bacteria 5758
525 Ga0501048_0146719 3300049582 Bacteria 1668
526 Ga0501048_0215869 3300049582 Bacteria 1360
527 Ga0501067_0269534 3300049583 Bacteria 948
528 Ga0501068_0047077 3300049584 Bacteria 2601
529 Ga0501068_0307817 3300049584 Bacteria 1015
530 Ga0501071_0029734 3300049587 Bacteria 3858
531 Ga0501071_0062699 3300049587 Bacteria 2694
532 Ga0501071_0089391 3300049587 Bacteria 2260
533 Ga0501071_0282300 3300049587 Bacteria 1257
534 Ga0501072_0010731 3300049588 Bacteria 6980
535 Ga0501072_0011976 3300049588 Bacteria 6626
536 Ga0501072_0019392 3300049588 Bacteria 5256
537 Ga0501072_0024925 3300049588 Bacteria 4657
538 Ga0501072_0143087 3300049588 Bacteria 1907
539 Ga0501072_0213564 3300049588 Bacteria 1538
540 Ga0501072_0563245 3300049588 Bacteria 899
541 Ga0501073_0046661 3300049589 Bacteria 3046
542 Ga0501073_0113279 3300049589 Bacteria 1881
543 Ga0501073_0149774 3300049589 Bacteria 1617
544 Ga0501074_0048490 3300049590 Bacteria 3068
545 Ga0501074_0069840 3300049590 Bacteria 2526
546 Ga0501074_0119473 3300049590 Bacteria 1884
547 Ga0501075_0014499 3300049591 Bacteria 5649
548 Ga0501075_0024646 3300049591 Bacteria 4416
549 Ga0501075_0034507 3300049591 Bacteria 3767
550 Ga0501075_0045394 3300049591 Bacteria 3298
551 Ga0501075_0074095 3300049591 Bacteria 2575
552 Ga0501075_0109511 3300049591 Bacteria 2100
553 Ga0501075_0109520 3300049591 Bacteria 2100
554 Ga0501075_0115461 3300049591 Bacteria 2041
555 Ga0501075_0198999 3300049591 Bacteria 1528
556 Ga0501076_0018260 3300049592 Bacteria 5344
557 Ga0501076_0021228 3300049592 Bacteria 4980
558 Ga0501076_0051267 3300049592 Bacteria 3266
559 Ga0501076_0060391 3300049592 Bacteria 3016
560 Ga0501076_0079350 3300049592 Bacteria 2634
561 Ga0501076_0243552 3300049592 Bacteria 1471
562 Ga0501076_0296881 3300049592 Bacteria 1324
563 Ga0501076_0706975 3300049592 Bacteria 832
564 Ga0501076_0910073 3300049592 Bacteria 725
565 Ga0501077_0012026 3300049593 Bacteria 5418
566 Ga0501077_0046909 3300049593 Bacteria 2745
567 Ga0501077_0084986 3300049593 Bacteria 2006
568 Ga0501077_0104873 3300049593 Bacteria 1791
569 Ga0501077_0148829 3300049593 Bacteria 1485
570 Ga0501077_0356827 3300049593 Bacteria 933
571 Ga0501079_0000962 3300049741 Bacteria 19859
572 Ga0501079_0022830 3300049741 Bacteria 4802
573 Ga0501079_0028488 3300049741 Bacteria 4287
574 Ga0501079_0044843 3300049741 Bacteria 3412
575 Ga0501079_0110328 3300049741 Bacteria 2137
576 Ga0501079_0115159 3300049741 Bacteria 2090
577 Ga0501079_0186870 3300049741 Bacteria 1617
578 Ga0501080_0013705 3300049742 Bacteria 7466
579 Ga0501080_0061308 3300049742 Bacteria 3502
580 Ga0501080_0229708 3300049742 Bacteria 1696
581 Ga0501080_0239431 3300049742 Bacteria 1656
582 Ga0501080_0277362 3300049742 Bacteria 1525
583 Ga0501080_0565874 3300049742 Bacteria 1011
584 Ga0501080_0584024 3300049742 Bacteria 993
585 Ga0501081_0002065 3300049743 Bacteria 12525
586 Ga0501081_0003003 3300049743 Bacteria 10711
587 Ga0501081_0003043 3300049743 Bacteria 10641
588 Ga0501081_0006739 3300049743 Bacteria 7466
589 Ga0501081_0018202 3300049743 Bacteria 4663
590 Ga0501081_0064719 3300049743 Bacteria 2540
591 Ga0501083_0029430 3300049744 Bacteria 3777
592 Ga0501083_0173718 3300049744 Bacteria 1408
593 Ga0501035_0285826 3300049822 Bacteria 1393
594 Ga0501035_0288301 3300049822 Bacteria 1386
595 Ga0501035_0320692 3300049822 Bacteria 1302
596 Ga0501045_0000542 3300049824 Bacteria 23648
597 Ga0501045_0018403 3300049824 Bacteria 4970
