F476347

General Info

Members Datasets Scaffolds Average Seq Length
704 287 1408 118

Family's Representative Sequence

Representative Sequence 3300009553|Ga0105249_11530845|Ga0105249_115308452
Length 134
Sequence LNPDPNSTXXXXTLPMTFTVEIVLRERDYAVTEQLPAPGGHQVPAEWNDADVEQLLKEILLAIDRARDPKSTQTYVALRGFSWIVEPTAGGVVIAIEIPMGAAVAGPFAVEQAVLDRIIRRVIAAAAPQKPVVH

Samples

Sample ID Description Type Environment
1 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
70 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
71 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
109 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
110 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
161 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
166 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
167 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
168 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
169 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
170 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
171 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
172 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
173 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
174 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
175 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
176 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
177 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
178 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
179 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
180 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
181 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
182 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
183 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
184 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
185 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
186 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
187 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
188 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
189 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
190 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
191 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
192 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
193 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
194 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
195 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
196 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
197 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
198 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
199 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
200 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
201 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
202 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
203 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
204 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
205 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
206 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
207 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
208 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
209 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
210 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
211 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
212 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
213 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
214 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
215 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
216 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
217 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
218 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
219 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
220 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
221 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
222 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
223 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
224 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
225 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
226 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
227 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
228 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
229 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
230 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
231 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
232 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
233 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
234 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
235 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
236 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
237 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
250 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
251 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
252 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
253 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
254 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
255 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
256 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
257 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
258 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
259 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
260 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
261 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
262 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
263 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
264 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
265 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
266 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
268 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
269 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
270 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
271 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
272 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
273 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
274 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
275 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
276 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
277 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
278 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
279 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
280 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
281 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
282 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
283 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
284 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
285 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
286 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
287 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.27
Nodule 0
Rhizoplane 3.98
Rhizosphere 93.32
Stem 0
Stem Tuber 0
Unclassified 30.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105249_11530845 3300009553 Unclassified 739
2 MBSR1b_contig_5728622 2162886012 Bacteria 838
3 JGI24034J26672_10062400 3300002239 Unclassified 656
4 Ga0065704_10198105 3300005289 Bacteria 1158
5 Ga0065712_10086979 3300005290 Bacteria 2605
6 Ga0065712_10103510 3300005290 Bacteria 1981
