F476307

General Info

Members Datasets Scaffolds Average Seq Length
703 311 1406 350

Family's Representative Sequence

Representative Sequence 3300046537|Ga0495598_0034903|Ga0495598_0034903_23_1291
Length 415
Sequence LIVSAENREQLERWSRRTTSAQALALRSKIILGCAEGADNITVASGLGVTSITVGKWRRRFVEKGLDGLVDEARPGGPRSVSDEQVEQVVVETLERTPRDATHWSRSAMAAQTGLSKSTVGRIWRAFGLKPHLVDTFKLSSDPLFIEKVRDVVGLYVNPPERAVVLCVDEKSGIQALNRSSPLLPMMPGTLERRTFDYARAGTTDLFAALDVATGLVIHSIQRRHRAAEFKRFLSQIDQSVPAELDVHLICDNLSTHKTPAIGTWLAAHPRFHLHFLNQVERWFGLLTDRQIRRGVHDSIAALERDIESWIKQWNADPKPFVWTKTADEILGRLARYLQRIPGAGHQWTASEVLLRLAFLRISSGVLVHTKGWQRSFQPLMKARILIIRSRTEGKVPRWMAWRSMMPNQTSTKFS

Samples

Sample ID Description Type Environment
1 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
38 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
41 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
46 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
53 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
54 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
55 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
61 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
62 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
63 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
77 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
83 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
84 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
85 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
86 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
90 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
91 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
92 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
93 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
94 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
96 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
97 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
98 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
99 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
100 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
102 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
103 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
104 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
105 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
106 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
107 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
108 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
109 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
110 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
119 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
120 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
121 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
122 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
123 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
124 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
125 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
126 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
127 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
128 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
129 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
197 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
198 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
199 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
200 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
201 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
202 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
203 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
204 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
205 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
206 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
207 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
208 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
209 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
210 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
211 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
212 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
213 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
214 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
215 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
216 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
217 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
218 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
219 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
220 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
221 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
222 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
223 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
224 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
225 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
226 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
227 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
228 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
229 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
230 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
231 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
232 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
233 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
234 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
235 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
236 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
237 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
238 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
239 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
240 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
241 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
242 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
243 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
244 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
245 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
246 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
247 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
248 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
249 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
250 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
251 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
252 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
253 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
254 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
255 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
256 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
257 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
258 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
259 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
260 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
261 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
262 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
263 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
264 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
265 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
266 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
267 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
268 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
269 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
270 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