598 Ga0501045_0018570 3300049824 Bacteria 4947
599 Ga0501045_0026245 3300049824 Bacteria 4189
600 Ga0501045_0144679 3300049824 Bacteria 1768
601 Ga0501045_0273232 3300049824 Bacteria 1258
602 Ga0501045_0489812 3300049824 Bacteria 913
603 nmdc:mga05p37_10296_c1 3300050507 Bacteria 11105
604 nmdc:mga05p37_10313_c1 3300050507 Bacteria 11096
605 nmdc:mga05p37_111793_c1 3300050507 Bacteria 3359
606 nmdc:mga05p37_11771_c1 3300050507 Bacteria 9366
607 nmdc:mga05p37_1188_c1 3300050507 Bacteria 30065
608 nmdc:mga05p37_132550_c1 3300050507 Bacteria 3057
609 nmdc:mga05p37_182465_c1 3300050507 Bacteria 2553
610 nmdc:mga05p37_212_c1 3300050507 Bacteria 58811
611 nmdc:mga05p37_270065_c1 3300050507 Bacteria 2033
612 nmdc:mga05p37_335410_c1 3300050507 Bacteria 1785
613 nmdc:mga05p37_403887_c1 3300050507 Bacteria 1594
614 nmdc:mga05p37_41471_c1 3300050507 Bacteria 5651
615 nmdc:mga05p37_7876_c1 3300050507 Bacteria 12576
616 nmdc:mga09592_11174_c1 3300050508 Bacteria 7306
617 nmdc:mga09592_134764_c1 3300050508 Bacteria 2127
618 nmdc:mga09592_212597_c1 3300050508 Bacteria 1676
619 nmdc:mga09592_265_c1 3300050508 Bacteria 38165
620 nmdc:mga09592_32798_c1 3300050508 Bacteria 4330
621 nmdc:mga09592_38645_c1 3300050508 Bacteria 4007
622 nmdc:mga09592_3999_c1 3300050508 Bacteria 11886
623 nmdc:mga09592_413686_c1 3300050508 Bacteria 1165
624 nmdc:mga09592_7616_c1 3300050508 Bacteria 8809
625 nmdc:mga09592_92363_c1 3300050508 Bacteria 2587
626 nmdc:mga09592_992_c1 3300050508 Bacteria 22474
627 nmdc:mga0qj67_162838_c1 3300050509 Bacteria 1811
628 nmdc:mga0qj67_2490_c1 3300050509 Bacteria 13137
629 nmdc:mga0qj67_426286_c1 3300050509 Bacteria 1069
630 nmdc:mga0qj67_6600_c1 3300050509 Bacteria 8527
631 nmdc:mga0qj67_72017_c1 3300050509 Bacteria 2758
632 nmdc:mga06r32_100340_c1 3300050510 Bacteria 2840
633 nmdc:mga06r32_102516_c1 3300050510 Bacteria 2809
634 nmdc:mga06r32_179862_c1 3300050510 Bacteria 2100
635 nmdc:mga06r32_1850_c1 3300050510 Bacteria 18813
636 nmdc:mga06r32_2420_c1 3300050510 Bacteria 16703
637 nmdc:mga06r32_26143_c1 3300050510 Bacteria 5439
638 nmdc:mga06r32_30435_c1 3300050510 Bacteria 5064
639 nmdc:mga06r32_455607_c1 3300050510 Bacteria 1258
640 nmdc:mga06r32_52930_c1 3300050510 Bacteria 3889
641 nmdc:mga06r32_63311_c1 3300050510 Bacteria 3565
642 nmdc:mga06r32_749782_c1 3300050510 Bacteria 940
643 nmdc:mga06r32_886_c1 3300050510 Bacteria 26660
644 nmdc:mga08y16_1163552_c1 3300050511 Bacteria 744
645 nmdc:mga08y16_350387_c1 3300050511 Bacteria 1517
646 nmdc:mga08y16_5536_c1 3300050511 Bacteria 13220
647 nmdc:mga08y16_6014_c1 3300050511 Bacteria 12718
648 nmdc:mga0n895_10268_c1 3300050512 Bacteria 8255
649 nmdc:mga0n895_139945_c1 3300050512 Bacteria 2448
650 nmdc:mga0n895_24612_c1 3300050512 Bacteria 5676
651 nmdc:mga0n895_270470_c1 3300050512 Bacteria 1724
652 nmdc:mga0n895_286848_c1 3300050512 Bacteria 1669
653 nmdc:mga0n895_3081_c1 3300050512 Bacteria 13264
654 nmdc:mga0n895_33586_c1 3300050512 Bacteria 4932
655 nmdc:mga0n895_353404_c1 3300050512 Bacteria 1488
656 nmdc:mga0n895_35372_c1 3300050512 Bacteria 4816
657 nmdc:mga0n895_42945_c1 3300050512 Bacteria 4403
658 nmdc:mga0n895_459722_c1 3300050512 Bacteria 1285
659 nmdc:mga0rr50_1061_c1 3300050513 Bacteria 14938
660 nmdc:mga0rr50_147245_c1 3300050513 Bacteria 1900
661 nmdc:mga0rr50_153051_c1 3300050513 Bacteria 1866
662 nmdc:mga0rr50_168928_c1 3300050513 Bacteria 1781
663 nmdc:mga0rr50_2266_c1 3300050513 Bacteria 10791