7 Ga0065712_10173568 3300005290 Bacteria 1230
8 Ga0065712_10295085 3300005290 Bacteria 870
9 Ga0065712_10573403 3300005290 Unclassified 591
10 Ga0065712_10586940 3300005290 Unclassified 598
11 Ga0065715_10004728 3300005293 Bacteria 5204
12 Ga0065715_10021825 3300005293 Bacteria 2311
13 Ga0065715_10137552 3300005293 Bacteria 1905
14 Ga0065715_10171753 3300005293 Unclassified 1541
15 Ga0065715_10201068 3300005293 Bacteria 1361
16 Ga0065715_10278084 3300005293 Unclassified 1093
17 Ga0065715_10304920 3300005293 Unclassified 1033
18 Ga0065715_10307205 3300005293 Bacteria 1017
19 Ga0065715_10380553 3300005293 Unclassified 908
20 Ga0065715_10427648 3300005293 Unclassified 851
21 Ga0065715_10575901 3300005293 Bacteria 724
22 Ga0065707_10001845 3300005295 Bacteria 7161
23 Ga0065707_10221738 3300005295 Bacteria 1222
24 Ga0065707_10227048 3300005295 Bacteria 1203
25 Ga0070658_10344412 3300005327 Unclassified 1275
26 Ga0070676_10077594 3300005328 Bacteria 2008
27 Ga0070676_10100171 3300005328 Bacteria 1788
28 Ga0070676_10403476 3300005328 Bacteria 952
29 Ga0070683_100002078 3300005329 Bacteria 15813
30 Ga0070683_100113950 3300005329 Bacteria 2552
31 Ga0070690_100078001 3300005330 Bacteria 2163
32 Ga0070690_100263421 3300005330 Unclassified 1223
33 Ga0070670_100010965 3300005331 Bacteria 7743
34 Ga0070670_100070482 3300005331 Bacteria 3001
35 Ga0070677_10086962 3300005333 Bacteria 1351
36 Ga0070677_10576990 3300005333 Unclassified 620
37 Ga0070666_10117992 3300005335 Bacteria 1839
38 Ga0070666_10412975 3300005335 Bacteria 971
39 Ga0070680_100648670 3300005336 Unclassified 907
40 Ga0070682_100220582 3300005337 Archaea 1349
41 Ga0070682_100609197 3300005337 Unclassified 863
42 Ga0068868_100162724 3300005338 Bacteria 1844
43 Ga0068868_101846027 3300005338 Bacteria 572
44 Ga0070660_100098864 3300005339 Bacteria 2310
45 Ga0070660_100099191 3300005339 Bacteria 2306
46 Ga0070660_100169126 3300005339 Bacteria 1765
47 Ga0070689_100007957 3300005340 Bacteria 7439
48 Ga0070689_100052500 3300005340 Bacteria 3153
49 Ga0070689_101909879 3300005340 Unclassified 542
50 Ga0070691_10084191 3300005341 Unclassified 1561
51 Ga0070691_10300755 3300005341 Unclassified 876
52 Ga0070687_100578128 3300005343 Bacteria 768
53 Ga0070661_100058006 3300005344 Bacteria 2837
54 Ga0070661_100138419 3300005344 Bacteria 1833
55 Ga0070661_100495169 3300005344 Unclassified 978
56 Ga0070668_100213249 3300005347 Unclassified 1589
57 Ga0070668_100698788 3300005347 Unclassified 894
58 Ga0070668_101986298 3300005347 Unclassified 536
59 Ga0070669_100001430 3300005353 Bacteria 17264
60 Ga0070669_100093036 3300005353 Bacteria 2264
61 Ga0070669_100147154 3300005353 Bacteria 1821
62 Ga0070669_100161051 3300005353 Bacteria 1744
63 Ga0070669_100427318 3300005353 Bacteria 1088
64 Ga0070669_101331238 3300005353 Unclassified 622
65 Ga0070669_101907904 3300005353 Unclassified 519
66 Ga0070675_100029844 3300005354 Bacteria 4399
67 Ga0070675_100367016 3300005354 Bacteria 1279
68 Ga0070675_101621388 3300005354 Unclassified 597
69 Ga0070671_100026083 3300005355 Bacteria 4800
70 Ga0070671_100600877 3300005355 Bacteria 951
71 Ga0070674_100035377 3300005356 Bacteria 3345
72 Ga0070674_100151796 3300005356 Bacteria 1749
73 Ga0070674_100213775 3300005356 Bacteria 1496
74 Ga0070674_100303695 3300005356 Bacteria 1273
75 Ga0070674_100579518 3300005356 Bacteria 945
76 Ga0070674_100617490 3300005356 Bacteria 918
77 Ga0070673_100100215 3300005364 Bacteria 2384
78 Ga0070673_100146229 3300005364 Unclassified 1998
79 Ga0070673_100209346 3300005364 Unclassified 1683
80 Ga0070673_100352019 3300005364 Bacteria 1307
81 Ga0070673_101610906 3300005364 Unclassified 613
82 Ga0070688_101093869 3300005365 Bacteria 637
83 Ga0070659_100050596 3300005366 Bacteria 3266
84 Ga0070659_100077793 3300005366 Bacteria 2646
85 Ga0070659_100094079 3300005366 Bacteria 2406
86 Ga0070659_100282995 3300005366 Bacteria 1380
87 Ga0070659_100427574 3300005366 Bacteria 1121
88 Ga0070659_100577400 3300005366 Unclassified 964
89 Ga0070667_100424948 3300005367 Bacteria 1212
90 Ga0070667_101543112 3300005367 Unclassified 624
91 Ga0070713_100040587 3300005436 Bacteria 3784
92 Ga0070701_10155243 3300005438 Unclassified 1321
93 Ga0070705_100005698 3300005440 Bacteria 6085
94 Ga0070700_100002855 3300005441 Bacteria 8861
95 Ga0070700_100521050 3300005441 Bacteria 918
96 Ga0070700_100667489 3300005441 Unclassified 823
97 Ga0070700_100804056 3300005441 Unclassified 757
98 Ga0070700_101372459 3300005441 Bacteria 596
99 Ga0070708_100349604 3300005445 Bacteria 1393
100 Ga0070663_100062097 3300005455 Bacteria 2692
101 Ga0070678_100556597 3300005456 Bacteria 1019
102 Ga0070678_101333499 3300005456 Bacteria 668
103 Ga0070678_102051345 3300005456 Bacteria 541
104 Ga0070662_100049815 3300005457 Bacteria 3021
105 Ga0070662_100480420 3300005457 Unclassified 1034
106 Ga0070662_100571004 3300005457 Unclassified 949
107 Ga0070662_100628818 3300005457 Bacteria 904
108 Ga0070681_10431414 3300005458 Bacteria 1230
109 Ga0070681_10469279 3300005458 Bacteria 1171
110 Ga0070681_10827704 3300005458 Unclassified 843
111 Ga0070685_10351457 3300005466 Unclassified 1008
112 Ga0070706_100419211 3300005467 Unclassified 1246
113 Ga0070698_100507484 3300005471 Unclassified 1144
114 Ga0070698_101818603 3300005471 Bacteria 562
115 Ga0070699_100053801 3300005518 Bacteria 3484
116 Ga0070679_101388977 3300005530 Bacteria 648
117 Ga0070684_100000410 3300005535 Bacteria 29374
118 Ga0070684_100229727 3300005535 Bacteria 1694
119 Ga0068853_101472726 3300005539 Unclassified 659
120 Ga0070672_100024760 3300005543 Bacteria 4442
121 Ga0070672_100086423 3300005543 Bacteria 2522
122 Ga0070672_101245479 3300005543 Unclassified 663
123 Ga0070672_101401020 3300005543 Unclassified 625
124 Ga0070695_100010754 3300005545 Bacteria 5467
125 Ga0070696_100232280 3300005546 Unclassified 1388
126 Ga0070696_100240998 3300005546 Unclassified 1364
127 Ga0070696_100731923 3300005546 Bacteria 809
128 Ga0070693_100024152 3300005547 Bacteria 3256
129 Ga0070693_100024701 3300005547 Bacteria 3225
130 Ga0070693_100824418 3300005547 Bacteria 689
131 Ga0070665_100693108 3300005548 Bacteria 1032
132 Ga0070665_101691536 3300005548 Unclassified 640
133 Ga0070704_100243613 3300005549 Bacteria 1472
134 Ga0070664_100062200 3300005564 Bacteria 3182
135 Ga0070664_100128194 3300005564 Unclassified 2227
136 Ga0070664_100136784 3300005564 Bacteria 2155
137 Ga0070664_100192071 3300005564 Bacteria 1819
138 Ga0068857_100019720 3300005577 Bacteria 5923
139 Ga0068857_100038740 3300005577 Bacteria 4220
140 Ga0068857_101362761 3300005577 Unclassified 689
141 Ga0068854_100024075 3300005578 Bacteria 4165
142 Ga0068854_100952767 3300005578 Bacteria 757
143 Ga0068856_100154317 3300005614 Bacteria 2306
144 Ga0068856_100814694 3300005614 Bacteria 953
145 Ga0070702_100099058 3300005615 Bacteria 1784
146 Ga0070702_100156340 3300005615 Bacteria 1469
147 Ga0070702_100742515 3300005615 Bacteria 753
148 Ga0068852_100097414 3300005616 Bacteria 2646
149 Ga0068864_100291618 3300005618 Bacteria 1525
150 Ga0068861_100116765 3300005719 Bacteria 2146
151 Ga0068861_100316126 3300005719 Unclassified 1358
152 Ga0068851_10310466 3300005834 Bacteria 909
153 Ga0068870_10190728 3300005840 Bacteria 1236
154 Ga0068863_100067233 3300005841 Bacteria 3389
155 Ga0068863_100476160 3300005841 Bacteria 1227
156 Ga0068858_101138267 3300005842 Bacteria 766
157 Ga0068858_101886868 3300005842 Unclassified 590
158 Ga0068860_101744118 3300005843 Unclassified 644
159 Ga0068860_102108167 3300005843 Unclassified 585