271 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
272 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
273 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
274 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
275 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
276 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
277 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
278 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
279 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
287 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
288 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
289 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
290 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
291 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
292 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
293 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
294 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
295 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
296 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
297 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
298 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
299 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
300 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
301 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
302 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
303 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
304 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
305 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
306 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
307 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
308 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
309 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
310 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
311 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.86
Metatranscriptomes 0
Isolates 0.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.43
Nodule 0
Rhizoplane 6.4
Rhizosphere 92.03
Stem 0
Stem Tuber 0
Unclassified 1.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495598_0034903 3300046537 Bacteria 1437
2 JGI24739J22299_10058866 3300001989 Bacteria 1218
3 JGI24735J21928_10047576 3300002067 Bacteria 1243
4 JGI24738J21930_10026968 3300002075 Bacteria 1177
5 JGI24749J21850_1011577 3300002076 Bacteria 1238
6 JGI24744J21845_10012706 3300002077 Bacteria 1703
7 JGI24744J21845_10025159 3300002077 Bacteria 1161
8 JGI24034J26672_10016608 3300002239 Bacteria 1135
9 rootL2_10276227 3300003322 Bacteria 2877
10 JGI25405J52794_10016556 3300003911 Bacteria 1458
11 Ga0065715_10135057 3300005293 Bacteria 1944
12 Ga0065707_10205910 3300005295 Bacteria 1288
13 Ga0065707_10227940 3300005295 Bacteria 1199
14 Ga0070676_10010447 3300005328 Bacteria 5038
15 Ga0070676_10162219 3300005328 Bacteria 1439
16 Ga0070683_100407497 3300005329 Bacteria 1297
17 Ga0070690_100162067 3300005330 Bacteria 1533
18 Ga0070690_100173728 3300005330 Bacteria 1484
19 Ga0070690_100228759 3300005330 Bacteria 1306
20 Ga0070670_100214076 3300005331 Bacteria 1676
21 Ga0070670_100216556 3300005331 Bacteria 1666
22 Ga0070677_10061106 3300005333 Bacteria 1554
23 Ga0068869_100333178 3300005334 Bacteria 1233
24 Ga0070666_10201730 3300005335 Bacteria 1399
25 Ga0070680_100032714 3300005336 Bacteria 4186
26 Ga0070680_100097718 3300005336 Bacteria 2435
27 Ga0070682_100011649 3300005337 Bacteria 5029
28 Ga0070682_100033763 3300005337 Bacteria 3111
29 Ga0070682_100096867 3300005337 Bacteria 1940
30 Ga0070682_100184561 3300005337 Bacteria 1460
31 Ga0068868_100039734 3300005338 Bacteria 3658
32 Ga0068868_100057673 3300005338 Bacteria 3068
33 Ga0068868_100291094 3300005338 Bacteria 1385
34 Ga0068868_100315630 3300005338 Bacteria 1330
35 Ga0070660_100088444 3300005339 Bacteria 2439
36 Ga0070689_100063914 3300005340 Bacteria 2864
37 Ga0070689_100190514 3300005340 Bacteria 1670
38 Ga0070689_100404578 3300005340 Bacteria 1154
39 Ga0070691_10085045 3300005341 Bacteria 1553
40 Ga0070687_100018837 3300005343 Bacteria 3201
41 Ga0070687_100203133 3300005343 Bacteria 1202
42 Ga0070661_100209161 3300005344 Bacteria 1493
43 Ga0070692_10005292 3300005345 Bacteria 5482
44 Ga0070668_100035459 3300005347 Bacteria 3803
45 Ga0070668_100264847 3300005347 Bacteria 1430
46 Ga0070669_100175670 3300005353 Bacteria 1672
47 Ga0070669_100237229 3300005353 Bacteria 1447
48 Ga0070675_100219741 3300005354 Bacteria 1654
49 Ga0070675_100354328 3300005354 Bacteria 1302
50 Ga0070671_100033804 3300005355 Bacteria 4231
51 Ga0070671_100269287 3300005355 Bacteria 1448
52 Ga0070671_100311300 3300005355 Bacteria 1341
53 Ga0070674_100138037 3300005356 Bacteria 1826
54 Ga0070674_100149368 3300005356 Bacteria 1762
55 Ga0070674_100319763 3300005356 Bacteria 1244
56 Ga0070673_100170457 3300005364 Bacteria 1857
57 Ga0070673_100177935 3300005364 Bacteria 1819
58 Ga0070688_100094045 3300005365 Bacteria 1964
59 Ga0070688_100166560 3300005365 Bacteria 1517
60 Ga0070688_100174715 3300005365 Bacteria 1485
61 Ga0070688_100232224 3300005365 Bacteria 1305
62 Ga0070659_100039616 3300005366 Bacteria 3679
63 Ga0070659_100316255 3300005366 Bacteria 1304
64 Ga0070667_100059238 3300005367 Bacteria 3239
65 Ga0070703_10028674 3300005406 Bacteria 1666
66 Ga0070709_10022063 3300005434 Bacteria 3719
67 Ga0070709_10040773 3300005434 Bacteria 2856
68 Ga0070713_100154359 3300005436 Bacteria 2045
69 Ga0070713_100383565 3300005436 Bacteria 1310
70 Ga0070710_10024533 3300005437 Bacteria 3182
71 Ga0070710_10137450 3300005437 Bacteria 1495
72 Ga0070701_10023068 3300005438 Bacteria 2992
73 Ga0070701_10066585 3300005438 Bacteria 1915
74 Ga0070711_100074529 3300005439 Bacteria 2400
75 Ga0070705_100045621 3300005440 Bacteria 2522
76 Ga0070705_100168003 3300005440 Bacteria 1473
77 Ga0070700_100120440 3300005441 Bacteria 1757
78 Ga0070694_100156730 3300005444 Bacteria 1667
79 Ga0070694_100161692 3300005444 Bacteria 1643
80 Ga0070694_100180159 3300005444 Bacteria 1562
81 Ga0070694_100282785 3300005444 Bacteria 1265
82 Ga0070708_100394999 3300005445 Bacteria 1304
83 Ga0070708_100404054 3300005445 Bacteria 1288
84 Ga0070663_100091727 3300005455 Bacteria 2251
85 Ga0070663_100111689 3300005455 Bacteria 2054
86 Ga0070678_100005208 3300005456 Bacteria 7481
87 Ga0070678_100074284 3300005456 Bacteria 2554
88 Ga0070678_100139511 3300005456 Bacteria 1938
89 Ga0070678_100216045 3300005456 Bacteria 1591
90 Ga0070678_100225695 3300005456 Bacteria 1559
91 Ga0070678_100329865 3300005456 Bacteria 1305
92 Ga0070678_100347313 3300005456 Bacteria 1275
93 Ga0070662_100048261 3300005457 Bacteria 3067
94 Ga0070662_100074335 3300005457 Bacteria 2514
95 Ga0070662_100180311 3300005457 Bacteria 1664
96 Ga0070681_10151986 3300005458 Bacteria 2241
97 Ga0070681_10156452 3300005458 Bacteria 2204
98 Ga0068867_100306274 3300005459 Bacteria 1311
99 Ga0068867_100328741 3300005459 Bacteria 1269
100 Ga0070685_10016219 3300005466 Bacteria 3967
101 Ga0070685_10102784 3300005466 Bacteria 1747
102 Ga0070685_10161144 3300005466 Bacteria 1430
103 Ga0070706_100376125 3300005467 Bacteria 1323
104 Ga0070707_100401780 3300005468 Bacteria 1330
105 Ga0070707_100427968 3300005468 Bacteria 1284
106 Ga0070707_100484124 3300005468 Bacteria 1199
107 Ga0070698_100154947 3300005471 Bacteria 2237
108 Ga0070679_100239436 3300005530 Bacteria 1772
109 Ga0070679_100286646 3300005530 Bacteria 1598
110 Ga0070679_100376381 3300005530 Bacteria 1367
111 Ga0070684_100196996 3300005535 Bacteria 1834