664 nmdc:mga0rr50_401764_c1 3300050513 Bacteria 1157
665 nmdc:mga0rr50_65858_c1 3300050513 Bacteria 2746
666 nmdc:mga0rr50_7012_c1 3300050513 Bacteria 6914
667 nmdc:mga08x19_116540_c1 3300050514 Bacteria 1786
668 nmdc:mga08x19_23888_c1 3300050514 Bacteria 3795
669 nmdc:mga08x19_361440_c1 3300050514 Bacteria 1015
670 nmdc:mga08x19_546158_c1 3300050514 Bacteria 820
671 nmdc:mga0a205_1419_c1 3300050515 Bacteria 20361
672 nmdc:mga0a205_153847_c1 3300050515 Bacteria 2199
673 nmdc:mga0a205_15574_c1 3300050515 Bacteria 7107
674 nmdc:mga0a205_17378_c1 3300050515 Bacteria 6740
675 nmdc:mga0a205_173969_c1 3300050515 Bacteria 2049
676 nmdc:mga0a205_259714_c1 3300050515 Bacteria 1615
677 nmdc:mga0a205_3138_c2 3300050515 Bacteria 13217
678 nmdc:mga0a205_3294_c1 3300050515 Bacteria 14365
679 nmdc:mga0a205_353382_c1 3300050515 Bacteria 1337
680 nmdc:mga0a205_60234_c1 3300050515 Bacteria 3667
681 nmdc:mga0a205_669355_c1 3300050515 Bacteria 889
682 nmdc:mga0a205_69079_c1 3300050515 Bacteria 3412
683 nmdc:mga0a205_7770_c1 3300050515 Bacteria 9735
684 Ga0501084_0011863 3300054114 Bacteria 7214
685 Ga0501084_0043575 3300054114 Bacteria 3753
686 Ga0501084_0060512 3300054114 Bacteria 3170
687 Ga0501084_0064742 3300054114 Bacteria 3059
688 Ga0501084_0109738 3300054114 Bacteria 2318
689 Ga0501084_0113893 3300054114 Bacteria 2273
690 Ga0501084_0202675 3300054114 Bacteria 1674
691 Ga0590074_010689 3300059423 Bacteria 1535
692 Ga0501082_0000590 3300060353 Bacteria 32111
693 Ga0501082_0007107 3300060353 Bacteria 9659
694 Ga0501082_0010275 3300060353 Bacteria 8058
695 Ga0501082_0059775 3300060353 Bacteria 3284
696 Ga0501082_0105500 3300060353 Bacteria 2438
697 Ga0501082_0158908 3300060353 Bacteria 1964
698 Ga0501082_0167219 3300060353 Bacteria 1911
699 Ga0501082_0253139 3300060353 Bacteria 1532
700 Ga0501082_0508353 3300060353 Bacteria 1053
701 Ga0530510_0015192 3300061734 Bacteria 5437
702 Ga0530510_0032811 3300061734 Bacteria 3737
703 Ga0530510_0231024 3300061734 Bacteria 1376
704 Ga0530510_0232407 3300061734 Bacteria 1372
705 Ga0530510_0523958
706 JGI24735J21928_10012005
707 JGI26129J50193_1003564
708 JGI25407J50210_10033392
709 JGI26141J51220_1001422
710 Ga0065704_10314564
711 Ga0065715_10369058
712 Ga0070676_10001508
713 Ga0070683_100040464
714 Ga0070690_100118531
715 Ga0070690_100227937
716 Ga0070690_100516391
717 Ga0070670_100005711
718 Ga0068869_100001826
719 Ga0068869_100002053
720 Ga0070680_100011525
721 Ga0070680_100029669
722 Ga0070680_100034957
723 Ga0070680_100346515
724 Ga0070682_100010168
725 Ga0068868_100186906
726 Ga0070660_100006407
727 Ga0070689_100086275
728 Ga0070691_10001908
729 Ga0070691_10004132
730 Ga0070691_10023591
731 Ga0070661_100004542
732 Ga0070692_10096760
733 Ga0070668_100158679
734 Ga0070669_100009553
735 Ga0070669_100383192
736 Ga0070675_100096848
737 Ga0070659_100000322
738 Ga0070703_10000793
739 Ga0070703_10005280
740 Ga0070709_10045578
741 Ga0070701_10055062
742 Ga0070711_100462505
743 Ga0070705_100002220
744 Ga0070705_100019189
745 Ga0070705_100048811
746 Ga0070705_100068779
747 Ga0070700_100019386
748 Ga0070700_100054686
749 Ga0070694_100000296
750 Ga0070694_100000326
751 Ga0070694_100020927
752 Ga0070694_100054799
753 Ga0070694_100145888
754 Ga0070694_100468245
755 Ga0070708_100011197
756 Ga0070708_100015611
757 Ga0070708_100028675
758 Ga0070708_100032014
759 Ga0070708_100069682
760 Ga0070708_100129176
761 Ga0070708_100132915