160 Ga0068860_102326549 3300005843 Unclassified 556
161 Ga0068862_100112316 3300005844 Unclassified 2393
162 Ga0068862_100962819 3300005844 Bacteria 842
163 Ga0068862_101027381 3300005844 Unclassified 816
164 Ga0070717_10468944 3300006028 Bacteria 1136
165 Ga0075365_10008855 3300006038 Bacteria 5744
166 Ga0075365_10702770 3300006038 Viruses 714
167 Ga0075365_10750179 3300006038 Unclassified 689
168 Ga0075368_10023333 3300006042 Bacteria 2362
169 Ga0075432_10254338 3300006058 Bacteria 714
170 Ga0075367_10006485 3300006178 Bacteria 5916
171 Ga0075367_10353806 3300006178 Unclassified 927
172 Ga0075366_10019381 3300006195 Bacteria 3936
173 Ga0075366_10426677 3300006195 Bacteria 817
174 Ga0097621_100317620 3300006237 Unclassified 1379
175 Ga0075428_100018018 3300006844 Bacteria 7804
176 Ga0075428_100020894 3300006844 Bacteria 7249
177 Ga0075428_100030260 3300006844 Bacteria 5988
178 Ga0075428_100040829 3300006844 Bacteria 5103
179 Ga0075428_100078720 3300006844 Bacteria 3598
180 Ga0075428_101249061 3300006844 Bacteria 782
181 Ga0075428_101553582 3300006844 Bacteria 692
182 Ga0075430_100001210 3300006846 Bacteria 20754
183 Ga0075430_100022839 3300006846 Bacteria 5320
184 Ga0075430_100039460 3300006846 Bacteria 3998
185 Ga0075430_100149139 3300006846 Bacteria 1947
186 Ga0075430_100177530 3300006846 Bacteria 1772
187 Ga0075430_100215754 3300006846 Unclassified 1592
188 Ga0075430_100301972 3300006846 Bacteria 1324
189 Ga0075431_100014064 3300006847 Bacteria 8088
190 Ga0075431_100020689 3300006847 Bacteria 6723
191 Ga0075431_100048249 3300006847 Bacteria 4392
192 Ga0075431_100067158 3300006847 Unclassified 3702
193 Ga0075431_100067442 3300006847 Unclassified 3693
194 Ga0075431_100106980 3300006847 Bacteria 2886
195 Ga0075431_100151236 3300006847 Bacteria 2390
196 Ga0075431_100341738 3300006847 Bacteria 1506
197 Ga0075431_100370046 3300006847 Bacteria 1438
198 Ga0075431_102039037 3300006847 Bacteria 529
199 Ga0075433_10007689 3300006852 Bacteria 8561
200 Ga0075433_10021426 3300006852 Bacteria 5420
201 Ga0075433_10087471 3300006852 Unclassified 2752
202 Ga0075433_10153575 3300006852 Bacteria 2048
203 Ga0075433_10189456 3300006852 Bacteria 1830
204 Ga0075434_100024029 3300006871 Bacteria 5952
205 Ga0075434_100043086 3300006871 Bacteria 4475
206 Ga0075434_100197002 3300006871 Bacteria 2034
207 Ga0075434_100201978 3300006871 Bacteria 2008
208 Ga0075434_100222681 3300006871 Bacteria 1906
209 Ga0075434_100958553 3300006871 Bacteria 870
210 Ga0075429_100007738 3300006880 Bacteria 9328
211 Ga0075429_100132147 3300006880 Unclassified 2184
212 Ga0075429_100174378 3300006880 Bacteria 1884
213 Ga0075429_100191997 3300006880 Unclassified 1789
214 Ga0075429_100193944 3300006880 Unclassified 1779
215 Ga0075429_101030478 3300006880 Unclassified 719
216 Ga0075429_101358391 3300006880 Bacteria 619
217 Ga0075429_101722708 3300006880 Unclassified 544
218 Ga0068865_100260439 3300006881 Unclassified 1373
219 Ga0068865_100551167 3300006881 Unclassified 968
220 Ga0075435_100121106 3300007076 Bacteria 2183
221 Ga0075435_100124655 3300007076 Bacteria 2152
222 Ga0105240_10417622 3300009093 Unclassified 1508
223 Ga0105240_11191958 3300009093 Bacteria 807
224 Ga0111539_10000434 3300009094 Bacteria 52748
225 Ga0111539_10000656 3300009094 Bacteria 44723
226 Ga0111539_10032109 3300009094 Bacteria 6378
227 Ga0111539_10049148 3300009094 Bacteria 5033
228 Ga0111539_10050973 3300009094 Bacteria 4931
229 Ga0111539_10179955 3300009094 Bacteria 2470
230 Ga0111539_10309297 3300009094 Bacteria 1839
231 Ga0111539_10466059 3300009094 Unclassified 1471
232 Ga0111539_10589091 3300009094 Unclassified 1295
233 Ga0111539_10994240 3300009094 Unclassified 975
234 Ga0105245_10151585 3300009098 Bacteria 2193
235 Ga0105247_11435125 3300009101 Unclassified 560
236 Ga0114129_10000313 3300009147 Bacteria 56679
237 Ga0114129_10003752 3300009147 Bacteria 21421
238 Ga0114129_10024306 3300009147 Bacteria 8584
239 Ga0114129_10024565 3300009147 Bacteria 8538
240 Ga0114129_10130207 3300009147 Bacteria 3456
241 Ga0114129_10138698 3300009147 Bacteria 3335
242 Ga0114129_10154957 3300009147 Bacteria 3134
243 Ga0114129_10287978 3300009147 Bacteria 2193
244 Ga0114129_10818296 3300009147 Unclassified 1187
245 Ga0114129_11192015 3300009147 Bacteria 949
246 Ga0114129_11223222 3300009147 Bacteria 934
247 Ga0105243_10345783 3300009148 Unclassified 1364
248 Ga0105243_10357909 3300009148 Bacteria 1342
249 Ga0105243_11565971 3300009148 Unclassified 685
250 Ga0105241_10236508 3300009174 Unclassified 1542
251 Ga0105242_10208369 3300009176 Unclassified 1740
252 Ga0105248_10050565 3300009177 Bacteria 4662
253 Ga0105248_10052240 3300009177 Bacteria 4586
254 Ga0105248_11221635 3300009177 Bacteria 850
255 Ga0105238_10690587 3300009551 Bacteria 1032
256 Ga0105249_10002582 3300009553 Bacteria 15674
257 Ga0105249_10362431 3300009553 Unclassified 1471
258 Ga0105249_10421844 3300009553 Bacteria 1368
259 Ga0105249_12381974 3300009553 Bacteria 602
260 Ga0105239_10466256 3300010375 Unclassified 1434
261 Ga0105239_10630079 3300010375 Unclassified 1224
262 Ga0105239_11972838 3300010375 Bacteria 677
263 Ga0105246_10127427 3300011119 Unclassified 1896
264 Ga0105246_10416689 3300011119 Unclassified 1120
265 Ga0105246_10450416 3300011119 Bacteria 1081
266 Ga0157373_11399710 3300013100 Bacteria 532
267 Ga0157370_10124563 3300013104 Bacteria 2406
268 Ga0157374_10153567 3300013296 Bacteria 2240
269 Ga0157378_10461178 3300013297 Bacteria 1263
270 Ga0163162_10360157 3300013306 Unclassified 1587
271 Ga0163162_11263182 3300013306 Unclassified 839
272 Ga0157372_10804547 3300013307 Unclassified 1092
273 Ga0157375_10135744 3300013308 Bacteria 2584
274 Ga0157375_10784088 3300013308 Bacteria 1103
275 Ga0157375_11001592 3300013308 Bacteria 975
276 Ga0157375_12302023 3300013308 Bacteria 642
277 Ga0163163_10006072 3300014325 Bacteria 10510
278 Ga0163163_10196299 3300014325 Bacteria 2066
279 Ga0157380_10040851 3300014326 Bacteria 3616
280 Ga0157380_10191708 3300014326 Bacteria 1805
281 Ga0157380_10492832 3300014326 Bacteria 1188
282 Ga0157380_11069347 3300014326 Bacteria 844
283 Ga0157380_11182306 3300014326 Bacteria 808
284 Ga0157380_13043052 3300014326 Bacteria 534
285 Ga0157377_10092757 3300014745 Unclassified 1786
286 Ga0157379_11074439 3300014968 Unclassified 770
287 Ga0157379_11663499 3300014968 Bacteria 624
288 Ga0157376_10513496 3300014969 Unclassified 1180
289 Ga0163161_10622158 3300017792 Archaea 892
290 Ga0213876_10113104 3300021384 Bacteria 1441
291 Ga0207673_1046539 3300025290 Unclassified 612
292 Ga0207697_10000452 3300025315 Bacteria 23128
293 Ga0207642_10331091 3300025899 Unclassified 892
294 Ga0207688_10008316 3300025901 Bacteria 5642
295 Ga0207688_10197770 3300025901 Unclassified 1204
296 Ga0207647_10630259 3300025904 Unclassified 589
297 Ga0207645_10597999 3300025907 Bacteria 749
298 Ga0207705_10334210 3300025909 Unclassified 1166
299 Ga0207684_10349005 3300025910 Unclassified 1274
300 Ga0207707_10228829 3300025912 Bacteria 1618
301 Ga0207707_10317066 3300025912 Unclassified 1347
302 Ga0207695_11056736 3300025913 Bacteria 692
303 Ga0207660_10252707 3300025917 Bacteria 1391
304 Ga0207660_10434852 3300025917 Bacteria 1060
305 Ga0207662_10002564 3300025918 Bacteria 9154
306 Ga0207662_10562382 3300025918 Bacteria 791
307 Ga0207657_10284255 3300025919 Bacteria 1313
308 Ga0207657_10325512 3300025919 Bacteria 1215
309 Ga0207649_10165667 3300025920 Bacteria 1535
310 Ga0207649_10929513 3300025920 Unclassified 683
311 Ga0207652_10103381 3300025921 Bacteria 2519