112 Ga0070697_100173880 3300005536 Bacteria 1824
113 Ga0070697_100386496 3300005536 Bacteria 1213
114 Ga0070672_100050954 3300005543 Bacteria 3227
115 Ga0070672_100104302 3300005543 Bacteria 2304
116 Ga0070672_100142147 3300005543 Bacteria 1980
117 Ga0070672_100180003 3300005543 Bacteria 1761
118 Ga0070686_100121837 3300005544 Bacteria 1792
119 Ga0070686_100146977 3300005544 Bacteria 1647
120 Ga0070686_100173203 3300005544 Bacteria 1528
121 Ga0070686_100194449 3300005544 Bacteria 1450
122 Ga0070695_100248464 3300005545 Bacteria 1294
123 Ga0070696_100175403 3300005546 Bacteria 1587
124 Ga0070693_100023017 3300005547 Bacteria 3323
125 Ga0070693_100080131 3300005547 Bacteria 1945
126 Ga0070693_100141359 3300005547 Bacteria 1516
127 Ga0070665_100112729 3300005548 Bacteria 2722
128 Ga0070665_100172119 3300005548 Bacteria 2166
129 Ga0070665_100255162 3300005548 Bacteria 1754
130 Ga0070665_100396067 3300005548 Bacteria 1389
131 Ga0070665_100405470 3300005548 Bacteria 1371
132 Ga0070704_100332690 3300005549 Bacteria 1276
133 Ga0070704_100345989 3300005549 Bacteria 1253
134 Ga0068855_100005073 3300005563 Bacteria 16057
135 Ga0068855_100093992 3300005563 Bacteria 3457
136 Ga0068855_100158266 3300005563 Bacteria 2572
137 Ga0068855_100373908 3300005563 Bacteria 1566
138 Ga0068855_100423159 3300005563 Bacteria 1456
139 Ga0068857_100320860 3300005577 Bacteria 1430
140 Ga0068854_100063358 3300005578 Bacteria 2683
141 Ga0068854_100122510 3300005578 Bacteria 1976
142 Ga0068854_100228531 3300005578 Bacteria 1476
143 Ga0068854_100236206 3300005578 Bacteria 1453
144 Ga0068856_100234487 3300005614 Bacteria 1850
145 Ga0068856_100445474 3300005614 Bacteria 1316
146 Ga0070702_100153327 3300005615 Bacteria 1481
147 Ga0070702_100156718 3300005615 Bacteria 1467
148 Ga0068852_100027326 3300005616 Bacteria 4650
149 Ga0068852_100234458 3300005616 Bacteria 1751
150 Ga0068852_100244139 3300005616 Bacteria 1718
151 Ga0068852_100305933 3300005616 Bacteria 1540
152 Ga0068859_100485522 3300005617 Bacteria 1331
153 Ga0068859_100541488 3300005617 Unclassified 1259
154 Ga0068864_100060520 3300005618 Bacteria 3278
155 Ga0068864_100148623 3300005618 Bacteria 2120
156 Ga0068864_100244734 3300005618 Bacteria 1663
157 Ga0068864_100408544 3300005618 Bacteria 1291
158 Ga0068864_100437101 3300005618 Unclassified 1249
159 Ga0068866_10060396 3300005718 Bacteria 1965
160 Ga0068866_10070785 3300005718 Bacteria 1842
161 Ga0068861_100077119 3300005719 Bacteria 2599
162 Ga0068861_100159282 3300005719 Bacteria 1860
163 Ga0068861_100159789 3300005719 Bacteria 1858
164 Ga0068861_100183775 3300005719 Bacteria 1742
165 Ga0068861_100395256 3300005719 Bacteria 1225
166 Ga0068851_10110366 3300005834 Bacteria 1467
167 Ga0068870_10146695 3300005840 Bacteria 1386
168 Ga0068870_10190799 3300005840 Unclassified 1236
169 Ga0068870_10191576 3300005840 Bacteria 1234
170 Ga0068863_100096312 3300005841 Bacteria 2809
171 Ga0068863_100106983 3300005841 Bacteria 2661
172 Ga0068863_100234973 3300005841 Bacteria 1769
173 Ga0068863_100381685 3300005841 Bacteria 1376
174 Ga0068858_100005735 3300005842 Bacteria 12134
175 Ga0068858_100093236 3300005842 Bacteria 2803
176 Ga0068858_100162231 3300005842 Bacteria 2105
177 Ga0068860_100038528 3300005843 Bacteria 4573
178 Ga0068860_100063074 3300005843 Bacteria 3520
179 Ga0068862_100177823 3300005844 Bacteria 1908
180 Ga0068862_100250006 3300005844 Bacteria 1615
181 Ga0068862_100263006 3300005844 Bacteria 1575
182 Ga0068862_100365747 3300005844 Bacteria 1341
183 Ga0081455_10066538 3300005937 Bacteria 3009
184 Ga0081455_10071257 3300005937 Bacteria 2882
185 Ga0081455_10139106 3300005937 Bacteria 1888
186 Ga0081540_1024082 3300005983 Bacteria 3542
187 Ga0081540_1060435 3300005983 Bacteria 1812
188 Ga0081539_10010464 3300005985 Bacteria 7529
189 Ga0070715_10059987 3300006163 Bacteria 1666
190 Ga0070715_10110719 3300006163 Bacteria 1295
191 Ga0070715_10112651 3300006163 Bacteria 1286
192 Ga0070716_100012087 3300006173 Bacteria 4365
193 Ga0070716_100227325 3300006173 Bacteria 1257
194 Ga0097621_100065385 3300006237 Bacteria 2993
195 Ga0097621_100092611 3300006237 Bacteria 2532
196 Ga0097621_100264150 3300006237 Bacteria 1511
197 Ga0068871_100208065 3300006358 Bacteria 1691
198 Ga0068871_100213026 3300006358 Bacteria 1671
199 Ga0068871_100262630 3300006358 Bacteria 1506
200 Ga0075430_100048238 3300006846 Bacteria 3595
201 Ga0075430_100339210 3300006846 Bacteria 1241
202 Ga0075431_100390919 3300006847 Bacteria 1393
203 Ga0075431_100415730 3300006847 Bacteria 1344
204 Ga0075434_100334802 3300006871 Bacteria 1534
205 Ga0075429_100079756 3300006880 Bacteria 2853
206 Ga0075429_100238975 3300006880 Bacteria 1591
207 Ga0068865_100013298 3300006881 Bacteria 5200
208 Ga0068865_100100945 3300006881 Bacteria 2112
209 Ga0068865_100157345 3300006881 Bacteria 1730
210 Ga0068865_100243676 3300006881 Bacteria 1415
211 Ga0097620_100485538 3300006931 Bacteria 1331
212 Ga0097620_100541470 3300006931 Unclassified 1259
213 Ga0075435_100390253 3300007076 Bacteria 1196
214 Ga0105244_10128110 3300009036 Bacteria 1226
215 Ga0105250_10008557 3300009092 Bacteria 4339
216 Ga0105250_10029726 3300009092 Bacteria 2198
217 Ga0105245_10173514 3300009098 Bacteria 2055
218 Ga0105245_10290447 3300009098 Bacteria 1601
219 Ga0105245_10419681 3300009098 Bacteria 1341
220 Ga0105247_10075635 3300009101 Bacteria 2114
221 Ga0105247_10148693 3300009101 Bacteria 1542
222 Ga0105247_10153981 3300009101 Bacteria 1517
223 Ga0105247_10204709 3300009101 Bacteria 1328
224 Ga0105247_10220766 3300009101 Bacteria 1283
225 Ga0114129_10178659 3300009147 Bacteria 2890
226 Ga0114129_10523454 3300009147 Bacteria 1546
227 Ga0105243_10059464 3300009148 Bacteria 3050
228 Ga0105243_10271319 3300009148 Bacteria 1523
229 Ga0105243_10403478 3300009148 Bacteria 1271
230 Ga0105243_10406606 3300009148 Bacteria 1266
231 Ga0105241_10122937 3300009174 Bacteria 2092
232 Ga0105241_10157653 3300009174 Bacteria 1863
233 Ga0105242_10240325 3300009176 Bacteria 1628
234 Ga0105242_10265946 3300009176 Bacteria 1551
235 Ga0105248_10261785 3300009177 Bacteria 1947
236 Ga0105248_10495459 3300009177 Bacteria 1377
237 Ga0105248_10544188 3300009177 Bacteria 1310
238 Ga0105248_10640640 3300009177 Bacteria 1199
239 Ga0105237_10203338 3300009545 Bacteria 1981
240 Ga0105237_10248186 3300009545 Bacteria 1782
241 Ga0105237_10258013 3300009545 Bacteria 1746
242 Ga0105237_10308923 3300009545 Bacteria 1584
243 Ga0105237_10340342 3300009545 Bacteria 1505
244 Ga0105237_10401177 3300009545 Bacteria 1376
245 Ga0105237_10496219 3300009545 Bacteria 1227
246 Ga0105238_10266340 3300009551 Bacteria 1694
247 Ga0105238_10279793 3300009551 Bacteria 1650
248 Ga0105238_10316699 3300009551 Bacteria 1545
249 Ga0105249_10241688 3300009553 Bacteria 1785
250 Ga0105249_10296142 3300009553 Bacteria 1621
251 Ga0105249_10393986 3300009553 Unclassified 1414
252 Ga0105249_10404634 3300009553 Bacteria 1396
253 Ga0105249_10529976 3300009553 Bacteria 1226
254 Ga0105239_10139782 3300010375 Bacteria 2698
255 Ga0105239_10184187 3300010375 Bacteria 2336
256 Ga0105239_10232663 3300010375 Bacteria 2068
257 Ga0105239_10493507 3300010375 Bacteria 1392
258 Ga0105239_10507450 3300010375 Bacteria 1371
259 Ga0105239_10522895 3300010375 Bacteria 1350
260 Ga0105239_10545067 3300010375 Bacteria 1321
261 Ga0105246_10255168 3300011119 Bacteria 1394
262 Ga0157371_10068312 3300013102 Bacteria 2515
263 Ga0157371_10112499 3300013102 Bacteria 1932
264 Ga0157371_10127643 3300013102 Bacteria 1809
265 Ga0157371_10183501 3300013102 Bacteria 1497
266 Ga0157371_10255340 3300013102 Bacteria 1263