762 Ga0070708_100385405
763 Ga0070663_100011713
764 Ga0070662_100002852
765 Ga0070662_100125151
766 Ga0070662_100411032
767 Ga0070662_100510981
768 Ga0070681_10003875
769 Ga0068867_100028261
770 Ga0070706_100023384
771 Ga0070706_100037683
772 Ga0070706_100048189
773 Ga0070706_100389021
774 Ga0070706_100574269
775 Ga0070707_100001990
776 Ga0070707_100015361
777 Ga0070707_100061601
778 Ga0070707_100114959
779 Ga0070707_100141390
780 Ga0070707_100264879
781 Ga0070707_100302553
782 Ga0070707_100401665
783 Ga0070707_100519354
784 Ga0070698_100011688
785 Ga0070698_100039746
786 Ga0070698_100060267
787 Ga0070698_100158187
788 Ga0070698_100322269
789 Ga0070698_100335321
790 Ga0070699_100003494
791 Ga0070699_100007127
792 Ga0070699_100150214
793 Ga0070699_100191765
794 Ga0070699_100248325
795 Ga0070699_100285229
796 Ga0070679_100011577
797 Ga0070684_100033110
798 Ga0070697_100006412
799 Ga0070697_100027540
800 Ga0070697_100044734
801 Ga0070697_100048855
802 Ga0070697_100050530
803 Ga0070697_100056999
804 Ga0070697_100276740
805 Ga0070697_100351576
806 Ga0068853_100000518
807 Ga0070672_100014519
808 Ga0070672_100027044
809 Ga0070695_100002363
810 Ga0070695_100005039
811 Ga0070695_100010470
812 Ga0070695_100017187
813 Ga0070696_100023696
814 Ga0070696_100081933
815 Ga0070696_100083494
816 Ga0070696_100108877
817 Ga0070696_100109916
818 Ga0070696_100284506
819 Ga0070693_100001092
820 Ga0070693_100053471
821 Ga0070704_100013935
822 Ga0070704_100035814
823 Ga0070704_100047033
824 Ga0070704_100117534
825 Ga0070704_100169678
826 Ga0068855_100008473
827 Ga0068855_100262322
828 Ga0070664_100023335
829 Ga0068857_100005198
830 Ga0068857_100094490
831 Ga0068857_100307625
832 Ga0068854_100002526
833 Ga0068856_100019528
834 Ga0070702_100065431
835 Ga0068852_100024867
836 Ga0068859_100000976
837 Ga0068859_100211864
838 Ga0068864_100001266
839 Ga0068870_10000987
840 Ga0068863_100056203
841 Ga0068858_100036781
842 Ga0068860_100016087
843 Ga0068860_100052318
844 Ga0068860_100144646
845 Ga0068860_100499276
846 Ga0068862_100001929
847 Ga0068862_100092664
848 Ga0068862_100532795
849 Ga0081455_10015861
850 Ga0081538_10028407
851 Ga0081540_1017503
852 Ga0081540_1103207
853 Ga0081539_10000044
854 Ga0070712_100003253
855 Ga0075428_100000409
856 Ga0075428_100004007
857 Ga0075428_100010083
858 Ga0075428_100012600
859 Ga0075428_100071289
860 Ga0075428_100093499
861 Ga0075428_100148280
862 Ga0075428_100721192
863 Ga0075428_100843780
864 Ga0075430_100000648
865 Ga0075430_100002276
866 Ga0075430_100006658
867 Ga0075430_100041160
868 Ga0075430_100059632
869 Ga0075430_100420480
870 Ga0075431_100000181
871 Ga0075431_100001052
872 Ga0075431_100003068
873 Ga0075431_100003078
874 Ga0075431_100009651
875 Ga0075431_100080627
876 Ga0075431_100093628
877 Ga0075431_100203116
878 Ga0075431_100311893
879 Ga0075431_100473263
880 Ga0075433_10001470
881 Ga0075433_10002688
882 Ga0075433_10017885
883 Ga0075433_10025926
884 Ga0075433_10067634
885 Ga0075433_10073771
886 Ga0075433_10100906
887 Ga0075433_10221264
888 Ga0075433_10229189
889 Ga0075434_100006184
890 Ga0075434_100010856
891 Ga0075434_100037121
892 Ga0075434_100045687
893 Ga0075434_100078686
894 Ga0075434_100122319
895 Ga0075434_100125335
896 Ga0075434_100134302
897 Ga0075434_100213306
898 Ga0075434_100640345
899 Ga0075429_100000116
900 Ga0075429_100006906
901 Ga0075429_100009267
902 Ga0075429_100010439
903 Ga0075429_100010600
904 Ga0075429_100011279
905 Ga0075429_100042925