312 Ga0207681_10017662 3300025923 Unclassified 4482
313 Ga0207681_10133479 3300025923 Bacteria 1839
314 Ga0207681_10142365 3300025923 Bacteria 1787
315 Ga0207650_10010113 3300025925 Bacteria 6465
316 Ga0207650_10037851 3300025925 Bacteria 3518
317 Ga0207659_10019102 3300025926 Bacteria 4504
318 Ga0207659_11210483 3300025926 Bacteria 649
319 Ga0207700_10012334 3300025928 Bacteria 5505
320 Ga0207664_10875833 3300025929 Bacteria 807
321 Ga0207644_10181253 3300025931 Bacteria 1651
322 Ga0207690_10377686 3300025932 Bacteria 1126
323 Ga0207690_10581137 3300025932 Unclassified 913
324 Ga0207706_10453597 3300025933 Bacteria 1109
325 Ga0207706_10512698 3300025933 Unclassified 1035
326 Ga0207686_10125947 3300025934 Unclassified 1750
327 Ga0207709_10051326 3300025935 Bacteria 2528
328 Ga0207669_11259532 3300025937 Unclassified 627
329 Ga0207669_11322621 3300025937 Unclassified 612
330 Ga0207669_11469633 3300025937 Unclassified 581
331 Ga0207704_10243270 3300025938 Unclassified 1346
332 Ga0207691_10026358 3300025940 Bacteria 5454
333 Ga0207691_10164424 3300025940 Bacteria 1945
334 Ga0207691_10205545 3300025940 Bacteria 1713
335 Ga0207691_10915580 3300025940 Unclassified 734
336 Ga0207711_10005504 3300025941 Bacteria 10707
337 Ga0207689_10153475 3300025942 Bacteria 1898
338 Ga0207661_10053550 3300025944 Bacteria 3229
339 Ga0207661_10231555 3300025944 Bacteria 1636
340 Ga0207679_10043674 3300025945 Bacteria 3229
341 Ga0207679_10070262 3300025945 Bacteria 2638
342 Ga0207679_10299072 3300025945 Unclassified 1386
343 Ga0207651_10005415 3300025960 Bacteria 6545
344 Ga0207651_10225833 3300025960 Unclassified 1517
345 Ga0207651_11196834 3300025960 Unclassified 682
346 Ga0207712_10063625 3300025961 Bacteria 2627
347 Ga0207712_10156812 3300025961 Bacteria 1764
348 Ga0207712_10345017 3300025961 Bacteria 1236
349 Ga0207668_10652382 3300025972 Unclassified 921
350 Ga0207668_11218305 3300025972 Bacteria 677
351 Ga0207640_11858496 3300025981 Bacteria 545
352 Ga0207658_11893941 3300025986 Bacteria 543
353 Ga0207677_10100958 3300026023 Bacteria 2123
354 Ga0207703_10329862 3300026035 Bacteria 1399
355 Ga0207639_10382728 3300026041 Bacteria 1264
356 Ga0207678_10046568 3300026067 Bacteria 3750
357 Ga0207678_11390488 3300026067 Bacteria 620
358 Ga0207678_11404532 3300026067 Bacteria 617
359 Ga0207708_10000847 3300026075 Bacteria 23031
360 Ga0207708_11164808 3300026075 Bacteria 673
361 Ga0207708_11391081 3300026075 Bacteria 616
362 Ga0207702_11302142 3300026078 Bacteria 721
363 Ga0207641_10245445 3300026088 Bacteria 1670
364 Ga0207641_10408755 3300026088 Bacteria 1305
365 Ga0207641_11225974 3300026088 Bacteria 750
366 Ga0207648_10008769 3300026089 Bacteria 9746
367 Ga0207676_10267719 3300026095 Bacteria 1546
368 Ga0207674_10024860 3300026116 Bacteria 6393
369 Ga0207674_10051429 3300026116 Bacteria 4204
370 Ga0207674_11172179 3300026116 Unclassified 738
371 Ga0207675_100007516 3300026118 Bacteria 10296
372 Ga0207683_10025142 3300026121 Bacteria 5135
373 Ga0207683_10026635 3300026121 Bacteria 4993
374 Ga0207683_10323015 3300026121 Bacteria 1414
375 Ga0207698_10420083 3300026142 Bacteria 1283
376 Ga0207698_11244479 3300026142 Bacteria 759
377 Ga0210002_1041591 3300027617 Unclassified 781
378 Ga0209813_10069367 3300027866 Bacteria 1143
379 Ga0207428_10003733 3300027907 Bacteria 14622
380 Ga0207428_10016933 3300027907 Bacteria 6263
381 Ga0207428_10072065 3300027907 Unclassified 2713
382 Ga0207428_10131882 3300027907 Bacteria 1911
383 Ga0207428_10462077 3300027907 Bacteria 925
384 Ga0268266_10472971 3300028379 Bacteria 1194
385 Ga0268266_11092692 3300028379 Unclassified 772
386 Ga0268265_10143540 3300028380 Unclassified 2002
387 Ga0268265_10230604 3300028380 Unclassified 1627
388 Ga0268265_10424779 3300028380 Bacteria 1235
389 Ga0268265_11027825 3300028380 Bacteria 815
390 Ga0268264_11879227 3300028381 Bacteria 609
391 Ga0268264_12650657 3300028381 Bacteria 505
392 Ga0316182_1123610 3300030745 Bacteria 979
393 Ga0265332_10027285 3300031238 Bacteria 2502
394 Ga0265320_10043033 3300031240 Bacteria 2236
395 Ga0307408_100014810 3300031548 Bacteria 5185
396 Ga0307408_100171835 3300031548 Bacteria 1731
397 Ga0307408_100259842 3300031548 Bacteria 1437
398 Ga0307408_100987205 3300031548 Bacteria 775
399 Ga0265314_10043946 3300031711 Bacteria 3171
400 Ga0316576_10844847 3300031727 Bacteria 657
401 Ga0307405_10127599 3300031731 Bacteria 1752
402 Ga0307405_10237293 3300031731 Bacteria 1348
403 Ga0307405_10775301 3300031731 Unclassified 801
404 Ga0307405_10949102 3300031731 Unclassified 731
405 Ga0307413_10139527 3300031824 Bacteria 1673
406 Ga0307413_10508494 3300031824 Unclassified 969
407 Ga0307413_10583609 3300031824 Bacteria 912
408 Ga0307410_10850255 3300031852 Unclassified 779
409 Ga0307406_10146027 3300031901 Bacteria 1681
410 Ga0307406_10279921 3300031901 Bacteria 1272
411 Ga0307407_10227470 3300031903 Bacteria 1265
412 Ga0307407_11403244 3300031903 Bacteria 550
413 Ga0307412_10031508 3300031911 Bacteria 3350
414 Ga0307412_10744036 3300031911 Bacteria 846
415 Ga0307412_10751455 3300031911 Unclassified 842
416 Ga0307412_11024401 3300031911 Bacteria 731
417 Ga0307412_11458731 3300031911 Bacteria 621
418 Ga0307409_100075728 3300031995 Bacteria 2696
419 Ga0307409_100105110 3300031995 Bacteria 2353
420 Ga0307409_100124688 3300031995 Bacteria 2189
421 Ga0307409_100480582 3300031995 Bacteria 1205
422 Ga0307409_100488699 3300031995 Bacteria 1196
423 Ga0307409_100755921 3300031995 Bacteria 976
424 Ga0307416_100039491 3300032002 Bacteria 3655
425 Ga0307416_100132932 3300032002 Unclassified 2244
426 Ga0307416_100296750 3300032002 Bacteria 1604
427 Ga0307416_100574789 3300032002 Bacteria 1203
428 Ga0307416_100942247 3300032002 Unclassified 965
429 Ga0307416_101132580 3300032002 Bacteria 887
430 Ga0307416_101252933 3300032002 Unclassified 847
431 Ga0307416_101559803 3300032002 Bacteria 766
432 Ga0307416_102586420 3300032002 Unclassified 605
433 Ga0307416_102848347 3300032002 Bacteria 579
434 Ga0307416_103720495 3300032002 Unclassified 511
435 Ga0307411_10122021 3300032005 Unclassified 1888
436 Ga0307411_10135349 3300032005 Bacteria 1808
437 Ga0307411_10183271 3300032005 Bacteria 1591
438 Ga0307411_10242837 3300032005 Bacteria 1411
439 Ga0307411_10298390 3300032005 Unclassified 1291
440 Ga0307411_10500072 3300032005 Unclassified 1027
441 Ga0307411_11539246 3300032005 Unclassified 612
442 Ga0307415_100020005 3300032126 Bacteria 4077
443 Ga0307415_100458440 3300032126 Unclassified 1104
444 Ga0373959_0097380 3300034820 Bacteria 696
445 Ga0373926_0194420 3300035083 Bacteria 780
446 Ga0373944_0145959 3300035089 Bacteria 831
447 Ga0373923_0224550 3300035111 Bacteria 874
448 Ga0373943_0055931 3300035170 Bacteria 1956
449 Ga0373946_0403547 3300035171 Bacteria 690
450 Ga0373955_0266049 3300035172 Bacteria 1030
451 Ga0373927_0563094 3300035695 Bacteria 753
452 Ga0373947_0014683 3300035725 Bacteria 4493
453 Ga0373947_0616398 3300035725 Bacteria 740
454 Ga0373937_0430135 3300036401 Bacteria 1253
455 Ga0373937_1784423 3300036401 Unclassified 562
456 Ga0373925_1047206 3300037068 Unclassified 672
457 Ga0436365_1794937 3300039437 Bacteria 2121
458 Ga0439436_0215284 3300041404 Unclassified 552
459 Ga0439453_0007070 3300041408 Bacteria 1768
460 Ga0439461_0130065 3300041410 Unclassified 636
461 Ga0451853_2543361 3300041512 Unclassified 805
462 Ga0439433_0010692 3300041999 Unclassified 2006
463 Ga0439445_0044146 3300042004 Unclassified 1190
464 Ga0439449_0068350 3300042007 Unclassified 1310
465 Ga0439449_0133055 3300042007 Bacteria 925