267 Ga0157369_10071295 3300013105 Bacteria 3731
268 Ga0157369_10243397 3300013105 Bacteria 1878
269 Ga0157369_10417071 3300013105 Bacteria 1392
270 Ga0157374_10146177 3300013296 Bacteria 2296
271 Ga0157374_10177294 3300013296 Bacteria 2080
272 Ga0157374_10185528 3300013296 Bacteria 2033
273 Ga0157374_10240404 3300013296 Bacteria 1780
274 Ga0157374_10404056 3300013296 Bacteria 1363
275 Ga0157378_10093734 3300013297 Bacteria 2734
276 Ga0157378_10252015 3300013297 Bacteria 1690
277 Ga0157378_10291315 3300013297 Bacteria 1577
278 Ga0157378_10352898 3300013297 Bacteria 1437
279 Ga0157378_10507749 3300013297 Bacteria 1205
280 Ga0163162_10470297 3300013306 Bacteria 1389
281 Ga0163162_10493243 3300013306 Bacteria 1356
282 Ga0157372_10209894 3300013307 Bacteria 2256
283 Ga0157372_10336094 3300013307 Bacteria 1759
284 Ga0157372_10413176 3300013307 Bacteria 1572
285 Ga0157372_10457132 3300013307 Bacteria 1488
286 Ga0157372_10485930 3300013307 Bacteria 1440
287 Ga0157372_10641351 3300013307 Bacteria 1237
288 Ga0157375_10178106 3300013308 Bacteria 2277
289 Ga0157375_10280087 3300013308 Bacteria 1831
290 Ga0157375_10414677 3300013308 Bacteria 1513
291 Ga0157375_10586613 3300013308 Bacteria 1275
292 Ga0163163_10459657 3300014325 Bacteria 1333
293 Ga0157380_10052639 3300014326 Bacteria 3224
294 Ga0157380_10078757 3300014326 Bacteria 2689
295 Ga0157380_10182901 3300014326 Bacteria 1843
296 Ga0157380_10208017 3300014326 Bacteria 1741
297 Ga0157380_10210571 3300014326 Bacteria 1732
298 Ga0157377_10107713 3300014745 Bacteria 1671
299 Ga0157377_10111917 3300014745 Bacteria 1642
300 Ga0157377_10137035 3300014745 Bacteria 1501
301 Ga0157377_10247818 3300014745 Bacteria 1153
302 Ga0157379_10016595 3300014968 Bacteria 6476
303 Ga0157379_10050706 3300014968 Bacteria 3706
304 Ga0157379_10281274 3300014968 Bacteria 1514
305 Ga0157379_10296794 3300014968 Bacteria 1472
306 Ga0157376_10286037 3300014969 Bacteria 1555
307 Ga0157376_10314898 3300014969 Bacteria 1486
308 Ga0157376_10316677 3300014969 Bacteria 1482
309 Ga0182007_10046936 3300015262 Bacteria 1429
310 Ga0182005_1038728 3300015265 Bacteria 1297
311 Ga0163161_10099480 3300017792 Bacteria 2163
312 Ga0163161_10121552 3300017792 Bacteria 1963
313 Ga0163161_10236885 3300017792 Bacteria 1418
314 Ga0163161_10275529 3300017792 Bacteria 1318
315 Ga0213872_10119716 3300021361 Bacteria 1164
316 Ga0213874_10067207 3300021377 Bacteria 1136
317 Ga0213876_10120521 3300021384 Bacteria 1392
318 Ga0228598_1021656 3300024227 Bacteria 1264
319 Ga0207672_1002112 3300025223 Bacteria 1252
320 Ga0207666_1002572 3300025271 Bacteria 2190
321 Ga0207656_10089342 3300025321 Bacteria 1396
322 Ga0207656_10135616 3300025321 Bacteria 1156
323 Ga0207653_10003899 3300025885 Bacteria 4688
324 Ga0207653_10009949 3300025885 Bacteria 2966
325 Ga0207682_10073375 3300025893 Bacteria 1453
326 Ga0207692_10090235 3300025898 Bacteria 1660
327 Ga0207692_10203088 3300025898 Bacteria 1166
328 Ga0207642_10155761 3300025899 Bacteria 1221
329 Ga0207642_10167621 3300025899 Bacteria 1185
330 Ga0207710_10047686 3300025900 Bacteria 1916
331 Ga0207710_10111754 3300025900 Bacteria 1298
332 Ga0207710_10137227 3300025900 Bacteria 1179
333 Ga0207710_10139735 3300025900 Bacteria 1169
334 Ga0207688_10047118 3300025901 Bacteria 2407
335 Ga0207688_10054201 3300025901 Bacteria 2250
336 Ga0207688_10062194 3300025901 Bacteria 2105
337 Ga0207688_10088940 3300025901 Bacteria 1771
338 Ga0207688_10178115 3300025901 Bacteria 1267
339 Ga0207688_10189694 3300025901 Bacteria 1229
340 Ga0207680_10228719 3300025903 Bacteria 1277
341 Ga0207680_10276687 3300025903 Bacteria 1165
342 Ga0207647_10029102 3300025904 Bacteria 3579
343 Ga0207647_10051838 3300025904 Bacteria 2534
344 Ga0207647_10145511 3300025904 Bacteria 1387
345 Ga0207685_10091909 3300025905 Bacteria 1280
346 Ga0207699_10266272 3300025906 Bacteria 1186
347 Ga0207699_10267629 3300025906 Bacteria 1183
348 Ga0207645_10019831 3300025907 Bacteria 4403
349 Ga0207645_10070146 3300025907 Bacteria 2241
350 Ga0207645_10105110 3300025907 Bacteria 1824
351 Ga0207645_10232943 3300025907 Bacteria 1216
352 Ga0207643_10036328 3300025908 Bacteria 2762
353 Ga0207643_10129736 3300025908 Bacteria 1499
354 Ga0207643_10157854 3300025908 Bacteria 1363
355 Ga0207684_10206903 3300025910 Bacteria 1693
356 Ga0207654_10258501 3300025911 Bacteria 1170
357 Ga0207707_10282229 3300025912 Bacteria 1438
358 Ga0207695_10448340 3300025913 Bacteria 1174
359 Ga0207671_10322215 3300025914 Bacteria 1223
360 Ga0207671_10334420 3300025914 Bacteria 1200
361 Ga0207671_10352814 3300025914 Bacteria 1167
362 Ga0207693_10041145 3300025915 Bacteria 3639
363 Ga0207693_10049207 3300025915 Bacteria 3310
364 Ga0207693_10051941 3300025915 Bacteria 3215
365 Ga0207663_10186351 3300025916 Bacteria 1486
366 Ga0207663_10272077 3300025916 Bacteria 1255
367 Ga0207660_10293885 3300025917 Bacteria 1292
368 Ga0207660_10362291 3300025917 Bacteria 1163
369 Ga0207662_10115220 3300025918 Bacteria 1680
370 Ga0207662_10133663 3300025918 Bacteria 1566
371 Ga0207662_10136648 3300025918 Bacteria 1550
372 Ga0207657_10058295 3300025919 Bacteria 3323
373 Ga0207657_10063809 3300025919 Bacteria 3147
374 Ga0207657_10066183 3300025919 Bacteria 3077
375 Ga0207657_10089453 3300025919 Bacteria 2572
376 Ga0207657_10127787 3300025919 Bacteria 2086
377 Ga0207652_10250795 3300025921 Bacteria 1596
378 Ga0207652_10300380 3300025921 Bacteria 1449
379 Ga0207652_10401641 3300025921 Unclassified 1236
380 Ga0207646_10263953 3300025922 Bacteria 1556
381 Ga0207646_10417468 3300025922 Bacteria 1211
382 Ga0207681_10232391 3300025923 Bacteria 1432
383 Ga0207681_10294354 3300025923 Bacteria 1282
384 Ga0207681_10348697 3300025923 Bacteria 1184
385 Ga0207694_10319832 3300025924 Bacteria 1280
386 Ga0207694_10386513 3300025924 Bacteria 1162
387 Ga0207659_10188112 3300025926 Bacteria 1641
388 Ga0207659_10304419 3300025926 Bacteria 1310
389 Ga0207659_10329808 3300025926 Bacteria 1261
390 Ga0207687_10045861 3300025927 Bacteria 3024
391 Ga0207687_10184509 3300025927 Bacteria 1619
392 Ga0207687_10184722 3300025927 Bacteria 1618
393 Ga0207687_10250543 3300025927 Bacteria 1408
394 Ga0207687_10294268 3300025927 Bacteria 1306
395 Ga0207687_10333965 3300025927 Bacteria 1230
396 Ga0207687_10364279 3300025927 Bacteria 1181
397 Ga0207687_10406708 3300025927 Bacteria 1121
398 Ga0207700_10265060 3300025928 Bacteria 1472
399 Ga0207700_10422582 3300025928 Bacteria 1171
400 Ga0207644_10295660 3300025931 Bacteria 1303
401 Ga0207644_10352427 3300025931 Bacteria 1195
402 Ga0207644_10370611 3300025931 Bacteria 1166
403 Ga0207690_10221909 3300025932 Bacteria 1446
404 Ga0207690_10336519 3300025932 Bacteria 1190
405 Ga0207690_10343740 3300025932 Bacteria 1178
406 Ga0207706_10043780 3300025933 Bacteria 3966
407 Ga0207706_10067346 3300025933 Bacteria 3150
408 Ga0207706_10073352 3300025933 Bacteria 3010
409 Ga0207706_10230570 3300025933 Bacteria 1620
410 Ga0207706_10243241 3300025933 Bacteria 1573
411 Ga0207706_10315631 3300025933 Bacteria 1361
412 Ga0207706_10371047 3300025933 Bacteria 1243
413 Ga0207686_10256430 3300025934 Bacteria 1280
414 Ga0207686_10299323 3300025934 Bacteria 1194
415 Ga0207686_10309382 3300025934 Bacteria 1176
416 Ga0207709_10131044 3300025935 Bacteria 1709
417 Ga0207709_10306731 3300025935 Bacteria 1183
418 Ga0207709_10309697 3300025935 Bacteria 1178
419 Ga0207670_10038724 3300025936 Bacteria 3116
420 Ga0207670_10123603 3300025936 Bacteria 1885
421 Ga0207670_10344744 3300025936 Bacteria 1178
422 Ga0207669_10075709 3300025937 Bacteria 2133
423 Ga0207669_10188763 3300025937 Bacteria 1484
424 Ga0207669_10253611 3300025937 Bacteria 1311