906 Ga0075429_100100746
907 Ga0075429_100141934
908 Ga0075429_100430711
909 Ga0068865_100098520
910 Ga0068865_100100352
911 Ga0075436_100027597
912 Ga0075436_100035510
913 Ga0075436_100179959
914 Ga0097620_100000976
915 Ga0097620_100211860
916 Ga0075435_100005723
917 Ga0075435_100006422
918 Ga0075435_100010888
919 Ga0075435_100042844
920 Ga0075435_100160144
921 Ga0075435_100400418
922 Ga0099794_10045714
923 Ga0111539_10001546
924 Ga0111539_10016844
925 Ga0111539_10029142
926 Ga0111539_10059927
927 Ga0111539_10086840
928 Ga0105245_10061624
929 Ga0114129_10001191
930 Ga0114129_10012024
931 Ga0114129_10012777
932 Ga0114129_10016389
933 Ga0114129_10017340
934 Ga0114129_10022174
935 Ga0114129_10036794
936 Ga0114129_10073027
937 Ga0114129_10082640
938 Ga0114129_10127166
939 Ga0114129_10152998
940 Ga0114129_10244822
941 Ga0114129_10285463
942 Ga0114129_10294037
943 Ga0114129_10321737
944 Ga0114129_10363333
945 Ga0114129_10831422
946 Ga0114129_11337027
947 Ga0105243_10036440
948 Ga0105243_10153032
949 Ga0105243_10155987
950 Ga0105243_10301713
951 Ga0105241_10000602
952 Ga0105241_10081082
953 Ga0105241_10351278
954 Ga0105242_10002560
955 Ga0105242_10312952
956 Ga0105237_10004996
957 Ga0105238_10981169
958 Ga0105249_10022216
959 Ga0105249_10101361
960 Ga0105239_10002552
961 Ga0105239_10255784
962 Ga0105246_10031031
963 Ga0157373_10001523
964 Ga0157373_10280657
965 Ga0157369_10003919
966 Ga0157378_10103497
967 Ga0157378_10260932
968 Ga0157378_10438618
969 Ga0163162_10628566
970 Ga0163162_10669834
971 Ga0157372_10000415
972 Ga0157375_10024425
973 Ga0157375_10715082
974 Ga0157375_10982318
975 Ga0157375_11082745
976 Ga0163163_10075053
977 Ga0157380_10175728
978 Ga0157380_10680290
979 Ga0182008_10038272
980 Ga0207653_10001986
981 Ga0207653_10004275
982 Ga0207653_10017569
983 Ga0207688_10022050
984 Ga0207645_10000389
985 Ga0207643_10000290
986 Ga0207684_10000673
987 Ga0207684_10004725
988 Ga0207684_10007696
989 Ga0207684_10013914
990 Ga0207684_10019842
991 Ga0207684_10024244
992 Ga0207684_10049409
993 Ga0207654_10005545
994 Ga0207654_10018200
995 Ga0207707_10000158
996 Ga0207671_10002849
997 Ga0207693_10004038
998 Ga0207693_10164148
999 Ga0207663_10563445
1000 Ga0207660_10000987
1001 Ga0207660_10063986
1002 Ga0207660_10170079
1003 Ga0207660_10668382
1004 Ga0207657_10000426
1005 Ga0207649_10002448
1006 Ga0207652_10000290
1007 Ga0207646_10003019
1008 Ga0207646_10004413
1009 Ga0207646_10094726
1010 Ga0207646_10116178
1011 Ga0207646_10194980
1012 Ga0207646_10202571
1013 Ga0207646_10422670
1014 Ga0207646_10476044
1015 Ga0207646_10484674
1016 Ga0207681_10016844
1017 Ga0207681_10351511
1018 Ga0207650_10256121
1019 Ga0207659_10025333
1020 Ga0207687_10035250
1021 Ga0207690_10002346
1022 Ga0207706_10003426
1023 Ga0207686_10015702
1024 Ga0207709_10014362
1025 Ga0207709_10032319
1026 Ga0207709_10059847
1027 Ga0207709_10072769
1028 Ga0207709_10184559
1029 Ga0207670_10111422
1030 Ga0207670_10118886
1031 Ga0207704_10106592
1032 Ga0207704_10178895
1033 Ga0207665_10003465
1034 Ga0207691_10076908
1035 Ga0207691_10086362
1036 Ga0207691_10356739
1037 Ga0207689_10000277
1038 Ga0207689_10002344
1039 Ga0207689_10052447
1040 Ga0207679_10000773
1041 Ga0207667_10003179
1042 Ga0207667_10724203
1043 Ga0207712_10077000
1044 Ga0207668_10102555
1045 Ga0207668_10632273
1046 Ga0207640_10001020
1047 Ga0207677_10082810
1048 Ga0207703_10041954
1049 Ga0207703_10449022
1050 Ga0207639_10001029
1051 Ga0207678_10022159