466 Ga0439450_053140 3300042008 Bacteria 966
467 Ga0439451_082025 3300042009 Unclassified 648
468 Ga0439462_0038317 3300042015 Unclassified 1277
469 Ga0450915_015299 3300042119 Bacteria 576
470 Ga0450891_022995 3300042129 Bacteria 620
471 Ga0450889_015673 3300042144 Bacteria 815
472 Ga0439446_0006017 3300042156 Bacteria 3144
473 Ga0439446_0269852 3300042156 Unclassified 591
474 Ga0439434_0031728 3300042435 Bacteria 1607
475 Ga0439434_0110588 3300042435 Bacteria 890
476 Ga0439435_0020027 3300042436 Bacteria 1721
477 Ga0439435_0120170 3300042436 Unclassified 823
478 Ga0439435_0144943 3300042436 Unclassified 758
479 Ga0439464_0001620 3300042439 Bacteria 5362
480 Ga0439460_0067027 3300042461 Unclassified 1105
481 Ga0453684_0564701 3300044712 Bacteria 1252
482 Ga0466967_1999011 3300045976 Bacteria 576
483 Ga0495629_0206062 3300046459 Bacteria 1359
484 Ga0495653_0022197 3300046463 Bacteria 5137
485 Ga0495594_0332104 3300046499 Bacteria 866
486 Ga0495633_0573457 3300046558 Unclassified 508
487 Ga0495647_0366044 3300046681 Unclassified 658
488 Ga0495669_0196493 3300046684 Bacteria 963
489 Ga0495649_0524324 3300046694 Unclassified 588
490 Ga0495600_0445923 3300046809 Bacteria 801
491 Ga0496100_1299322 3300048903 Unclassified 574
492 Ga0496101_0075840 3300048904 Bacteria 2476
493 Ga0496101_0719534 3300048904 Unclassified 788
494 Ga0496102_0003103 3300048905 Bacteria 14087
495 Ga0496103_0173540 3300048906 Bacteria 1385
496 Ga0496103_0188571 3300048906 Bacteria 1326
497 Ga0496105_0079603 3300048908 Bacteria 2706
498 Ga0496106_0102233 3300048909 Bacteria 2223
499 Ga0496106_0622076 3300048909 Unclassified 864
500 Ga0496106_0728062 3300048909 Bacteria 790
501 Ga0496106_1259251 3300048909 Unclassified 575
502 Ga0496107_0788069 3300048910 Bacteria 696
503 Ga0496107_0838352 3300048910 Unclassified 672
504 Ga0496107_0902688 3300048910 Unclassified 644
505 Ga0496108_1103654 3300048911 Bacteria 674
506 Ga0496108_1254969 3300048911 Unclassified 625
507 Ga0496109_0001791 3300048912 Bacteria 17856
508 Ga0496109_0519873 3300048912 Unclassified 1123
509 Ga0496109_0575506 3300048912 Bacteria 1062
510 Ga0496109_0578003 3300048912 Unclassified 1059
511 Ga0496109_1070618 3300048912 Bacteria 743
512 Ga0496110_0002233 3300048913 Bacteria 14476
513 Ga0496110_0143395 3300048913 Bacteria 2160
514 Ga0496111_0089374 3300048914 Bacteria 2256
515 Ga0496112_0053611 3300048915 Bacteria 3961
516 Ga0496112_0578866 3300048915 Bacteria 1055
517 Ga0496112_0692421 3300048915 Bacteria 947
518 Ga0496113_0135227 3300048916 Bacteria 1936
519 Ga0501297_011788 3300049520 Bacteria 1008
520 Ga0501299_017261 3300049522 Bacteria 1286
521 Ga0501303_023090 3300049526 Bacteria 677
522 Ga0501031_0076841 3300049568 Bacteria 2175
523 Ga0501031_0084172 3300049568 Bacteria 2073
524 Ga0501036_0006521 3300049572 Bacteria 9482
525 Ga0501036_0153813 3300049572 Bacteria 1940
526 Ga0501036_0248131 3300049572 Bacteria 1492
527 Ga0501036_0427461 3300049572 Bacteria 1104
528 Ga0501037_0521602 3300049573 Unclassified 804
529 Ga0501037_0890482 3300049573 Bacteria 584
530 Ga0501038_0490993 3300049574 Bacteria 940
531 Ga0501038_0565431 3300049574 Unclassified 863
532 Ga0501038_0775598 3300049574 Bacteria 714
533 Ga0501038_0868940 3300049574 Bacteria 667
534 Ga0501038_1372973 3300049574 Bacteria 508
535 Ga0501039_0054547 3300049575 Bacteria 3094
536 Ga0501039_0175423 3300049575 Unclassified 1686
537 Ga0501039_0387656 3300049575 Bacteria 1097
538 Ga0501040_0026847 3300049576 Bacteria 3874
539 Ga0501040_0071877 3300049576 Bacteria 2389
540 Ga0501040_0252490 3300049576 Bacteria 1258
541 Ga0501040_0566873 3300049576 Unclassified 820
542 Ga0501040_0809631 3300049576 Unclassified 678
543 Ga0501041_0112806 3300049577 Bacteria 1687
544 Ga0501041_0350134 3300049577 Unclassified 933
545 Ga0501041_0403845 3300049577 Unclassified 866
546 Ga0501041_0532302 3300049577 Bacteria 748
547 Ga0501041_0860115 3300049577 Unclassified 582
548 Ga0501041_0946199 3300049577 Unclassified 554
549 Ga0501042_0202296 3300049578 Unclassified 1432
550 Ga0501042_0203405 3300049578 Unclassified 1428
551 Ga0501042_1162988 3300049578 Unclassified 562
552 Ga0501043_0524233 3300049579 Bacteria 883
553 Ga0501043_1289211 3300049579 Unclassified 510
554 Ga0501046_0178337 3300049580 Bacteria 1590
555 Ga0501047_0132272 3300049581 Bacteria 2375
556 Ga0501048_0078116 3300049582 Unclassified 2336
557 Ga0501048_0217975 3300049582 Bacteria 1353
558 Ga0501048_1269541 3300049582 Unclassified 529
559 Ga0501048_1306437 3300049582 Unclassified 521
560 Ga0501071_0005221 3300049587 Bacteria 8323
561 Ga0501071_0103922 3300049587 Bacteria 2096
562 Ga0501071_0209892 3300049587 Bacteria 1464
563 Ga0501071_0324673 3300049587 Bacteria 1169
564 Ga0501071_0437681 3300049587 Bacteria 1000
565 Ga0501072_0035092 3300049588 Bacteria 3931
566 Ga0501072_0078045 3300049588 Unclassified 2622
567 Ga0501072_0265365 3300049588 Bacteria 1366
568 Ga0501072_0522573 3300049588 Bacteria 938
569 Ga0501072_1416033 3300049588 Unclassified 537
570 Ga0501073_0063961 3300049589 Bacteria 2565
571 Ga0501074_0239503 3300049590 Unclassified 1291
572 Ga0501074_0338673 3300049590 Bacteria 1068
573 Ga0501075_0003459 3300049591 Bacteria 10558
574 Ga0501075_0118883 3300049591 Bacteria 2010
575 Ga0501075_0324913 3300049591 Bacteria 1172
576 Ga0501075_0371233 3300049591 Archaea 1090
577 Ga0501075_0415871 3300049591 Bacteria 1025
578 Ga0501075_0525242 3300049591 Unclassified 903
579 Ga0501076_0056120 3300049592 Bacteria 3125
580 Ga0501076_0067944 3300049592 Bacteria 2847
581 Ga0501076_0083616 3300049592 Unclassified 2563
582 Ga0501076_0185560 3300049592 Bacteria 1696
583 Ga0501076_0235735 3300049592 Bacteria 1496
584 Ga0501076_0248613 3300049592 Bacteria 1455
585 Ga0501076_1535958 3300049592 Unclassified 547
586 Ga0501077_0037163 3300049593 Bacteria 3103
587 Ga0501077_0193487 3300049593 Unclassified 1292
588 Ga0501202_077476 3300049652 Bacteria 776
589 Ga0501216_024097 3300049660 Bacteria 1086
590 Ga0501216_110283 3300049660 Unclassified 617
591 Ga0501217_051846 3300049661 Unclassified 1075
592 Ga0501233_198723 3300049668 Unclassified 582
593 Ga0501235_205519 3300049669 Unclassified 535
594 Ga0501079_0023969 3300049741 Bacteria 4681
595 Ga0501079_0070863 3300049741 Bacteria 2692
596 Ga0501079_0144156 3300049741 Bacteria 1856
597 Ga0501079_1288021 3300049741 Bacteria 575
598 Ga0501080_0121319 3300049742 Bacteria 2422
599 Ga0501080_0171503 3300049742 Bacteria 2001
600 Ga0501080_0243798 3300049742 Unclassified 1640
601 Ga0501080_0260602 3300049742 Bacteria 1580
602 Ga0501080_0282400 3300049742 Bacteria 1509
603 Ga0501080_0773117 3300049742 Bacteria 843
604 Ga0501080_1359650 3300049742 Unclassified 607
605 Ga0501080_1488013 3300049742 Bacteria 576
606 Ga0501080_1599938 3300049742 Unclassified 552
607 Ga0501081_0040751 3300049743 Bacteria 3180
608 Ga0501081_0059981 3300049743 Unclassified 2635
609 Ga0501081_0114096 3300049743 Bacteria 1919
610 Ga0501081_0250899 3300049743 Bacteria 1292
611 Ga0501081_0918585 3300049743 Unclassified 660
612 Ga0501083_0292888 3300049744 Bacteria 1059
613 Ga0501083_0808755 3300049744 Unclassified 610
614 Ga0501283_103434 3300049779 Bacteria 557
615 Ga0501035_0166347 3300049822 Unclassified 1907
616 Ga0501045_0013626 3300049824 Bacteria 5747
617 Ga0501045_0055148 3300049824 Bacteria 2907
618 Ga0501045_0382604 3300049824 Bacteria 1047
619 Ga0501045_0447390 3300049824 Unclassified 960
620 Ga0501045_0460502 3300049824 Unclassified 945
621 nmdc:mga00v17_484616_c1 3300050491 Bacteria 802
622 nmdc:mga0yw44_42785_c1 3300050492 Bacteria 2702