425 Ga0207669_10271756 3300025937 Bacteria 1273
426 Ga0207669_10310491 3300025937 Bacteria 1202
427 Ga0207669_10323403 3300025937 Bacteria 1181
428 Ga0207704_10231142 3300025938 Bacteria 1375
429 Ga0207704_10315190 3300025938 Bacteria 1204
430 Ga0207704_10315755 3300025938 Bacteria 1203
431 Ga0207704_10356788 3300025938 Bacteria 1140
432 Ga0207665_10016900 3300025939 Bacteria 4791
433 Ga0207665_10032327 3300025939 Bacteria 3464
434 Ga0207665_10050172 3300025939 Bacteria 2806
435 Ga0207665_10161675 3300025939 Bacteria 1611
436 Ga0207691_10194885 3300025940 Bacteria 1766
437 Ga0207691_10277475 3300025940 Bacteria 1442
438 Ga0207711_10390595 3300025941 Bacteria 1292
439 Ga0207711_10472265 3300025941 Bacteria 1168
440 Ga0207689_10033408 3300025942 Bacteria 4275
441 Ga0207689_10085727 3300025942 Bacteria 2589
442 Ga0207689_10128716 3300025942 Bacteria 2083
443 Ga0207689_10138029 3300025942 Bacteria 2008
444 Ga0207689_10179881 3300025942 Bacteria 1744
445 Ga0207689_10251616 3300025942 Unclassified 1461
446 Ga0207661_10091069 3300025944 Bacteria 2540
447 Ga0207667_10163827 3300025949 Bacteria 2286
448 Ga0207667_10407973 3300025949 Bacteria 1383
449 Ga0207667_10514234 3300025949 Bacteria 1213
450 Ga0207651_10156432 3300025960 Bacteria 1781
451 Ga0207651_10391248 3300025960 Bacteria 1180
452 Ga0207712_10108465 3300025961 Bacteria 2078
453 Ga0207712_10267587 3300025961 Unclassified 1389
454 Ga0207712_10302799 3300025961 Bacteria 1313
455 Ga0207712_10379485 3300025961 Bacteria 1183
456 Ga0207712_10386596 3300025961 Bacteria 1173
457 Ga0207668_10306985 3300025972 Bacteria 1311
458 Ga0207668_10340039 3300025972 Bacteria 1251
459 Ga0207668_10369238 3300025972 Bacteria 1204
460 Ga0207668_10395873 3300025972 Bacteria 1166
461 Ga0207640_10245455 3300025981 Bacteria 1386
462 Ga0207640_10270887 3300025981 Bacteria 1328
463 Ga0207640_10301131 3300025981 Bacteria 1268
464 Ga0207640_10322216 3300025981 Bacteria 1231
465 Ga0207658_10372673 3300025986 Bacteria 1248
466 Ga0207658_10433962 3300025986 Bacteria 1160
467 Ga0207677_10138379 3300026023 Bacteria 1860
468 Ga0207677_10145048 3300026023 Bacteria 1823
469 Ga0207677_10234966 3300026023 Bacteria 1479
470 Ga0207677_10280129 3300026023 Bacteria 1368
471 Ga0207677_10303648 3300026023 Bacteria 1319
472 Ga0207677_10343648 3300026023 Bacteria 1248
473 Ga0207677_10387531 3300026023 Bacteria 1181
474 Ga0207677_10391997 3300026023 Bacteria 1175
475 Ga0207703_10106594 3300026035 Bacteria 2384
476 Ga0207703_10247837 3300026035 Bacteria 1604
477 Ga0207703_10404516 3300026035 Bacteria 1267
478 Ga0207639_10356225 3300026041 Bacteria 1308
479 Ga0207639_10412500 3300026041 Bacteria 1219
480 Ga0207639_10453702 3300026041 Bacteria 1164
481 Ga0207678_10082337 3300026067 Bacteria 2754
482 Ga0207678_10083226 3300026067 Bacteria 2737
483 Ga0207678_10196962 3300026067 Bacteria 1722
484 Ga0207678_10321673 3300026067 Bacteria 1331
485 Ga0207678_10371273 3300026067 Bacteria 1236
486 Ga0207708_10006981 3300026075 Bacteria 8349
487 Ga0207708_10016004 3300026075 Bacteria 5632
488 Ga0207708_10243790 3300026075 Bacteria 1446
489 Ga0207708_10259653 3300026075 Bacteria 1402
490 Ga0207708_10290640 3300026075 Bacteria 1327
491 Ga0207702_10473259 3300026078 Bacteria 1218
492 Ga0207702_10500745 3300026078 Bacteria 1184
493 Ga0207702_10502274 3300026078 Bacteria 1182
494 Ga0207702_10525269 3300026078 Bacteria 1156
495 Ga0207641_10137705 3300026088 Bacteria 2199
496 Ga0207641_10490722 3300026088 Bacteria 1191
497 Ga0207641_10505132 3300026088 Bacteria 1174
498 Ga0207648_10092261 3300026089 Bacteria 2648
499 Ga0207648_10116873 3300026089 Bacteria 2344
500 Ga0207648_10250918 3300026089 Bacteria 1577
501 Ga0207648_10260515 3300026089 Bacteria 1547
502 Ga0207648_10317396 3300026089 Bacteria 1400
503 Ga0207676_10316772 3300026095 Bacteria 1430
504 Ga0207676_10338850 3300026095 Bacteria 1386
505 Ga0207676_10363760 3300026095 Unclassified 1341
506 Ga0207676_10454147 3300026095 Bacteria 1208
507 Ga0207674_10023331 3300026116 Bacteria 6629
508 Ga0207675_100056785 3300026118 Bacteria 3651
509 Ga0207675_100095115 3300026118 Bacteria 2803
510 Ga0207675_100103735 3300026118 Bacteria 2680
511 Ga0207675_100104688 3300026118 Bacteria 2667
512 Ga0207675_100124479 3300026118 Bacteria 2441
513 Ga0207675_100414868 3300026118 Bacteria 1329
514 Ga0207683_10009250 3300026121 Bacteria 8395
515 Ga0207683_10061080 3300026121 Bacteria 3315
516 Ga0207683_10074585 3300026121 Bacteria 3001
517 Ga0207683_10386336 3300026121 Bacteria 1287
518 Ga0207698_10278830 3300026142 Bacteria 1545
519 Ga0207698_10309740 3300026142 Bacteria 1474
520 Ga0207698_10318743 3300026142 Bacteria 1455
521 Ga0207698_10507864 3300026142 Bacteria 1174
522 Ga0268266_10302032 3300028379 Bacteria 1493
523 Ga0268266_10380374 3300028379 Bacteria 1331
524 Ga0268266_10431487 3300028379 Bacteria 1250
525 Ga0268266_10479509 3300028379 Bacteria 1185
526 Ga0268266_10491761 3300028379 Bacteria 1170
527 Ga0268266_10493382 3300028379 Bacteria 1168
528 Ga0268266_10498393 3300028379 Bacteria 1162
529 Ga0268265_10258902 3300028380 Bacteria 1545
530 Ga0268265_10313467 3300028380 Bacteria 1417
531 Ga0268265_10459914 3300028380 Bacteria 1190
532 Ga0268265_10460762 3300028380 Bacteria 1189
533 Ga0268265_10465812 3300028380 Bacteria 1183
534 Ga0268264_10500348 3300028381 Bacteria 1185
535 Ga0268264_10502103 3300028381 Bacteria 1183
536 Ga0265332_10080234 3300031238 Bacteria 1384
537 Ga0265331_10020082 3300031250 Bacteria 3436
538 Ga0265327_10000803 3300031251 Bacteria 47939
539 Ga0265327_10128429 3300031251 Bacteria 1194
540 Ga0307509_10173204 3300031507 Bacteria 2034
541 Ga0265314_10121818 3300031711 Bacteria 1640
542 Ga0307413_10259014 3300031824 Bacteria 1295
543 Ga0307410_10302591 3300031852 Bacteria 1262
544 Ga0307406_10121421 3300031901 Bacteria 1817
545 Ga0307407_10145902 3300031903 Bacteria 1532
546 Ga0307407_10166821 3300031903 Bacteria 1446
547 Ga0307416_100206051 3300032002 Bacteria 1871
548 Ga0307415_100376263 3300032126 Bacteria 1204
549 Ga0316580_10058133 3300032139 Bacteria 1188
550 Ga0373950_0006519 3300034818 Bacteria 1783
551 Ga0373958_0015891 3300034819 Bacteria 1335
552 Ga0373938_0005564 3300034957 Bacteria 2148
553 Ga0373928_0026793 3300035084 Bacteria 1250
554 Ga0373929_0009861 3300035085 Bacteria 1776
555 Ga0373940_0024328 3300035088 Bacteria 1569
556 Ga0373951_0018599 3300035091 Bacteria 1579
557 Ga0373952_0026349 3300035092 Bacteria 1262
558 Ga0373932_0005183 3300035112 Bacteria 3065
559 Ga0373939_0049249 3300035114 Bacteria 1301
560 Ga0373941_0015546 3300035115 Bacteria 2055
561 Ga0373941_0019367 3300035115 Bacteria 1893
562 Ga0373960_0031346 3300035121 Bacteria 1486
563 Ga0373942_0023079 3300035207 Bacteria 1585
564 Ga0373962_0023538 3300035242 Bacteria 1641
565 Ga0373931_0039734 3300035691 Bacteria 2465
566 Ga0373947_0126513 3300035725 Bacteria 1628
567 Ga0316582_0046739 3300036647 Bacteria 2730
568 Ga0316582_0065297 3300036647 Bacteria 2343
569 Ga0316584_0206271 3300036712 Bacteria 1448
570 Ga0316584_0278712 3300036712 Bacteria 1215
571 Ga0395899_0014582 3300037312 Bacteria 6000
572 Ga0395899_0084679 3300037312 Bacteria 2305
573 Ga0395900_0021883 3300037418 Bacteria 6537
574 Ga0395900_0058714 3300037418 Bacteria 3960
575 Ga0395898_0140813 3300037466 Bacteria 2309
576 Ga0395898_0239866 3300037466 Bacteria 1729
577 Ga0395905_0121110 3300037471 Bacteria 2459
578 Ga0395905_0121290 3300037471 Bacteria 2457
579 Ga0395905_0265703 3300037471 Bacteria 1601
580 Ga0316581_0036850 3300037588 Bacteria 1485
581 Ga0395901_0013536 3300038443 Bacteria 8295