1052 Ga0207708_10004830
1053 Ga0207708_10061128
1054 Ga0207702_10003932
1055 Ga0207648_10042884
1056 Ga0207648_10046041
1057 Ga0207648_10123281
1058 Ga0207676_10033858
1059 Ga0207674_10001112
1060 Ga0207674_10324804
1061 Ga0207675_100003707
1062 Ga0207683_10382711
1063 Ga0207698_10409182
1064 Ga0209969_1005511
1065 Ga0209967_1013273
1066 Ga0209981_1003723
1067 Ga0209996_1000276
1068 Ga0210000_1005391
1069 Ga0209995_1000753
1070 Ga0209968_1002525
1071 Ga0209999_1001317
1072 Ga0209982_1002708
1073 Ga0209983_1000304
1074 Ga0209983_1019974
1075 Ga0209588_1021324
1076 Ga0209588_1029903
1077 Ga0209588_1036640
1078 Ga0209971_1000036
1079 Ga0209966_1000228
1080 Ga0209998_10000002
1081 Ga0209974_10012526
1082 Ga0207428_10000398
1083 Ga0207428_10000526
1084 Ga0207428_10069725
1085 Ga0268266_10502658
1086 Ga0268265_10011589
1087 Ga0268265_10024881
1088 Ga0268264_10032016
1089 Ga0268264_10045134
1090 Ga0268264_10086095
1091 Ga0268264_10210804
1092 Ga0307408_100003915
1093 Ga0307408_100101902
1094 Ga0307408_100246087
1095 Ga0307405_10031571
1096 Ga0307413_10002384
1097 Ga0307410_10215824
1098 Ga0307407_10370626
1099 Ga0307412_10013219
1100 Ga0307412_10074286
1101 Ga0307412_10404405
1102 Ga0307409_100271350
1103 Ga0307409_100361726
1104 Ga0307409_100556605
1105 Ga0307409_101296598
1106 Ga0307416_100014018
1107 Ga0307411_10120923
1108 Ga0307415_100239906
1109 Ga0373950_0009574
1110 Ga0373928_0017528
1111 Ga0373940_0003877
1112 Ga0373949_0012139
1113 Ga0373949_0020438
1114 Ga0373949_0044645
1115 Ga0373951_0009267
1116 Ga0373952_0002583
1117 Ga0373932_0032119
1118 Ga0373939_0011216
1119 Ga0373939_0022929
1120 Ga0373931_0017773
1121 Ga0373931_0028538
1122 Ga0373931_0044914
1123 Ga0373931_0130007
1124 Ga0373931_0505477
1125 Ga0395899_0228129
1126 Ga0395898_0110168
1127 Ga0395898_0758660
1128 Ga0395901_0085204
1129 Ga0395901_0695613
1130 Ga0439443_021858
1131 Ga0439448_0007726
1132 Ga0439448_0034698
1133 Ga0439450_059040
1134 Ga0439455_0036068
1135 Ga0439458_0031856
1136 Ga0439435_0074447
1137 Ga0439435_0096276
1138 Ga0439464_0003187
1139 Ga0439460_0002670
1140 Ga0439460_0088913
1141 Ga0451577_0000793
1142 Ga0451577_0007730
1143 Ga0451577_0014349
1144 Ga0451577_0968603
1145 Ga0453683_0005071
1146 Ga0453683_0009470
1147 Ga0453683_0039670
1148 Ga0453683_0278141
1149 Ga0453684_0031081
1150 Ga0453684_0130819
1151 Ga0453684_0530748
1152 Ga0453684_0694702
1153 Ga0451576_0005173
1154 Ga0451576_0032025
1155 Ga0451576_0033529
1156 Ga0451576_0049699
1157 Ga0451576_0053559
1158 Ga0451576_0114215
1159 Ga0451576_0264864
1160 Ga0495603_0084563
1161 Ga0495580_0016661
1162 Ga0495580_0193068
1163 Ga0495584_0071647
1164 Ga0495584_0072783
1165 Ga0495642_0011189
1166 Ga0495633_0181734
1167 Ga0495656_0053380
1168 Ga0495659_0037935
1169 Ga0495669_0027414
1170 Ga0495669_0038401
1171 Ga0495636_0058445
1172 Ga0495636_0098583
1173 Ga0495636_0188675
1174 Ga0496102_0051899
1175 Ga0496103_0375382
1176 Ga0496104_0253378
1177 Ga0496105_0061652
1178 Ga0496106_0037094
1179 Ga0496106_0287039
1180 Ga0496106_0394127
1181 Ga0496106_0514185
1182 Ga0496108_0022804
1183 Ga0496108_0649067
1184 Ga0496109_0442920
1185 Ga0496110_0018494
1186 Ga0496110_0806316
1187 Ga0496111_0262286
1188 Ga0496112_0064810
1189 Ga0496113_0295158
1190 Ga0496114_0012272
1191 Ga0501031_0116012
1192 Ga0501031_0243676
1193 Ga0501032_0127389
1194 Ga0501033_0020667
1195 Ga0501033_0057423
1196 Ga0501033_0252405
1197 Ga0501036_0053635
1198 Ga0501036_0344199