623 nmdc:mga0yw44_650693_c1 3300050492 Unclassified 716
624 nmdc:mga0k408_174929_c1 3300050493 Bacteria 1280
625 nmdc:mga0k408_3912_c1 3300050493 Bacteria 7895
626 nmdc:mga06z11_842876_c1 3300050494 Unclassified 559
627 nmdc:mga04h51_82662_c1 3300050495 Bacteria 1143
628 nmdc:mga05p37_1257818_c1 3300050507 Unclassified 759
629 nmdc:mga05p37_2141_c1 3300050507 Bacteria 21407
630 nmdc:mga05p37_2460_c1 3300050507 Bacteria 21542
631 nmdc:mga05p37_3085_c1 3300050507 Bacteria 19352
632 nmdc:mga05p37_358234_c1 3300050507 Unclassified 1716
633 nmdc:mga05p37_40156_c1 3300050507 Bacteria 5746
634 nmdc:mga05p37_513271_c1 3300050507 Bacteria 1373
635 nmdc:mga05p37_593114_c1 3300050507 Bacteria 1252
636 nmdc:mga05p37_781344_c1 3300050507 Unclassified 1048
637 nmdc:mga05p37_9_c1 3300050507 Bacteria 151480
638 nmdc:mga09592_10764_c1 3300050508 Bacteria 7437
639 nmdc:mga09592_1131946_c1 3300050508 Bacteria 649
640 nmdc:mga09592_273421_c1 3300050508 Bacteria 1465
641 nmdc:mga09592_710876_c1 3300050508 Bacteria 855
642 nmdc:mga09592_769226_c1 3300050508 Unclassified 816
643 nmdc:mga0qj67_166853_c1 3300050509 Bacteria 1788
644 nmdc:mga0qj67_243953_c1 3300050509 Bacteria 1457
645 nmdc:mga0qj67_280701_c1 3300050509 Bacteria 1350
646 nmdc:mga0qj67_324079_c1 3300050509 Bacteria 1247
647 nmdc:mga0qj67_57430_c1 3300050509 Bacteria 3085
648 nmdc:mga0qj67_60580_c1 3300050509 Bacteria 3004
649 nmdc:mga0qj67_976852_c1 3300050509 Bacteria 665
650 nmdc:mga06r32_10567_c1 3300050510 Bacteria 8323
651 nmdc:mga06r32_125330_c1 3300050510 Bacteria 2536
652 nmdc:mga06r32_140525_c1 3300050510 Bacteria 2391
653 nmdc:mga06r32_190978_c1 3300050510 Bacteria 2036
654 nmdc:mga06r32_1990441_c1 3300050510 Bacteria 515
655 nmdc:mga06r32_664696_c1 3300050510 Unclassified 1009
656 nmdc:mga06r32_71320_c1 3300050510 Bacteria 3361
657 nmdc:mga06r32_93935_c1 3300050510 Unclassified 2935
658 nmdc:mga08y16_190619_c1 3300050511 Bacteria 2126
659 nmdc:mga08y16_195458_c1 3300050511 Bacteria 2097
660 nmdc:mga08y16_2572_c1 3300050511 Bacteria 18660
661 nmdc:mga08y16_268996_c1 3300050511 Bacteria 1760
662 nmdc:mga08y16_366305_c1 3300050511 Unclassified 1479
663 nmdc:mga08y16_462455_c1 3300050511 Bacteria 1293
664 nmdc:mga08y16_85422_c1 3300050511 Bacteria 3289
665 nmdc:mga08y16_877379_c1 3300050511 Bacteria 885
666 nmdc:mga0n895_114838_c1 3300050512 Bacteria 2710
667 nmdc:mga0n895_160698_c1 3300050512 Bacteria 2278
668 nmdc:mga0n895_243122_c1 3300050512 Unclassified 1827
669 nmdc:mga0n895_362156_c1 3300050512 Bacteria 1468
670 nmdc:mga0n895_60857_c1 3300050512 Bacteria 3726
671 nmdc:mga0rr50_124739_c1 3300050513 Bacteria 2054
672 nmdc:mga0rr50_15205_c1 3300050513 Bacteria 5075
673 nmdc:mga0a205_111728_c1 3300050515 Bacteria 2632
674 nmdc:mga0a205_126724_c1 3300050515 Bacteria 2453
675 nmdc:mga0a205_204980_c1 3300050515 Bacteria 1861
676 nmdc:mga0a205_313014_c1 3300050515 Bacteria 1442
677 nmdc:mga0a205_331197_c1 3300050515 Bacteria 1392
678 nmdc:mga0a205_35164_c1 3300050515 Bacteria 4811
679 nmdc:mga0a205_40757_c1 3300050515 Unclassified 4471
680 Ga0501084_0003113 3300054114 Bacteria 13440
681 Ga0501084_0068487 3300054114 Bacteria 2971
682 Ga0501084_0396137 3300054114 Bacteria 1167
683 Ga0501084_0523131 3300054114 Bacteria 1003
684 Ga0501084_1091856 3300054114 Unclassified 670
685 Ga0501084_1438656 3300054114 Unclassified 577
686 Ga0590071_002585 3300059421 Bacteria 4552
687 Ga0590071_028522 3300059421 Bacteria 1326
688 Ga0590071_033925 3300059421 Unclassified 1220
689 Ga0590071_060535 3300059421 Unclassified 925
690 Ga0590074_034872 3300059423 Bacteria 895
691 Ga0590075_000152 3300059424 Bacteria 18638
692 Ga0590075_041781 3300059424 Bacteria 1172
693 Ga0590077_000386 3300059426 Bacteria 12394
694 Ga0590077_081182 3300059426 Unclassified 747
695 Ga0501082_0268475 3300060353 Bacteria 1485
696 Ga0501082_0339030 3300060353 Bacteria 1310
697 Ga0501082_0555851 3300060353 Bacteria 1004
698 Ga0501082_0998968 3300060353 Bacteria 732
699 Ga0501082_1519121 3300060353 Unclassified 585
700 Ga0530510_0006565 3300061734 Bacteria 8106
701 Ga0530510_0229517 3300061734 Bacteria 1381
702 Ga0530510_0336936 3300061734 Unclassified 1132
703 Ga0530510_0822538 3300061734 Unclassified 709
704 Ga0530510_0974644 3300061734 Unclassified 649
705 Ga0105249_11530845
706 MBSR1b_contig_5728622
707 JGI24034J26672_10062400
708 Ga0065704_10198105
709 Ga0065712_10086979
710 Ga0065712_10103510
711 Ga0065712_10173568
712 Ga0065712_10295085
713 Ga0065712_10573403
714 Ga0065712_10586940
715 Ga0065715_10004728
716 Ga0065715_10021825
717 Ga0065715_10137552
718 Ga0065715_10171753
719 Ga0065715_10201068
720 Ga0065715_10278084
721 Ga0065715_10304920
722 Ga0065715_10307205
723 Ga0065715_10380553
724 Ga0065715_10427648
725 Ga0065715_10575901
726 Ga0065707_10001845
727 Ga0065707_10221738
728 Ga0065707_10227048
729 Ga0070658_10344412
730 Ga0070676_10077594
731 Ga0070676_10100171
732 Ga0070676_10403476
733 Ga0070683_100002078
734 Ga0070683_100113950
735 Ga0070690_100078001
736 Ga0070690_100263421
737 Ga0070670_100010965
738 Ga0070670_100070482
739 Ga0070677_10086962
740 Ga0070677_10576990
741 Ga0070666_10117992
742 Ga0070666_10412975
743 Ga0070680_100648670
744 Ga0070682_100220582
745 Ga0070682_100609197
746 Ga0068868_100162724
747 Ga0068868_101846027
748 Ga0070660_100098864
749 Ga0070660_100099191
750 Ga0070660_100169126
751 Ga0070689_100007957
752 Ga0070689_100052500
753 Ga0070689_101909879
754 Ga0070691_10084191
755 Ga0070691_10300755
756 Ga0070687_100578128
757 Ga0070661_100058006
758 Ga0070661_100138419
759 Ga0070661_100495169
760 Ga0070668_100213249
761 Ga0070668_100698788
762 Ga0070668_101986298
763 Ga0070669_100001430
764 Ga0070669_100093036
765 Ga0070669_100147154
766 Ga0070669_100161051
767 Ga0070669_100427318
768 Ga0070669_101331238
769 Ga0070669_101907904
770 Ga0070675_100029844
771 Ga0070675_100367016
772 Ga0070675_101621388
773 Ga0070671_100026083
774 Ga0070671_100600877
775 Ga0070674_100035377
776 Ga0070674_100151796
777 Ga0070674_100213775
778 Ga0070674_100303695
779 Ga0070674_100579518
780 Ga0070674_100617490
781 Ga0070673_100100215
782 Ga0070673_100146229
783 Ga0070673_100209346
784 Ga0070673_100352019
785 Ga0070673_101610906
786 Ga0070688_101093869
787 Ga0070659_100050596
788 Ga0070659_100077793
789 Ga0070659_100094079
790 Ga0070659_100282995
791 Ga0070659_100427574
792 Ga0070659_100577400
793 Ga0070667_100424948
794 Ga0070667_101543112
795 Ga0070713_100040587
796 Ga0070701_10155243
797 Ga0070705_100005698
798 Ga0070700_100002855
799 Ga0070700_100521050
800 Ga0070700_100667489
801 Ga0070700_100804056
802 Ga0070700_101372459
803 Ga0070708_100349604
804 Ga0070663_100062097
805 Ga0070678_100556597
806 Ga0070678_101333499
807 Ga0070678_102051345
808 Ga0070662_100049815
809 Ga0070662_100480420
810 Ga0070662_100571004
811 Ga0070662_100628818
812 Ga0070681_10431414
813 Ga0070681_10469279
814 Ga0070681_10827704
815 Ga0070685_10351457
816 Ga0070706_100419211
817 Ga0070698_100507484
818 Ga0070698_101818603
819 Ga0070699_100053801
820 Ga0070679_101388977
821 Ga0070684_100000410
822 Ga0070684_100229727
823 Ga0068853_101472726
824 Ga0070672_100024760
825 Ga0070672_100086423
826 Ga0070672_101245479
827 Ga0070672_101401020
828 Ga0070695_100010754
829 Ga0070696_100232280
830 Ga0070696_100240998
831 Ga0070696_100731923
832 Ga0070693_100024152
833 Ga0070693_100024701
834 Ga0070693_100824418
835 Ga0070665_100693108
836 Ga0070665_101691536
837 Ga0070704_100243613
838 Ga0070664_100062200
839 Ga0070664_100128194
840 Ga0070664_100136784
841 Ga0070664_100192071