582 Ga0395901_0084085 3300038443 Bacteria 3326
583 Ga0395901_0561177 3300038443 Bacteria 1156
584 Ga0436365_1439059 3300039437 Bacteria 2291
585 Ga0436360_1152550 3300039438 Bacteria 1424
586 Ga0436361_1054128 3300039447 Bacteria 1775
587 Ga0436361_1113204 3300039447 Bacteria 3005
588 Ga0436363_0385066 3300039450 Bacteria 1397
589 Ga0436362_0202784 3300039453 Bacteria 1880
590 Ga0436362_0545994 3300039453 Bacteria 1425
591 Ga0451853_1144003 3300041512 Bacteria 1499
592 Ga0439433_0008413 3300041999 Bacteria 2237
593 Ga0439441_002977 3300042001 Bacteria 2444
594 Ga0439448_0039597 3300042005 Bacteria 1520
595 Ga0439450_004867 3300042008 Bacteria 2325
596 Ga0439454_007604 3300042011 Bacteria 1361
597 Ga0439455_0008304 3300042012 Bacteria 2221
598 Ga0450913_000929 3300042117 Bacteria 1452
599 Ga0439458_0035018 3300042157 Bacteria 1206
600 Ga0439464_0000760 3300042439 Bacteria 7008
601 Ga0439440_0037908 3300042993 Bacteria 1165
602 Ga0466963_0027299 3300044694 Bacteria 3654
603 Ga0466957_0172618 3300044842 Bacteria 1409
604 Ga0466957_0222437 3300044842 Bacteria 1247
605 Ga0466960_0187166 3300044901 Bacteria 1125
606 Ga0451576_0546804 3300045051 Unclassified 1216
607 Ga0466958_0076700 3300045836 Bacteria 2052
608 Ga0466967_0137823 3300045976 Bacteria 2270
609 Ga0466967_0477128 3300045976 Bacteria 1221
610 Ga0495603_0051081 3300046455 Bacteria 2457
611 Ga0495629_0035313 3300046459 Bacteria 3533
612 Ga0495662_0089119 3300046476 Bacteria 1503
613 Ga0495596_0074166 3300046500 Bacteria 1321
614 Ga0495663_0030168 3300046525 Bacteria 1605
615 Ga0495658_0112483 3300046683 Bacteria 1638
616 Ga0495670_0144533 3300046691 Bacteria 1245
617 Ga0495685_045279 3300047447 Bacteria 1499
618 Ga0495673_0022180 3300047469 Bacteria 3117
619 Ga0496100_0235991 3300048903 Bacteria 1347
620 Ga0496101_0249199 3300048904 Bacteria 1383
621 Ga0496101_0250984 3300048904 Bacteria 1378
622 Ga0496101_0302767 3300048904 Bacteria 1252
623 Ga0496102_0147249 3300048905 Bacteria 2210
624 Ga0496102_0386707 3300048905 Bacteria 1316
625 Ga0496102_0455152 3300048905 Bacteria 1200
626 Ga0496103_0199281 3300048906 Bacteria 1287
627 Ga0496104_0073248 3300048907 Bacteria 3258
628 Ga0496104_0422821 3300048907 Bacteria 1244
629 Ga0496105_0042246 3300048908 Bacteria 3758
630 Ga0496105_0346326 3300048908 Bacteria 1187
631 Ga0496106_0212212 3300048909 Bacteria 1542
632 Ga0496106_0254188 3300048909 Bacteria 1405
633 Ga0496106_0298625 3300048909 Bacteria 1291
634 Ga0496106_0333197 3300048909 Bacteria 1218
635 Ga0496106_0360636 3300048909 Bacteria 1167
636 Ga0496107_0108305 3300048910 Bacteria 2040
637 Ga0496107_0265477 3300048910 Bacteria 1277
638 Ga0496107_0296894 3300048910 Bacteria 1202
639 Ga0496108_0154291 3300048911 Bacteria 1982
640 Ga0496108_0247520 3300048911 Bacteria 1550
641 Ga0496108_0340018 3300048911 Bacteria 1309
642 Ga0496108_0372607 3300048911 Bacteria 1246
643 Ga0496108_0376533 3300048911 Bacteria 1239
644 Ga0496109_0077217 3300048912 Bacteria 3064
645 Ga0496109_0081404 3300048912 Bacteria 2983
646 Ga0496109_0433587 3300048912 Bacteria 1241
647 Ga0496110_0177992 3300048913 Bacteria 1931
648 Ga0496110_0279363 3300048913 Bacteria 1520
649 Ga0496110_0462902 3300048913 Bacteria 1155
650 Ga0496111_0042406 3300048914 Bacteria 3267
651 Ga0496111_0175203 3300048914 Bacteria 1594
652 Ga0496111_0283165 3300048914 Bacteria 1229
653 Ga0496112_0512620 3300048915 Bacteria 1134
654 Ga0496113_0200806 3300048916 Bacteria 1585
655 Ga0496113_0312181 3300048916 Bacteria 1260
656 Ga0496113_0339507 3300048916 Bacteria 1205
657 Ga0496114_0117726 3300048917 Bacteria 2282
658 Ga0496114_0191608 3300048917 Bacteria 1789
659 Ga0496114_0232021 3300048917 Bacteria 1621
660 Ga0496115_0155088 3300048918 Bacteria 1892
661 Ga0496115_0307408 3300048918 Bacteria 1298
662 Ga0496115_0348343 3300048918 Bacteria 1208
663 Ga0496115_0358058 3300048918 Bacteria 1189
664 Ga0501033_0229952 3300049570 Bacteria 1318
665 Ga0501036_0340747 3300049572 Bacteria 1252
666 Ga0501037_0038700 3300049573 Bacteria 3513
667 Ga0501040_0248894 3300049576 Bacteria 1267
668 Ga0501043_0068400 3300049579 Bacteria 2788
669 Ga0501043_0072729 3300049579 Bacteria 2701
670 Ga0501046_0076707 3300049580 Bacteria 2589
671 Ga0501047_0288301 3300049581 Bacteria 1485
672 Ga0501068_0034866 3300049584 Bacteria 3003
673 Ga0501070_0045405 3300049586 Bacteria 3654
674 Ga0501070_0201946 3300049586 Bacteria 1632
675 Ga0501071_0245347 3300049587 Bacteria 1351
676 Ga0501072_0121753 3300049588 Bacteria 2079
677 Ga0501072_0181794 3300049588 Bacteria 1677
678 Ga0501073_0105750 3300049589 Bacteria 1953
679 Ga0501074_0031677 3300049590 Bacteria 3831
680 Ga0501074_0103137 3300049590 Bacteria 2042
681 Ga0501075_0273026 3300049591 Bacteria 1288
682 Ga0501077_0195350 3300049593 Bacteria 1285
683 Ga0501251_006292 3300049681 Bacteria 1289
684 Ga0501079_0354010 3300049741 Bacteria 1150
685 Ga0501080_0256531 3300049742 Bacteria 1594
686 Ga0501081_0094867 3300049743 Bacteria 2102
687 Ga0501083_0064396 3300049744 Bacteria 2443
688 Ga0501083_0223315 3300049744 Bacteria 1227
689 Ga0501035_0126452 3300049822 Bacteria 2231
690 nmdc:mga05p37_305856_c1 3300050507 Bacteria 1887
691 nmdc:mga05p37_594864_c1 3300050507 Bacteria 1250
692 nmdc:mga09592_110595_c1 3300050508 Bacteria 2357
693 nmdc:mga09592_82204_c1 3300050508 Bacteria 2745
694 nmdc:mga0qj67_182250_c1 3300050509 Bacteria 1706
695 nmdc:mga06r32_418718_c1 3300050510 Bacteria 1321
696 nmdc:mga0rr50_215176_c1 3300050513 Bacteria 1585
697 Ga0495655_0024496 3300053083 Bacteria 1402
698 Ga0500643_002390 3300053087 Bacteria 9758
699 Ga0500608_080032 3300053122 Bacteria 1542
700 Ga0500564_049248 3300053138 Bacteria 1929
701 Ga0501084_0305188 3300054114 Bacteria 1344
702 Ga0501082_0012984 3300060353 Bacteria 7161
703 3003669216 3003665799 Bacteria 7279786
704 Ga0495598_0034903
705 JGI24739J22299_10058866
706 JGI24735J21928_10047576
707 JGI24738J21930_10026968
708 JGI24749J21850_1011577
709 JGI24744J21845_10012706
710 JGI24744J21845_10025159
711 JGI24034J26672_10016608
712 rootL2_10276227
713 JGI25405J52794_10016556
714 Ga0065715_10135057
715 Ga0065707_10205910
716 Ga0065707_10227940
717 Ga0070676_10010447
718 Ga0070676_10162219
719 Ga0070683_100407497
720 Ga0070690_100162067
721 Ga0070690_100173728
722 Ga0070690_100228759
723 Ga0070670_100214076
724 Ga0070670_100216556
725 Ga0070677_10061106
726 Ga0068869_100333178
727 Ga0070666_10201730
728 Ga0070680_100032714
729 Ga0070680_100097718
730 Ga0070682_100011649
731 Ga0070682_100033763
732 Ga0070682_100096867
733 Ga0070682_100184561
734 Ga0068868_100039734
735 Ga0068868_100057673
736 Ga0068868_100291094
737 Ga0068868_100315630
738 Ga0070660_100088444
739 Ga0070689_100063914
740 Ga0070689_100190514
741 Ga0070689_100404578
742 Ga0070691_10085045
743 Ga0070687_100018837
744 Ga0070687_100203133
745 Ga0070661_100209161
746 Ga0070692_10005292
747 Ga0070668_100035459
748 Ga0070668_100264847
749 Ga0070669_100175670
750 Ga0070669_100237229
751 Ga0070675_100219741
752 Ga0070675_100354328
753 Ga0070671_100033804
754 Ga0070671_100269287
755 Ga0070671_100311300
756 Ga0070674_100138037
757 Ga0070674_100149368
758 Ga0070674_100319763
759 Ga0070673_100170457
760 Ga0070673_100177935
761 Ga0070688_100094045
762 Ga0070688_100166560
763 Ga0070688_100174715
764 Ga0070688_100232224
765 Ga0070659_100039616
766 Ga0070659_100316255
767 Ga0070667_100059238
768 Ga0070703_10028674
769 Ga0070709_10022063
770 Ga0070709_10040773
771 Ga0070713_100154359
772 Ga0070713_100383565
773 Ga0070710_10024533
774 Ga0070710_10137450
775 Ga0070701_10023068
776 Ga0070701_10066585
777 Ga0070711_100074529