1199 Ga0501038_0062853
1200 Ga0501039_0005533
1201 Ga0501039_0357622
1202 Ga0501039_0466292
1203 Ga0501039_0636721
1204 Ga0501040_0002756
1205 Ga0501040_0030056
1206 Ga0501040_0087287
1207 Ga0501040_0145261
1208 Ga0501040_0252876
1209 Ga0501041_0036477
1210 Ga0501041_0052173
1211 Ga0501041_0080929
1212 Ga0501041_0111594
1213 Ga0501041_0352247
1214 Ga0501042_0000598
1215 Ga0501042_0065812
1216 Ga0501042_0148671
1217 Ga0501042_0279767
1218 Ga0501042_0358319
1219 Ga0501043_0033816
1220 Ga0501043_0122969
1221 Ga0501046_0000240
1222 Ga0501046_0055306
1223 Ga0501046_0055808
1224 Ga0501046_0093811
1225 Ga0501046_0142576
1226 Ga0501046_0576693
1227 Ga0501047_0193410
1228 Ga0501048_0014851
1229 Ga0501048_0146719
1230 Ga0501048_0215869
1231 Ga0501067_0269534
1232 Ga0501068_0047077
1233 Ga0501068_0307817
1234 Ga0501071_0029734
1235 Ga0501071_0062699
1236 Ga0501071_0089391
1237 Ga0501071_0282300
1238 Ga0501072_0010731
1239 Ga0501072_0011976
1240 Ga0501072_0019392
1241 Ga0501072_0024925
1242 Ga0501072_0143087
1243 Ga0501072_0213564
1244 Ga0501072_0563245
1245 Ga0501073_0046661
1246 Ga0501073_0113279
1247 Ga0501073_0149774
1248 Ga0501074_0048490
1249 Ga0501074_0069840
1250 Ga0501074_0119473
1251 Ga0501075_0014499
1252 Ga0501075_0024646
1253 Ga0501075_0034507
1254 Ga0501075_0045394
1255 Ga0501075_0074095
1256 Ga0501075_0109511
1257 Ga0501075_0109520
1258 Ga0501075_0115461
1259 Ga0501075_0198999
1260 Ga0501076_0018260
1261 Ga0501076_0021228
1262 Ga0501076_0051267
1263 Ga0501076_0060391
1264 Ga0501076_0079350
1265 Ga0501076_0243552
1266 Ga0501076_0296881
1267 Ga0501076_0706975
1268 Ga0501076_0910073
1269 Ga0501077_0012026
1270 Ga0501077_0046909
1271 Ga0501077_0084986
1272 Ga0501077_0104873
1273 Ga0501077_0148829
1274 Ga0501077_0356827
1275 Ga0501079_0000962
1276 Ga0501079_0022830
1277 Ga0501079_0028488
1278 Ga0501079_0044843
1279 Ga0501079_0110328
1280 Ga0501079_0115159
1281 Ga0501079_0186870
1282 Ga0501080_0013705
1283 Ga0501080_0061308
1284 Ga0501080_0229708
1285 Ga0501080_0239431
1286 Ga0501080_0277362
1287 Ga0501080_0565874
1288 Ga0501080_0584024
1289 Ga0501081_0002065
1290 Ga0501081_0003003
1291 Ga0501081_0003043
1292 Ga0501081_0006739
1293 Ga0501081_0018202
1294 Ga0501081_0064719
1295 Ga0501083_0029430
1296 Ga0501083_0173718
1297 Ga0501035_0285826
1298 Ga0501035_0288301
1299 Ga0501035_0320692
1300 Ga0501045_0000542
1301 Ga0501045_0018403
1302 Ga0501045_0018570
1303 Ga0501045_0026245
1304 Ga0501045_0144679
1305 Ga0501045_0273232
1306 Ga0501045_0489812
1307 nmdc:mga05p37_10296_c1
1308 nmdc:mga05p37_10313_c1
1309 nmdc:mga05p37_111793_c1
1310 nmdc:mga05p37_11771_c1
1311 nmdc:mga05p37_1188_c1
1312 nmdc:mga05p37_132550_c1
1313 nmdc:mga05p37_182465_c1
1314 nmdc:mga05p37_212_c1
1315 nmdc:mga05p37_270065_c1
1316 nmdc:mga05p37_335410_c1
1317 nmdc:mga05p37_403887_c1
1318 nmdc:mga05p37_41471_c1
1319 nmdc:mga05p37_7876_c1
1320 nmdc:mga09592_11174_c1
1321 nmdc:mga09592_134764_c1
1322 nmdc:mga09592_212597_c1
1323 nmdc:mga09592_265_c1
1324 nmdc:mga09592_32798_c1
1325 nmdc:mga09592_38645_c1
1326 nmdc:mga09592_3999_c1
1327 nmdc:mga09592_413686_c1
1328 nmdc:mga09592_7616_c1
1329 nmdc:mga09592_92363_c1
1330 nmdc:mga09592_992_c1
1331 nmdc:mga0qj67_162838_c1
1332 nmdc:mga0qj67_2490_c1
1333 nmdc:mga0qj67_426286_c1
1334 nmdc:mga0qj67_6600_c1
1335 nmdc:mga0qj67_72017_c1
1336 nmdc:mga06r32_100340_c1
1337 nmdc:mga06r32_102516_c1
1338 nmdc:mga06r32_179862_c1
1339 nmdc:mga06r32_1850_c1