842 Ga0068857_100019720
843 Ga0068857_100038740
844 Ga0068857_101362761
845 Ga0068854_100024075
846 Ga0068854_100952767
847 Ga0068856_100154317
848 Ga0068856_100814694
849 Ga0070702_100099058
850 Ga0070702_100156340
851 Ga0070702_100742515
852 Ga0068852_100097414
853 Ga0068864_100291618
854 Ga0068861_100116765
855 Ga0068861_100316126
856 Ga0068851_10310466
857 Ga0068870_10190728
858 Ga0068863_100067233
859 Ga0068863_100476160
860 Ga0068858_101138267
861 Ga0068858_101886868
862 Ga0068860_101744118
863 Ga0068860_102108167
864 Ga0068860_102326549
865 Ga0068862_100112316
866 Ga0068862_100962819
867 Ga0068862_101027381
868 Ga0070717_10468944
869 Ga0075365_10008855
870 Ga0075365_10702770
871 Ga0075365_10750179
872 Ga0075368_10023333
873 Ga0075432_10254338
874 Ga0075367_10006485
875 Ga0075367_10353806
876 Ga0075366_10019381
877 Ga0075366_10426677
878 Ga0097621_100317620
879 Ga0075428_100018018
880 Ga0075428_100020894
881 Ga0075428_100030260
882 Ga0075428_100040829
883 Ga0075428_100078720
884 Ga0075428_101249061
885 Ga0075428_101553582
886 Ga0075430_100001210
887 Ga0075430_100022839
888 Ga0075430_100039460
889 Ga0075430_100149139
890 Ga0075430_100177530
891 Ga0075430_100215754
892 Ga0075430_100301972
893 Ga0075431_100014064
894 Ga0075431_100020689
895 Ga0075431_100048249
896 Ga0075431_100067158
897 Ga0075431_100067442
898 Ga0075431_100106980
899 Ga0075431_100151236
900 Ga0075431_100341738
901 Ga0075431_100370046
902 Ga0075431_102039037
903 Ga0075433_10007689
904 Ga0075433_10021426
905 Ga0075433_10087471
906 Ga0075433_10153575
907 Ga0075433_10189456
908 Ga0075434_100024029
909 Ga0075434_100043086
910 Ga0075434_100197002
911 Ga0075434_100201978
912 Ga0075434_100222681
913 Ga0075434_100958553
914 Ga0075429_100007738
915 Ga0075429_100132147
916 Ga0075429_100174378
917 Ga0075429_100191997
918 Ga0075429_100193944
919 Ga0075429_101030478
920 Ga0075429_101358391
921 Ga0075429_101722708
922 Ga0068865_100260439
923 Ga0068865_100551167
924 Ga0075435_100121106
925 Ga0075435_100124655
926 Ga0105240_10417622
927 Ga0105240_11191958
928 Ga0111539_10000434
929 Ga0111539_10000656
930 Ga0111539_10032109
931 Ga0111539_10049148
932 Ga0111539_10050973
933 Ga0111539_10179955
934 Ga0111539_10309297
935 Ga0111539_10466059
936 Ga0111539_10589091
937 Ga0111539_10994240
938 Ga0105245_10151585
939 Ga0105247_11435125
940 Ga0114129_10000313
941 Ga0114129_10003752
942 Ga0114129_10024306
943 Ga0114129_10024565
944 Ga0114129_10130207
945 Ga0114129_10138698
946 Ga0114129_10154957
947 Ga0114129_10287978
948 Ga0114129_10818296
949 Ga0114129_11192015
950 Ga0114129_11223222
951 Ga0105243_10345783
952 Ga0105243_10357909
953 Ga0105243_11565971
954 Ga0105241_10236508
955 Ga0105242_10208369
956 Ga0105248_10050565
957 Ga0105248_10052240
958 Ga0105248_11221635
959 Ga0105238_10690587
960 Ga0105249_10002582
961 Ga0105249_10362431
962 Ga0105249_10421844
963 Ga0105249_12381974
964 Ga0105239_10466256
965 Ga0105239_10630079
966 Ga0105239_11972838
967 Ga0105246_10127427
968 Ga0105246_10416689
969 Ga0105246_10450416
970 Ga0157373_11399710
971 Ga0157370_10124563
972 Ga0157374_10153567
973 Ga0157378_10461178
974 Ga0163162_10360157
975 Ga0163162_11263182
976 Ga0157372_10804547
977 Ga0157375_10135744
978 Ga0157375_10784088
979 Ga0157375_11001592
980 Ga0157375_12302023
981 Ga0163163_10006072
982 Ga0163163_10196299
983 Ga0157380_10040851
984 Ga0157380_10191708
985 Ga0157380_10492832
986 Ga0157380_11069347
987 Ga0157380_11182306
988 Ga0157380_13043052
989 Ga0157377_10092757
990 Ga0157379_11074439
991 Ga0157379_11663499
992 Ga0157376_10513496
993 Ga0163161_10622158
994 Ga0213876_10113104
995 Ga0207673_1046539
996 Ga0207697_10000452
997 Ga0207642_10331091
998 Ga0207688_10008316
999 Ga0207688_10197770
1000 Ga0207647_10630259
1001 Ga0207645_10597999
1002 Ga0207705_10334210
1003 Ga0207684_10349005
1004 Ga0207707_10228829
1005 Ga0207707_10317066
1006 Ga0207695_11056736
1007 Ga0207660_10252707
1008 Ga0207660_10434852
1009 Ga0207662_10002564
1010 Ga0207662_10562382
1011 Ga0207657_10284255
1012 Ga0207657_10325512
1013 Ga0207649_10165667
1014 Ga0207649_10929513
1015 Ga0207652_10103381
1016 Ga0207681_10017662
1017 Ga0207681_10133479
1018 Ga0207681_10142365
1019 Ga0207650_10010113
1020 Ga0207650_10037851
1021 Ga0207659_10019102
1022 Ga0207659_11210483
1023 Ga0207700_10012334
1024 Ga0207664_10875833
1025 Ga0207644_10181253
1026 Ga0207690_10377686
1027 Ga0207690_10581137
1028 Ga0207706_10453597
1029 Ga0207706_10512698
1030 Ga0207686_10125947
1031 Ga0207709_10051326
1032 Ga0207669_11259532
1033 Ga0207669_11322621
1034 Ga0207669_11469633
1035 Ga0207704_10243270
1036 Ga0207691_10026358
1037 Ga0207691_10164424
1038 Ga0207691_10205545
1039 Ga0207691_10915580
1040 Ga0207711_10005504
1041 Ga0207689_10153475
1042 Ga0207661_10053550
1043 Ga0207661_10231555
1044 Ga0207679_10043674
1045 Ga0207679_10070262
1046 Ga0207679_10299072
1047 Ga0207651_10005415
1048 Ga0207651_10225833
1049 Ga0207651_11196834
1050 Ga0207712_10063625
1051 Ga0207712_10156812
1052 Ga0207712_10345017
1053 Ga0207668_10652382
1054 Ga0207668_11218305
1055 Ga0207640_11858496
1056 Ga0207658_11893941
1057 Ga0207677_10100958
1058 Ga0207703_10329862
1059 Ga0207639_10382728
1060 Ga0207678_10046568
1061 Ga0207678_11390488
1062 Ga0207678_11404532
1063 Ga0207708_10000847
1064 Ga0207708_11164808
1065 Ga0207708_11391081
1066 Ga0207702_11302142
1067 Ga0207641_10245445
1068 Ga0207641_10408755
1069 Ga0207641_11225974
1070 Ga0207648_10008769
1071 Ga0207676_10267719
1072 Ga0207674_10024860
1073 Ga0207674_10051429
1074 Ga0207674_11172179
1075 Ga0207675_100007516
1076 Ga0207683_10025142
1077 Ga0207683_10026635
1078 Ga0207683_10323015
1079 Ga0207698_10420083
1080 Ga0207698_11244479
1081 Ga0210002_1041591
1082 Ga0209813_10069367
1083 Ga0207428_10003733
1084 Ga0207428_10016933
1085 Ga0207428_10072065
1086 Ga0207428_10131882
1087 Ga0207428_10462077
1088 Ga0268266_10472971
1089 Ga0268266_11092692
1090 Ga0268265_10143540
1091 Ga0268265_10230604
1092 Ga0268265_10424779
1093 Ga0268265_11027825
1094 Ga0268264_11879227
1095 Ga0268264_12650657
1096 Ga0316182_1123610
1097 Ga0265332_10027285
1098 Ga0265320_10043033
1099 Ga0307408_100014810
1100 Ga0307408_100171835
1101 Ga0307408_100259842
1102 Ga0307408_100987205
1103 Ga0265314_10043946
1104 Ga0316576_10844847
1105 Ga0307405_10127599
1106 Ga0307405_10237293
1107 Ga0307405_10775301
1108 Ga0307405_10949102
1109 Ga0307413_10139527
1110 Ga0307413_10508494
1111 Ga0307413_10583609
1112 Ga0307410_10850255
1113 Ga0307406_10146027
1114 Ga0307406_10279921
1115 Ga0307407_10227470
1116 Ga0307407_11403244
1117 Ga0307412_10031508
1118 Ga0307412_10744036
1119 Ga0307412_10751455
1120 Ga0307412_11024401
1121 Ga0307412_11458731
1122 Ga0307409_100075728
1123 Ga0307409_100105110
1124 Ga0307409_100124688
1125 Ga0307409_100480582
1126 Ga0307409_100488699
1127 Ga0307409_100755921
1128 Ga0307416_100039491
1129 Ga0307416_100132932
1130 Ga0307416_100296750
1131 Ga0307416_100574789
1132 Ga0307416_100942247
1133 Ga0307416_101132580
1134 Ga0307416_101252933
1135 Ga0307416_101559803
1136 Ga0307416_102586420
1137 Ga0307416_102848347
1138 Ga0307416_103720495
1139 Ga0307411_10122021
1140 Ga0307411_10135349
1141 Ga0307411_10183271
1142 Ga0307411_10242837
1143 Ga0307411_10298390
1144 Ga0307411_10500072
1145 Ga0307411_11539246
1146 Ga0307415_100020005
1147 Ga0307415_100458440
1148 Ga0373959_0097380
1149 Ga0373926_0194420
1150 Ga0373944_0145959
1151 Ga0373923_0224550
1152 Ga0373943_0055931
1153 Ga0373946_0403547
1154 Ga0373955_0266049
1155 Ga0373927_0563094
1156 Ga0373947_0014683
1157 Ga0373947_0616398