778 Ga0070705_100045621
779 Ga0070705_100168003
780 Ga0070700_100120440
781 Ga0070694_100156730
782 Ga0070694_100161692
783 Ga0070694_100180159
784 Ga0070694_100282785
785 Ga0070708_100394999
786 Ga0070708_100404054
787 Ga0070663_100091727
788 Ga0070663_100111689
789 Ga0070678_100005208
790 Ga0070678_100074284
791 Ga0070678_100139511
792 Ga0070678_100216045
793 Ga0070678_100225695
794 Ga0070678_100329865
795 Ga0070678_100347313
796 Ga0070662_100048261
797 Ga0070662_100074335
798 Ga0070662_100180311
799 Ga0070681_10151986
800 Ga0070681_10156452
801 Ga0068867_100306274
802 Ga0068867_100328741
803 Ga0070685_10016219
804 Ga0070685_10102784
805 Ga0070685_10161144
806 Ga0070706_100376125
807 Ga0070707_100401780
808 Ga0070707_100427968
809 Ga0070707_100484124
810 Ga0070698_100154947
811 Ga0070679_100239436
812 Ga0070679_100286646
813 Ga0070679_100376381
814 Ga0070684_100196996
815 Ga0070697_100173880
816 Ga0070697_100386496
817 Ga0070672_100050954
818 Ga0070672_100104302
819 Ga0070672_100142147
820 Ga0070672_100180003
821 Ga0070686_100121837
822 Ga0070686_100146977
823 Ga0070686_100173203
824 Ga0070686_100194449
825 Ga0070695_100248464
826 Ga0070696_100175403
827 Ga0070693_100023017
828 Ga0070693_100080131
829 Ga0070693_100141359
830 Ga0070665_100112729
831 Ga0070665_100172119
832 Ga0070665_100255162
833 Ga0070665_100396067
834 Ga0070665_100405470
835 Ga0070704_100332690
836 Ga0070704_100345989
837 Ga0068855_100005073
838 Ga0068855_100093992
839 Ga0068855_100158266
840 Ga0068855_100373908
841 Ga0068855_100423159
842 Ga0068857_100320860
843 Ga0068854_100063358
844 Ga0068854_100122510
845 Ga0068854_100228531
846 Ga0068854_100236206
847 Ga0068856_100234487
848 Ga0068856_100445474
849 Ga0070702_100153327
850 Ga0070702_100156718
851 Ga0068852_100027326
852 Ga0068852_100234458
853 Ga0068852_100244139
854 Ga0068852_100305933
855 Ga0068859_100485522
856 Ga0068859_100541488
857 Ga0068864_100060520
858 Ga0068864_100148623
859 Ga0068864_100244734
860 Ga0068864_100408544
861 Ga0068864_100437101
862 Ga0068866_10060396
863 Ga0068866_10070785
864 Ga0068861_100077119
865 Ga0068861_100159282
866 Ga0068861_100159789
867 Ga0068861_100183775
868 Ga0068861_100395256
869 Ga0068851_10110366
870 Ga0068870_10146695
871 Ga0068870_10190799
872 Ga0068870_10191576
873 Ga0068863_100096312
874 Ga0068863_100106983
875 Ga0068863_100234973
876 Ga0068863_100381685
877 Ga0068858_100005735
878 Ga0068858_100093236
879 Ga0068858_100162231
880 Ga0068860_100038528
881 Ga0068860_100063074
882 Ga0068862_100177823
883 Ga0068862_100250006
884 Ga0068862_100263006
885 Ga0068862_100365747
886 Ga0081455_10066538
887 Ga0081455_10071257
888 Ga0081455_10139106
889 Ga0081540_1024082
890 Ga0081540_1060435
891 Ga0081539_10010464
892 Ga0070715_10059987
893 Ga0070715_10110719
894 Ga0070715_10112651
895 Ga0070716_100012087
896 Ga0070716_100227325
897 Ga0097621_100065385
898 Ga0097621_100092611
899 Ga0097621_100264150
900 Ga0068871_100208065
901 Ga0068871_100213026
902 Ga0068871_100262630
903 Ga0075430_100048238
904 Ga0075430_100339210
905 Ga0075431_100390919
906 Ga0075431_100415730
907 Ga0075434_100334802
908 Ga0075429_100079756
909 Ga0075429_100238975
910 Ga0068865_100013298
911 Ga0068865_100100945
912 Ga0068865_100157345
913 Ga0068865_100243676
914 Ga0097620_100485538
915 Ga0097620_100541470
916 Ga0075435_100390253
917 Ga0105244_10128110
918 Ga0105250_10008557
919 Ga0105250_10029726
920 Ga0105245_10173514
921 Ga0105245_10290447
922 Ga0105245_10419681
923 Ga0105247_10075635
924 Ga0105247_10148693
925 Ga0105247_10153981
926 Ga0105247_10204709
927 Ga0105247_10220766
928 Ga0114129_10178659
929 Ga0114129_10523454
930 Ga0105243_10059464
931 Ga0105243_10271319
932 Ga0105243_10403478
933 Ga0105243_10406606
934 Ga0105241_10122937
935 Ga0105241_10157653
936 Ga0105242_10240325
937 Ga0105242_10265946
938 Ga0105248_10261785
939 Ga0105248_10495459
940 Ga0105248_10544188
941 Ga0105248_10640640
942 Ga0105237_10203338
943 Ga0105237_10248186
944 Ga0105237_10258013
945 Ga0105237_10308923
946 Ga0105237_10340342
947 Ga0105237_10401177
948 Ga0105237_10496219
949 Ga0105238_10266340
950 Ga0105238_10279793
951 Ga0105238_10316699
952 Ga0105249_10241688
953 Ga0105249_10296142
954 Ga0105249_10393986
955 Ga0105249_10404634
956 Ga0105249_10529976
957 Ga0105239_10139782
958 Ga0105239_10184187
959 Ga0105239_10232663
960 Ga0105239_10493507
961 Ga0105239_10507450
962 Ga0105239_10522895
963 Ga0105239_10545067
964 Ga0105246_10255168
965 Ga0157371_10068312
966 Ga0157371_10112499
967 Ga0157371_10127643
968 Ga0157371_10183501
969 Ga0157371_10255340
970 Ga0157369_10071295
971 Ga0157369_10243397
972 Ga0157369_10417071
973 Ga0157374_10146177
974 Ga0157374_10177294
975 Ga0157374_10185528
976 Ga0157374_10240404
977 Ga0157374_10404056
978 Ga0157378_10093734
979 Ga0157378_10252015
980 Ga0157378_10291315
981 Ga0157378_10352898
982 Ga0157378_10507749
983 Ga0163162_10470297
984 Ga0163162_10493243
985 Ga0157372_10209894
986 Ga0157372_10336094
987 Ga0157372_10413176
988 Ga0157372_10457132
989 Ga0157372_10485930
990 Ga0157372_10641351
991 Ga0157375_10178106
992 Ga0157375_10280087
993 Ga0157375_10414677
994 Ga0157375_10586613
995 Ga0163163_10459657
996 Ga0157380_10052639
997 Ga0157380_10078757
998 Ga0157380_10182901
999 Ga0157380_10208017
1000 Ga0157380_10210571
1001 Ga0157377_10107713
1002 Ga0157377_10111917
1003 Ga0157377_10137035
1004 Ga0157377_10247818
1005 Ga0157379_10016595
1006 Ga0157379_10050706
1007 Ga0157379_10281274
1008 Ga0157379_10296794
1009 Ga0157376_10286037
1010 Ga0157376_10314898
1011 Ga0157376_10316677
1012 Ga0182007_10046936
1013 Ga0182005_1038728
1014 Ga0163161_10099480
1015 Ga0163161_10121552
1016 Ga0163161_10236885
1017 Ga0163161_10275529
1018 Ga0213872_10119716
1019 Ga0213874_10067207
1020 Ga0213876_10120521
1021 Ga0228598_1021656
1022 Ga0207672_1002112
1023 Ga0207666_1002572
1024 Ga0207656_10089342
1025 Ga0207656_10135616
1026 Ga0207653_10003899
1027 Ga0207653_10009949
1028 Ga0207682_10073375
1029 Ga0207692_10090235
1030 Ga0207692_10203088
1031 Ga0207642_10155761
1032 Ga0207642_10167621
1033 Ga0207710_10047686
1034 Ga0207710_10111754
1035 Ga0207710_10137227
1036 Ga0207710_10139735
1037 Ga0207688_10047118
1038 Ga0207688_10054201
1039 Ga0207688_10062194
1040 Ga0207688_10088940
1041 Ga0207688_10178115
1042 Ga0207688_10189694
1043 Ga0207680_10228719
1044 Ga0207680_10276687
1045 Ga0207647_10029102
1046 Ga0207647_10051838
1047 Ga0207647_10145511
1048 Ga0207685_10091909
1049 Ga0207699_10266272
1050 Ga0207699_10267629
1051 Ga0207645_10019831
1052 Ga0207645_10070146
1053 Ga0207645_10105110
1054 Ga0207645_10232943
1055 Ga0207643_10036328
1056 Ga0207643_10129736
1057 Ga0207643_10157854
1058 Ga0207684_10206903
1059 Ga0207654_10258501
1060 Ga0207707_10282229
1061 Ga0207695_10448340
1062 Ga0207671_10322215
1063 Ga0207671_10334420
1064 Ga0207671_10352814
1065 Ga0207693_10041145
1066 Ga0207693_10049207
1067 Ga0207693_10051941
1068 Ga0207663_10186351
1069 Ga0207663_10272077
1070 Ga0207660_10293885
1071 Ga0207660_10362291
1072 Ga0207662_10115220
1073 Ga0207662_10133663
1074 Ga0207662_10136648
1075 Ga0207657_10058295
1076 Ga0207657_10063809
1077 Ga0207657_10066183
1078 Ga0207657_10089453
1079 Ga0207657_10127787
1080 Ga0207652_10250795
1081 Ga0207652_10300380
1082 Ga0207652_10401641
1083 Ga0207646_10263953
1084 Ga0207646_10417468
1085 Ga0207681_10232391
1086 Ga0207681_10294354
1087 Ga0207681_10348697
1088 Ga0207694_10319832
1089 Ga0207694_10386513
1090 Ga0207659_10188112
1091 Ga0207659_10304419
1092 Ga0207659_10329808
1093 Ga0207687_10045861
1094 Ga0207687_10184509
1095 Ga0207687_10184722
1096 Ga0207687_10250543