1340 nmdc:mga06r32_2420_c1
1341 nmdc:mga06r32_26143_c1
1342 nmdc:mga06r32_30435_c1
1343 nmdc:mga06r32_455607_c1
1344 nmdc:mga06r32_52930_c1
1345 nmdc:mga06r32_63311_c1
1346 nmdc:mga06r32_749782_c1
1347 nmdc:mga06r32_886_c1
1348 nmdc:mga08y16_1163552_c1
1349 nmdc:mga08y16_350387_c1
1350 nmdc:mga08y16_5536_c1
1351 nmdc:mga08y16_6014_c1
1352 nmdc:mga0n895_10268_c1
1353 nmdc:mga0n895_139945_c1
1354 nmdc:mga0n895_24612_c1
1355 nmdc:mga0n895_270470_c1
1356 nmdc:mga0n895_286848_c1
1357 nmdc:mga0n895_3081_c1
1358 nmdc:mga0n895_33586_c1
1359 nmdc:mga0n895_353404_c1
1360 nmdc:mga0n895_35372_c1
1361 nmdc:mga0n895_42945_c1
1362 nmdc:mga0n895_459722_c1
1363 nmdc:mga0rr50_1061_c1
1364 nmdc:mga0rr50_147245_c1
1365 nmdc:mga0rr50_153051_c1
1366 nmdc:mga0rr50_168928_c1
1367 nmdc:mga0rr50_2266_c1
1368 nmdc:mga0rr50_401764_c1
1369 nmdc:mga0rr50_65858_c1
1370 nmdc:mga0rr50_7012_c1
1371 nmdc:mga08x19_116540_c1
1372 nmdc:mga08x19_23888_c1
1373 nmdc:mga08x19_361440_c1
1374 nmdc:mga08x19_546158_c1
1375 nmdc:mga0a205_1419_c1
1376 nmdc:mga0a205_153847_c1
1377 nmdc:mga0a205_15574_c1
1378 nmdc:mga0a205_17378_c1
1379 nmdc:mga0a205_173969_c1
1380 nmdc:mga0a205_259714_c1
1381 nmdc:mga0a205_3138_c2
1382 nmdc:mga0a205_3294_c1
1383 nmdc:mga0a205_353382_c1
1384 nmdc:mga0a205_60234_c1
1385 nmdc:mga0a205_669355_c1
1386 nmdc:mga0a205_69079_c1
1387 nmdc:mga0a205_7770_c1
1388 Ga0501084_0011863
1389 Ga0501084_0043575
1390 Ga0501084_0060512
1391 Ga0501084_0064742
1392 Ga0501084_0109738
1393 Ga0501084_0113893
1394 Ga0501084_0202675
1395 Ga0590074_010689
1396 Ga0501082_0000590
1397 Ga0501082_0007107
1398 Ga0501082_0010275
1399 Ga0501082_0059775
1400 Ga0501082_0105500
1401 Ga0501082_0158908
1402 Ga0501082_0167219
1403 Ga0501082_0253139
1404 Ga0501082_0508353
1405 Ga0530510_0015192
1406 Ga0530510_0032811
1407 Ga0530510_0231024
1408 Ga0530510_0232407

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

12

204

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

18

250

0.91

PF08659

KR

KR domain

12

186

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1uzm-assembly1.cif.gz_A-2 maba from mycobacterium tuberculosis 0.9425 8 238
3u09-assembly1.cif.gz_A crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg)(g92d) from vibrio cholerae 0.9397 6 238
3tzq-assembly1.cif.gz_C crystal structure of a short-chain type dehydrogenase/reductase from mycobacterium marinum 0.9364 5 241
4nbw-assembly1.cif.gz_D crystal structure of fabg from plesiocystis pacifica 0.9362 6 237
4rzi-assembly1.cif.gz_B crystal structure of phab from synechocystis sp. pcc 6803 0.9335 6 238
ID Description Score Start End Superfamily
5h5xG00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9423 6 241 3.40.50.720
3tzqC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9364 5 237 3.40.50.720
4nbwD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9362 6 237 3.40.50.720
2ntnB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9338 8 238 3.40.50.720
4rziB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9335 6 238 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A6G3V2G6-F1-model_v4 deleted 0.9633 147 241
AF-X1F0L5-F1-model_v4 SDR family oxidoreductase 0.9594 156 241 GO:0016616
AF-R7HG36-F1-model_v4 Short-chain dehydrogenase/reductase family protein 0.9471 6 241 GO:0016491
AF-C7Q7G2-F1-model_v4 Short-chain dehydrogenase/reductase SDR 0.9454 6 241 GO:0016491
AF-S9SQ61-F1-model_v4 Short-chain dehydrogenase/reductase SDR 0.944 92 238

Map