1158 Ga0373937_0430135
1159 Ga0373937_1784423
1160 Ga0373925_1047206
1161 Ga0436365_1794937
1162 Ga0439436_0215284
1163 Ga0439453_0007070
1164 Ga0439461_0130065
1165 Ga0451853_2543361
1166 Ga0439433_0010692
1167 Ga0439445_0044146
1168 Ga0439449_0068350
1169 Ga0439449_0133055
1170 Ga0439450_053140
1171 Ga0439451_082025
1172 Ga0439462_0038317
1173 Ga0450915_015299
1174 Ga0450891_022995
1175 Ga0450889_015673
1176 Ga0439446_0006017
1177 Ga0439446_0269852
1178 Ga0439434_0031728
1179 Ga0439434_0110588
1180 Ga0439435_0020027
1181 Ga0439435_0120170
1182 Ga0439435_0144943
1183 Ga0439464_0001620
1184 Ga0439460_0067027
1185 Ga0453684_0564701
1186 Ga0466967_1999011
1187 Ga0495629_0206062
1188 Ga0495653_0022197
1189 Ga0495594_0332104
1190 Ga0495633_0573457
1191 Ga0495647_0366044
1192 Ga0495669_0196493
1193 Ga0495649_0524324
1194 Ga0495600_0445923
1195 Ga0496100_1299322
1196 Ga0496101_0075840
1197 Ga0496101_0719534
1198 Ga0496102_0003103
1199 Ga0496103_0173540
1200 Ga0496103_0188571
1201 Ga0496105_0079603
1202 Ga0496106_0102233
1203 Ga0496106_0622076
1204 Ga0496106_0728062
1205 Ga0496106_1259251
1206 Ga0496107_0788069
1207 Ga0496107_0838352
1208 Ga0496107_0902688
1209 Ga0496108_1103654
1210 Ga0496108_1254969
1211 Ga0496109_0001791
1212 Ga0496109_0519873
1213 Ga0496109_0575506
1214 Ga0496109_0578003
1215 Ga0496109_1070618
1216 Ga0496110_0002233
1217 Ga0496110_0143395
1218 Ga0496111_0089374
1219 Ga0496112_0053611
1220 Ga0496112_0578866
1221 Ga0496112_0692421
1222 Ga0496113_0135227
1223 Ga0501297_011788
1224 Ga0501299_017261
1225 Ga0501303_023090
1226 Ga0501031_0076841
1227 Ga0501031_0084172
1228 Ga0501036_0006521
1229 Ga0501036_0153813
1230 Ga0501036_0248131
1231 Ga0501036_0427461
1232 Ga0501037_0521602
1233 Ga0501037_0890482
1234 Ga0501038_0490993
1235 Ga0501038_0565431
1236 Ga0501038_0775598
1237 Ga0501038_0868940
1238 Ga0501038_1372973
1239 Ga0501039_0054547
1240 Ga0501039_0175423
1241 Ga0501039_0387656
1242 Ga0501040_0026847
1243 Ga0501040_0071877
1244 Ga0501040_0252490
1245 Ga0501040_0566873
1246 Ga0501040_0809631
1247 Ga0501041_0112806
1248 Ga0501041_0350134
1249 Ga0501041_0403845
1250 Ga0501041_0532302
1251 Ga0501041_0860115
1252 Ga0501041_0946199
1253 Ga0501042_0202296
1254 Ga0501042_0203405
1255 Ga0501042_1162988
1256 Ga0501043_0524233
1257 Ga0501043_1289211
1258 Ga0501046_0178337
1259 Ga0501047_0132272
1260 Ga0501048_0078116
1261 Ga0501048_0217975
1262 Ga0501048_1269541
1263 Ga0501048_1306437
1264 Ga0501071_0005221
1265 Ga0501071_0103922
1266 Ga0501071_0209892
1267 Ga0501071_0324673
1268 Ga0501071_0437681
1269 Ga0501072_0035092
1270 Ga0501072_0078045
1271 Ga0501072_0265365
1272 Ga0501072_0522573
1273 Ga0501072_1416033
1274 Ga0501073_0063961
1275 Ga0501074_0239503
1276 Ga0501074_0338673
1277 Ga0501075_0003459
1278 Ga0501075_0118883
1279 Ga0501075_0324913
1280 Ga0501075_0371233
1281 Ga0501075_0415871
1282 Ga0501075_0525242
1283 Ga0501076_0056120
1284 Ga0501076_0067944
1285 Ga0501076_0083616
1286 Ga0501076_0185560
1287 Ga0501076_0235735
1288 Ga0501076_0248613
1289 Ga0501076_1535958
1290 Ga0501077_0037163
1291 Ga0501077_0193487
1292 Ga0501202_077476
1293 Ga0501216_024097
1294 Ga0501216_110283
1295 Ga0501217_051846
1296 Ga0501233_198723
1297 Ga0501235_205519
1298 Ga0501079_0023969
1299 Ga0501079_0070863
1300 Ga0501079_0144156
1301 Ga0501079_1288021
1302 Ga0501080_0121319
1303 Ga0501080_0171503
1304 Ga0501080_0243798
1305 Ga0501080_0260602
1306 Ga0501080_0282400
1307 Ga0501080_0773117
1308 Ga0501080_1359650
1309 Ga0501080_1488013
1310 Ga0501080_1599938
1311 Ga0501081_0040751
1312 Ga0501081_0059981
1313 Ga0501081_0114096
1314 Ga0501081_0250899
1315 Ga0501081_0918585
1316 Ga0501083_0292888
1317 Ga0501083_0808755
1318 Ga0501283_103434
1319 Ga0501035_0166347
1320 Ga0501045_0013626
1321 Ga0501045_0055148
1322 Ga0501045_0382604
1323 Ga0501045_0447390
1324 Ga0501045_0460502
1325 nmdc:mga00v17_484616_c1
1326 nmdc:mga0yw44_42785_c1
1327 nmdc:mga0yw44_650693_c1
1328 nmdc:mga0k408_174929_c1
1329 nmdc:mga0k408_3912_c1
1330 nmdc:mga06z11_842876_c1
1331 nmdc:mga04h51_82662_c1
1332 nmdc:mga05p37_1257818_c1
1333 nmdc:mga05p37_2141_c1
1334 nmdc:mga05p37_2460_c1
1335 nmdc:mga05p37_3085_c1
1336 nmdc:mga05p37_358234_c1
1337 nmdc:mga05p37_40156_c1
1338 nmdc:mga05p37_513271_c1
1339 nmdc:mga05p37_593114_c1
1340 nmdc:mga05p37_781344_c1
1341 nmdc:mga05p37_9_c1
1342 nmdc:mga09592_10764_c1
1343 nmdc:mga09592_1131946_c1
1344 nmdc:mga09592_273421_c1
1345 nmdc:mga09592_710876_c1
1346 nmdc:mga09592_769226_c1
1347 nmdc:mga0qj67_166853_c1
1348 nmdc:mga0qj67_243953_c1
1349 nmdc:mga0qj67_280701_c1
1350 nmdc:mga0qj67_324079_c1
1351 nmdc:mga0qj67_57430_c1
1352 nmdc:mga0qj67_60580_c1
1353 nmdc:mga0qj67_976852_c1
1354 nmdc:mga06r32_10567_c1
1355 nmdc:mga06r32_125330_c1
1356 nmdc:mga06r32_140525_c1
1357 nmdc:mga06r32_190978_c1
1358 nmdc:mga06r32_1990441_c1
1359 nmdc:mga06r32_664696_c1
1360 nmdc:mga06r32_71320_c1
1361 nmdc:mga06r32_93935_c1
1362 nmdc:mga08y16_190619_c1
1363 nmdc:mga08y16_195458_c1
1364 nmdc:mga08y16_2572_c1
1365 nmdc:mga08y16_268996_c1
1366 nmdc:mga08y16_366305_c1
1367 nmdc:mga08y16_462455_c1
1368 nmdc:mga08y16_85422_c1
1369 nmdc:mga08y16_877379_c1
1370 nmdc:mga0n895_114838_c1
1371 nmdc:mga0n895_160698_c1
1372 nmdc:mga0n895_243122_c1
1373 nmdc:mga0n895_362156_c1
1374 nmdc:mga0n895_60857_c1
1375 nmdc:mga0rr50_124739_c1
1376 nmdc:mga0rr50_15205_c1
1377 nmdc:mga0a205_111728_c1
1378 nmdc:mga0a205_126724_c1
1379 nmdc:mga0a205_204980_c1
1380 nmdc:mga0a205_313014_c1
1381 nmdc:mga0a205_331197_c1
1382 nmdc:mga0a205_35164_c1
1383 nmdc:mga0a205_40757_c1
1384 Ga0501084_0003113
1385 Ga0501084_0068487
1386 Ga0501084_0396137
1387 Ga0501084_0523131
1388 Ga0501084_1091856
1389 Ga0501084_1438656
1390 Ga0590071_002585
1391 Ga0590071_028522
1392 Ga0590071_033925
1393 Ga0590071_060535
1394 Ga0590074_034872
1395 Ga0590075_000152
1396 Ga0590075_041781
1397 Ga0590077_000386
1398 Ga0590077_081182
1399 Ga0501082_0268475
1400 Ga0501082_0339030
1401 Ga0501082_0555851
1402 Ga0501082_0998968
1403 Ga0501082_1519121
1404 Ga0530510_0006565
1405 Ga0530510_0229517
1406 Ga0530510_0336936
1407 Ga0530510_0822538
1408 Ga0530510_0974644

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fve-assembly1.cif.gz_A crystal structure of diaminopimelate epimerase mycobacterium tuberculosis dapf 0.8281 64 89
3akn-assembly1.cif.gz_A x-ray structure of ifabp from human and rat with bound fluorescent fatty acid analogue 0.8225 64 88
6ew5-assembly4.cif.gz_D human myelin protein p2 f57a mutant, monoclinic crystal form 0.8179 64 88
5n4m-assembly1.cif.gz_A human myelin protein p2, mutant i43n 0.8129 64 88
6xwu-assembly1.cif.gz_A-2 crystal structure of drosophila melanogaster cenp-c cumin domain 0.8126 2 21
ID Description Score Start End Superfamily
1ifcA00 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.8039 64 88 2.40.128.20
3pp6A00 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.7922 64 88 2.40.128.20
4lktA00 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.786 64 88 2.40.128.20
af_Q61727_128_238_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7807 2 20 2.60.40.10
1o8vA00 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.7797 64 88 2.40.128.20
ID Description Score Start End GO Terms
AF-A0A2V8FJC7-F1-model_v4 Uncharacterized protein 0.972 1 114
AF-A0A382MWZ6-F1-model_v4 Uncharacterized protein 0.97 1 108
AF-A0A7W1DPB9-F1-model_v4 DUF3194 domain-containing protein 0.9651 1 117
AF-A0A2V8I7N1-F1-model_v4 Uncharacterized protein 0.9621 1 109
AF-A0A7W1DPB9-F1-model_v4 DUF3194 domain-containing protein 0.957 1 117

Map