1097 Ga0207687_10294268
1098 Ga0207687_10333965
1099 Ga0207687_10364279
1100 Ga0207687_10406708
1101 Ga0207700_10265060
1102 Ga0207700_10422582
1103 Ga0207644_10295660
1104 Ga0207644_10352427
1105 Ga0207644_10370611
1106 Ga0207690_10221909
1107 Ga0207690_10336519
1108 Ga0207690_10343740
1109 Ga0207706_10043780
1110 Ga0207706_10067346
1111 Ga0207706_10073352
1112 Ga0207706_10230570
1113 Ga0207706_10243241
1114 Ga0207706_10315631
1115 Ga0207706_10371047
1116 Ga0207686_10256430
1117 Ga0207686_10299323
1118 Ga0207686_10309382
1119 Ga0207709_10131044
1120 Ga0207709_10306731
1121 Ga0207709_10309697
1122 Ga0207670_10038724
1123 Ga0207670_10123603
1124 Ga0207670_10344744
1125 Ga0207669_10075709
1126 Ga0207669_10188763
1127 Ga0207669_10253611
1128 Ga0207669_10271756
1129 Ga0207669_10310491
1130 Ga0207669_10323403
1131 Ga0207704_10231142
1132 Ga0207704_10315190
1133 Ga0207704_10315755
1134 Ga0207704_10356788
1135 Ga0207665_10016900
1136 Ga0207665_10032327
1137 Ga0207665_10050172
1138 Ga0207665_10161675
1139 Ga0207691_10194885
1140 Ga0207691_10277475
1141 Ga0207711_10390595
1142 Ga0207711_10472265
1143 Ga0207689_10033408
1144 Ga0207689_10085727
1145 Ga0207689_10128716
1146 Ga0207689_10138029
1147 Ga0207689_10179881
1148 Ga0207689_10251616
1149 Ga0207661_10091069
1150 Ga0207667_10163827
1151 Ga0207667_10407973
1152 Ga0207667_10514234
1153 Ga0207651_10156432
1154 Ga0207651_10391248
1155 Ga0207712_10108465
1156 Ga0207712_10267587
1157 Ga0207712_10302799
1158 Ga0207712_10379485
1159 Ga0207712_10386596
1160 Ga0207668_10306985
1161 Ga0207668_10340039
1162 Ga0207668_10369238
1163 Ga0207668_10395873
1164 Ga0207640_10245455
1165 Ga0207640_10270887
1166 Ga0207640_10301131
1167 Ga0207640_10322216
1168 Ga0207658_10372673
1169 Ga0207658_10433962
1170 Ga0207677_10138379
1171 Ga0207677_10145048
1172 Ga0207677_10234966
1173 Ga0207677_10280129
1174 Ga0207677_10303648
1175 Ga0207677_10343648
1176 Ga0207677_10387531
1177 Ga0207677_10391997
1178 Ga0207703_10106594
1179 Ga0207703_10247837
1180 Ga0207703_10404516
1181 Ga0207639_10356225
1182 Ga0207639_10412500
1183 Ga0207639_10453702
1184 Ga0207678_10082337
1185 Ga0207678_10083226
1186 Ga0207678_10196962
1187 Ga0207678_10321673
1188 Ga0207678_10371273
1189 Ga0207708_10006981
1190 Ga0207708_10016004
1191 Ga0207708_10243790
1192 Ga0207708_10259653
1193 Ga0207708_10290640
1194 Ga0207702_10473259
1195 Ga0207702_10500745
1196 Ga0207702_10502274
1197 Ga0207702_10525269
1198 Ga0207641_10137705
1199 Ga0207641_10490722
1200 Ga0207641_10505132
1201 Ga0207648_10092261
1202 Ga0207648_10116873
1203 Ga0207648_10250918
1204 Ga0207648_10260515
1205 Ga0207648_10317396
1206 Ga0207676_10316772
1207 Ga0207676_10338850
1208 Ga0207676_10363760
1209 Ga0207676_10454147
1210 Ga0207674_10023331
1211 Ga0207675_100056785
1212 Ga0207675_100095115
1213 Ga0207675_100103735
1214 Ga0207675_100104688
1215 Ga0207675_100124479
1216 Ga0207675_100414868
1217 Ga0207683_10009250
1218 Ga0207683_10061080
1219 Ga0207683_10074585
1220 Ga0207683_10386336
1221 Ga0207698_10278830
1222 Ga0207698_10309740
1223 Ga0207698_10318743
1224 Ga0207698_10507864
1225 Ga0268266_10302032
1226 Ga0268266_10380374
1227 Ga0268266_10431487
1228 Ga0268266_10479509
1229 Ga0268266_10491761
1230 Ga0268266_10493382
1231 Ga0268266_10498393
1232 Ga0268265_10258902
1233 Ga0268265_10313467
1234 Ga0268265_10459914
1235 Ga0268265_10460762
1236 Ga0268265_10465812
1237 Ga0268264_10500348
1238 Ga0268264_10502103
1239 Ga0265332_10080234
1240 Ga0265331_10020082
1241 Ga0265327_10000803
1242 Ga0265327_10128429
1243 Ga0307509_10173204
1244 Ga0265314_10121818
1245 Ga0307413_10259014
1246 Ga0307410_10302591
1247 Ga0307406_10121421
1248 Ga0307407_10145902
1249 Ga0307407_10166821
1250 Ga0307416_100206051
1251 Ga0307415_100376263
1252 Ga0316580_10058133
1253 Ga0373950_0006519
1254 Ga0373958_0015891
1255 Ga0373938_0005564
1256 Ga0373928_0026793
1257 Ga0373929_0009861
1258 Ga0373940_0024328
1259 Ga0373951_0018599
1260 Ga0373952_0026349
1261 Ga0373932_0005183
1262 Ga0373939_0049249
1263 Ga0373941_0015546
1264 Ga0373941_0019367
1265 Ga0373960_0031346
1266 Ga0373942_0023079
1267 Ga0373962_0023538
1268 Ga0373931_0039734
1269 Ga0373947_0126513
1270 Ga0316582_0046739
1271 Ga0316582_0065297
1272 Ga0316584_0206271
1273 Ga0316584_0278712
1274 Ga0395899_0014582
1275 Ga0395899_0084679
1276 Ga0395900_0021883
1277 Ga0395900_0058714
1278 Ga0395898_0140813
1279 Ga0395898_0239866
1280 Ga0395905_0121110
1281 Ga0395905_0121290
1282 Ga0395905_0265703
1283 Ga0316581_0036850
1284 Ga0395901_0013536
1285 Ga0395901_0084085
1286 Ga0395901_0561177
1287 Ga0436365_1439059
1288 Ga0436360_1152550
1289 Ga0436361_1054128
1290 Ga0436361_1113204
1291 Ga0436363_0385066
1292 Ga0436362_0202784
1293 Ga0436362_0545994
1294 Ga0451853_1144003
1295 Ga0439433_0008413
1296 Ga0439441_002977
1297 Ga0439448_0039597
1298 Ga0439450_004867
1299 Ga0439454_007604
1300 Ga0439455_0008304
1301 Ga0450913_000929
1302 Ga0439458_0035018
1303 Ga0439464_0000760
1304 Ga0439440_0037908
1305 Ga0466963_0027299
1306 Ga0466957_0172618
1307 Ga0466957_0222437
1308 Ga0466960_0187166
1309 Ga0451576_0546804
1310 Ga0466958_0076700
1311 Ga0466967_0137823
1312 Ga0466967_0477128
1313 Ga0495603_0051081
1314 Ga0495629_0035313
1315 Ga0495662_0089119
1316 Ga0495596_0074166
1317 Ga0495663_0030168
1318 Ga0495658_0112483
1319 Ga0495670_0144533
1320 Ga0495685_045279
1321 Ga0495673_0022180
1322 Ga0496100_0235991
1323 Ga0496101_0249199
1324 Ga0496101_0250984
1325 Ga0496101_0302767
1326 Ga0496102_0147249
1327 Ga0496102_0386707
1328 Ga0496102_0455152
1329 Ga0496103_0199281
1330 Ga0496104_0073248
1331 Ga0496104_0422821
1332 Ga0496105_0042246
1333 Ga0496105_0346326
1334 Ga0496106_0212212
1335 Ga0496106_0254188
1336 Ga0496106_0298625
1337 Ga0496106_0333197
1338 Ga0496106_0360636
1339 Ga0496107_0108305
1340 Ga0496107_0265477
1341 Ga0496107_0296894
1342 Ga0496108_0154291
1343 Ga0496108_0247520
1344 Ga0496108_0340018
1345 Ga0496108_0372607
1346 Ga0496108_0376533
1347 Ga0496109_0077217
1348 Ga0496109_0081404
1349 Ga0496109_0433587
1350 Ga0496110_0177992
1351 Ga0496110_0279363
1352 Ga0496110_0462902
1353 Ga0496111_0042406
1354 Ga0496111_0175203
1355 Ga0496111_0283165
1356 Ga0496112_0512620
1357 Ga0496113_0200806
1358 Ga0496113_0312181
1359 Ga0496113_0339507
1360 Ga0496114_0117726
1361 Ga0496114_0191608
1362 Ga0496114_0232021
1363 Ga0496115_0155088
1364 Ga0496115_0307408
1365 Ga0496115_0348343
1366 Ga0496115_0358058
1367 Ga0501033_0229952
1368 Ga0501036_0340747
1369 Ga0501037_0038700
1370 Ga0501040_0248894
1371 Ga0501043_0068400
1372 Ga0501043_0072729
1373 Ga0501046_0076707
1374 Ga0501047_0288301
1375 Ga0501068_0034866
1376 Ga0501070_0045405
1377 Ga0501070_0201946
1378 Ga0501071_0245347
1379 Ga0501072_0121753
1380 Ga0501072_0181794
1381 Ga0501073_0105750
1382 Ga0501074_0031677
1383 Ga0501074_0103137
1384 Ga0501075_0273026
1385 Ga0501077_0195350
1386 Ga0501251_006292
1387 Ga0501079_0354010
1388 Ga0501080_0256531
1389 Ga0501081_0094867
1390 Ga0501083_0064396
1391 Ga0501083_0223315
1392 Ga0501035_0126452
1393 nmdc:mga05p37_305856_c1
1394 nmdc:mga05p37_594864_c1
1395 nmdc:mga09592_110595_c1
1396 nmdc:mga09592_82204_c1
1397 nmdc:mga0qj67_182250_c1
1398 nmdc:mga06r32_418718_c1
1399 nmdc:mga0rr50_215176_c1
1400 Ga0495655_0024496
1401 Ga0500643_002390
1402 Ga0500608_080032
1403 Ga0500564_049248
1404 Ga0501084_0305188
1405 Ga0501082_0012984
1406 3003669216

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13551

HTH_29

Winged helix-turn helix

27

88

0.92

PF13358

DDE_3

DDE superfamily endonuclease

164

304

0.91

PF13565

HTH_32

Homeodomain-like domain

53

124

0.88

Map